Citrus Sinensis ID: 010254

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
ccccccccccccccccEEEEEEccccccHHHHHHHHHccccccccccccccEEEcccccccEEEEEEEEccccccHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHccccccHHHHccccccccccccccccHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHccccccccccccEEccccccHHHcccccccEEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEEEEcccHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcc
cccccccccccccccEEEEEEEccccccHHHHHHHHHHcHccccccccccccEcccccccccccEEEEEcccccccHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHccccccccccHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHcccccccccccccEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccEEEcccccEEHHHHHHHHHHHHHccHHHHHHHHHHHccccccccEEEEccccHHHccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEcccccEEEEEEEEcccccHHHHHccHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccHHHcEEEEEEEEEEcc
makasaansgpggktGVRIVVCgekgtgksSLIVTAAadtfpanvppvlpptrlpedfypdrvpitiidtpssvedrgKLGEELRRADAVVLTYAcdrpetldelstfwlpelrrlevkvPVIVVGckldlrdenqqVSLEQVMMPIMQQFREIETCIECSALKQIQVkcfnsplqpseivgVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKfgynndikladelipysafkrapdqsveLTNEAIDFLKGIFELfdadddnslrpievedlfstapecpwdeapykdaaektalgglsldgfLSEWALMTLLDPARSVENLIyigypgdpssaiRVTRKRRIDRKKQQAERNVFqcfvfgpkkagkSVLLNsflgrpfsdnytpttderyavnvvdqpggtkktVVLREIPEEAVAKLLSnkdslaacDIAVFvhdssdessWKRATELLVEVASygedtgfevpCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
makasaansgpggktgVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPitiidtpssvedrgkLGEELRRADAVVLTYACDRPETLDELstfwlpelrrlevKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFnsplqpseivgvKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYigypgdpssairvTRKRRidrkkqqaernvfqcfvfgpkkagKSVLLNSFLGRPFSDNYTPTTDeryavnvvdqpggtkktvvlrEIPEEAVAKLLSNKDSLAACDIAVFvhdssdesswKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
***************GVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDT***********EELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGD*********************RNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLY*
******************IVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSE**********************LAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSS*I******************VFQCFVFGPKKAGKSVLLNSFLGRPF******TTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
*************KTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
*************KTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDR*KQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRVFTFLVMVLYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q5ZM83618 Mitochondrial Rho GTPase yes no 0.898 0.747 0.351 2e-81
P0CO78686 Mitochondrial Rho GTPase yes no 0.910 0.682 0.316 5e-76
P0CO79686 Mitochondrial Rho GTPase N/A no 0.910 0.682 0.316 5e-76
Q6DIS1616 Mitochondrial Rho GTPase yes no 0.889 0.741 0.338 8e-75
Q4PB75 752 Mitochondrial Rho GTPase N/A no 0.904 0.618 0.326 2e-74
Q8IXI1618 Mitochondrial Rho GTPase yes no 0.889 0.739 0.343 3e-74
Q5E9M9618 Mitochondrial Rho GTPase yes no 0.889 0.739 0.343 5e-74
Q2HJF8631 Mitochondrial Rho GTPase no no 0.904 0.736 0.331 2e-73
Q8BG51631 Mitochondrial Rho GTPase yes no 0.904 0.736 0.329 3e-73
Q8IXI2618 Mitochondrial Rho GTPase no no 0.904 0.752 0.327 7e-73
>sp|Q5ZM83|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1 Back     alignment and function desciption
 Score =  303 bits (777), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 192/546 (35%), Positives = 279/546 (51%), Gaps = 84/546 (15%)

Query: 14  KTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSS 73
           K  VRI++ GE   GK+SLI+    + FP  VPP      +P D  P++VP  I+D   S
Sbjct: 2   KRDVRILLLGEAQVGKTSLIMALVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSES 61

Query: 74  VEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELR---RLEVKVPVIVVGCKLD 130
            +   +L EE+ +A+ V + Y   +  T++++ T W+P +        ++P+I+VG K D
Sbjct: 62  EQTEDELQEEIAKANVVCVVYDVTKEATIEKIRTKWIPMVNGGAEKGARIPIILVGNKSD 121

Query: 131 LRDENQQVSLEQVMMPIMQQFREIETCIECSAL--------------------------- 163
           L    Q  S  +V++PIM QF EIETC+ECSA                            
Sbjct: 122 L----QMGSSMEVILPIMNQFSEIETCVECSAKNLKNISELFYYAQKAVLHPTAPLYDPE 177

Query: 164 -KQIQVKC-------FN------------------------SPLQPSEIVGVKRVVQEKL 191
            KQ++  C       FN                        +PL P  +  VK VV +  
Sbjct: 178 EKQLRPACSRALTRIFNLSDQDNNQILSDDELNYFQKSCFGNPLAPQALEDVKMVVWKNT 237

Query: 192 REGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPD 251
            +GV + GLTL GFLFL+ LFI++GR ETTWT+LR+FGY+++++L D+ + Y  F+  P 
Sbjct: 238 TDGVQDNGLTLNGFLFLNTLFIQRGRHETTWTILRRFGYDDELELTDDYL-YPQFRLPPG 296

Query: 252 QSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALG 311
            S EL +    FL+ +FE  D D D +L P E+++ FS  P  PW    Y      T  G
Sbjct: 297 CSTELNHLGYQFLQRLFEKHDKDQDGALSPAELQNFFSVFPCMPWGPELYNTVC-TTDKG 355

Query: 312 GLSLDGFLSEWALMTLLDPARSVENLIYIGYP-----GDPSSAIRVTRKRRIDRKKQQAE 366
            LSL GFL +W L+  LD    +E L Y+GYP        + A+ VTR++RID +K Q +
Sbjct: 356 LLSLHGFLCQWTLIAYLDVRHCLECLGYLGYPILSEQDSQTQALTVTREKRIDLEKGQTQ 415

Query: 367 RNVFQCFVFGPKKAGKSVLLNSFLGRPF-SDNYTPTTDERYAVNVVDQPGGTKKTVVLRE 425
           RNVF C V G + AGKS  L +FLGR   +   +P     Y +N V Q  G +K ++L E
Sbjct: 416 RNVFLCKVLGARGAGKSAFLQAFLGRSLAAQRESPGEPSPYTINTV-QVNGQEKYLILHE 474

Query: 426 IPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIV 485
           +  E        K S AACD+A  ++D SD  S+     +  +   Y +    ++PC+ V
Sbjct: 475 VSAETQF----TKPSDAACDVACLIYDLSDPKSFSYCASIYKQ--HYMDS---QIPCVFV 525

Query: 486 AAKDDL 491
           A+K DL
Sbjct: 526 ASKTDL 531
Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -
>sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 Back     alignment and function description
>sp|Q6DIS1|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1 Back     alignment and function description
>sp|Q4PB75|GEM1_USTMA Mitochondrial Rho GTPase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GEM1 PE=3 SV=1 Back     alignment and function description
>sp|Q8IXI1|MIRO2_HUMAN Mitochondrial Rho GTPase 2 OS=Homo sapiens GN=RHOT2 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9M9|MIRO2_BOVIN Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJF8|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG51|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IXI2|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
150036254 647 ATP/GTP/Ca++ binding protein [Cucumis me 0.978 0.777 0.703 0.0
224125274 651 predicted protein [Populus trichocarpa] 0.959 0.757 0.701 0.0
449442827 647 PREDICTED: mitochondrial Rho GTPase 1-li 0.978 0.777 0.698 0.0
449482860 648 PREDICTED: mitochondrial Rho GTPase 1-li 0.978 0.776 0.693 0.0
224131044 651 predicted protein [Populus trichocarpa] 0.974 0.769 0.692 0.0
296088320 684 unnamed protein product [Vitis vinifera] 0.978 0.735 0.628 0.0
225450975 647 PREDICTED: mitochondrial Rho GTPase 1 [V 0.978 0.777 0.628 0.0
225436934 639 PREDICTED: mitochondrial Rho GTPase 1 [V 0.926 0.744 0.646 0.0
224082628 645 predicted protein [Populus trichocarpa] 0.964 0.768 0.598 0.0
115456129 642 Os03g0810600 [Oryza sativa Japonica Grou 0.947 0.758 0.613 0.0
>gi|150036254|gb|ABR67417.1| ATP/GTP/Ca++ binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/563 (70%), Positives = 452/563 (80%), Gaps = 60/563 (10%)

Query: 1   MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYP 60
           MA+A A+N   GG+T VRIV+ G++GTGKSSLIVTAAAD FP NVPPVLPPTRLPEDFYP
Sbjct: 1   MARAPASNVHSGGRTEVRIVIAGDRGTGKSSLIVTAAADNFPVNVPPVLPPTRLPEDFYP 60

Query: 61  DRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKV 120
           DRVP TIIDT S  ED  K+ EEL+RADAVVLTYACD+P TLD LSTFWLP+LR+LEV+V
Sbjct: 61  DRVPTTIIDTSSRTEDSAKVAEELKRADAVVLTYACDQPNTLDRLSTFWLPKLRQLEVRV 120

Query: 121 PVIVVGCKLDLRDENQQVSLEQVMMPIMQQ------------FREIET------------ 156
           PVIVVGCKLDLRDENQQVSLEQVM PIMQQ            F+ I+             
Sbjct: 121 PVIVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAFKHIQIPEVFYYAQKAVL 180

Query: 157 -----------------CIEC------------------SALKQIQVKCFNSPLQPSEIV 181
                            C+                    + L   QVKCFN+PLQPSEIV
Sbjct: 181 HPTGPLFDQETQTLKPRCVRALKRIFILCDHDKDGALSDAELNDFQVKCFNAPLQPSEIV 240

Query: 182 GVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELI 241
           GVKRVVQEKL EGVN+RGLTL GFLFLHALFIEKGRLETTWTVLRKFGY+NDIKL+DELI
Sbjct: 241 GVKRVVQEKLPEGVNDRGLTLTGFLFLHALFIEKGRLETTWTVLRKFGYDNDIKLSDELI 300

Query: 242 PYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPY 301
           P +  KRAPDQSVELTNEA++FL+GIFEL+D D D +LRP ++E+LFSTAPE PW+EAPY
Sbjct: 301 P-TLGKRAPDQSVELTNEALEFLRGIFELYDGDGDGALRPRDLEELFSTAPESPWNEAPY 359

Query: 302 KDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRK 361
           KD+AE+ A+GGLS+D FLS W+LMTLL+P  ++ENLIYIGY GDP+SA+RVTRKRR+DRK
Sbjct: 360 KDSAERNAMGGLSIDDFLSLWSLMTLLNPVYTIENLIYIGYSGDPASAVRVTRKRRLDRK 419

Query: 362 KQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTV 421
           KQQ +RNV QCFVFGPKKAGKS LL++FL RPFS  YTPTT+ERYAVNVVDQP GTKKT+
Sbjct: 420 KQQLDRNVLQCFVFGPKKAGKSSLLDAFLARPFSVTYTPTTEERYAVNVVDQPEGTKKTL 479

Query: 422 VLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVP 481
           +LREIPE+ V KLLS+K+SLAACDIA+FVHDSSDESSWK+AT+LLVEVAS+GEDTG+EVP
Sbjct: 480 ILREIPEDGVKKLLSSKESLAACDIALFVHDSSDESSWKKATDLLVEVASHGEDTGYEVP 539

Query: 482 CLIVAAKDDLDSFAMAIQDSTRV 504
           CLIVAAKDDLDSF +AIQDSTRV
Sbjct: 540 CLIVAAKDDLDSFPLAIQDSTRV 562

Source: Cucumis melo subsp. melo

Species: Cucumis melo

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125274|ref|XP_002319545.1| predicted protein [Populus trichocarpa] gi|222857921|gb|EEE95468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449442827|ref|XP_004139182.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449482860|ref|XP_004156425.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224131044|ref|XP_002328439.1| predicted protein [Populus trichocarpa] gi|222838154|gb|EEE76519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296088320|emb|CBI36765.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450975|ref|XP_002284757.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225436934|ref|XP_002275434.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera] gi|296086704|emb|CBI32339.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224082628|ref|XP_002306771.1| predicted protein [Populus trichocarpa] gi|222856220|gb|EEE93767.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115456129|ref|NP_001051665.1| Os03g0810600 [Oryza sativa Japonica Group] gi|50540759|gb|AAT77915.1| expressed protein [Oryza sativa Japonica Group] gi|108711690|gb|ABF99485.1| small GTP-binding protein domain containing protein, expressed [Oryza sativa Japonica Group] gi|113550136|dbj|BAF13579.1| Os03g0810600 [Oryza sativa Japonica Group] gi|125546156|gb|EAY92295.1| hypothetical protein OsI_14016 [Oryza sativa Indica Group] gi|215678858|dbj|BAG95295.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
TAIR|locus:2146385648 MIRO1 "MIRO-related GTP-ase 1" 0.663 0.526 0.774 1.6e-206
TAIR|locus:2099232643 MIRO2 "MIRO-related GTP-ase 2" 0.682 0.545 0.616 9.2e-178
TAIR|locus:2096224648 MIRO3 "MIRO-related GTP-ase 3" 0.663 0.526 0.573 2e-149
UNIPROTKB|Q5ZM83618 RHOT2 "Mitochondrial Rho GTPas 0.616 0.512 0.397 1.7e-84
UNIPROTKB|F1P578581 RHOT2 "Mitochondrial Rho GTPas 0.616 0.545 0.389 1.3e-82
UNIPROTKB|F1P577547 RHOT2 "Mitochondrial Rho GTPas 0.564 0.530 0.405 1.2e-81
UNIPROTKB|G1K237631 RHOT1 "Mitochondrial Rho GTPas 0.601 0.489 0.401 1.1e-80
UNIPROTKB|Q2HJF8631 RHOT1 "Mitochondrial Rho GTPas 0.601 0.489 0.401 1.7e-80
UNIPROTKB|J9NUJ0 720 RHOT1 "Mitochondrial Rho GTPas 0.601 0.429 0.395 2.8e-80
UNIPROTKB|F1PP14 691 RHOT1 "Mitochondrial Rho GTPas 0.601 0.447 0.395 2.8e-80
TAIR|locus:2146385 MIRO1 "MIRO-related GTP-ase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1392 (495.1 bits), Expect = 1.6e-206, Sum P(2) = 1.6e-206
 Identities = 265/342 (77%), Positives = 303/342 (88%)

Query:   163 LKQIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTW 222
             L   QVKCF++PLQPSEI GVKRVVQEKL EGVNERGLT+ GFLFLHALFIEKGRLETTW
Sbjct:   223 LNDFQVKCFHAPLQPSEIEGVKRVVQEKLPEGVNERGLTVTGFLFLHALFIEKGRLETTW 282

Query:   223 TVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPI 282
             TVLRKFGYNNDI+LA+EL+P + FKRAPDQS ELTN AIDFLKG++ LFD D DN+LRP 
Sbjct:   283 TVLRKFGYNNDIRLAEELLPSAIFKRAPDQSFELTNAAIDFLKGMYMLFDDDQDNNLRPQ 342

Query:   283 EVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGY 342
             E+EDLFSTAPE PW EAPY+DAAEKTALGGLS D FLS W+LMTLL+PARSVENLIYIG+
Sbjct:   343 EIEDLFSTAPESPWKEAPYEDAAEKTALGGLSFDAFLSMWSLMTLLEPARSVENLIYIGF 402

Query:   343 PGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTT 402
             PGDPS+AIRVTR+RR+DRKKQQ ER VFQCFVFGP  AGKS LLN FLGR ++DN   TT
Sbjct:   403 PGDPSTAIRVTRRRRLDRKKQQCERKVFQCFVFGPNNAGKSALLNCFLGRSYTDNQESTT 462

Query:   403 DERYAVNVVDQPGGTKKTVVLREIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRA 462
             DERYAVN+VD+  G KKT+++REIPE+ V  L S+K+SLAACDIAVFV+DSSDESSWKRA
Sbjct:   463 DERYAVNMVDE-SGAKKTLIMREIPEDGVQGLFSSKESLAACDIAVFVYDSSDESSWKRA 521

Query:   463 TELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAMAIQDSTRV 504
             T+LLVEVA+YGE TG+EVPCL+V+AKDDLDS  ++IQ+STR+
Sbjct:   522 TQLLVEVANYGEATGYEVPCLMVSAKDDLDSSPISIQESTRM 563
GO:0003924 "GTPase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA;NAS
GO:0019725 "cellular homeostasis" evidence=IEA
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0009790 "embryo development" evidence=IMP
GO:0009860 "pollen tube growth" evidence=IMP
GO:0005829 "cytosol" evidence=RCA
GO:0000003 "reproduction" evidence=RCA
GO:0000741 "karyogamy" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006325 "chromatin organization" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009933 "meristem structural organization" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
GO:0051301 "cell division" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
GO:0051645 "Golgi localization" evidence=RCA
GO:0051646 "mitochondrion localization" evidence=RCA
GO:0060151 "peroxisome localization" evidence=RCA
TAIR|locus:2099232 MIRO2 "MIRO-related GTP-ase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096224 MIRO3 "MIRO-related GTP-ase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM83 RHOT2 "Mitochondrial Rho GTPase 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P578 RHOT2 "Mitochondrial Rho GTPase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P577 RHOT2 "Mitochondrial Rho GTPase 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K237 RHOT1 "Mitochondrial Rho GTPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJF8 RHOT1 "Mitochondrial Rho GTPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUJ0 RHOT1 "Mitochondrial Rho GTPase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP14 RHOT1 "Mitochondrial Rho GTPase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 5e-78
cd01892180 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2) 2e-51
pfam0835689 pfam08356, EF_assoc_2, EF hand associated 1e-42
pfam0835575 pfam08355, EF_assoc_1, EF hand associated 2e-31
pfam08477116 pfam08477, Miro, Miro-like protein 2e-20
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 2e-19
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 8e-19
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 3e-15
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-14
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 2e-14
pfam00071162 pfam00071, Ras, Ras family 4e-13
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 5e-12
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 9e-12
cd01873195 cd01873, RhoBTB, RhoBTB protein is an atypical mem 8e-11
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 1e-10
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 2e-10
pfam08477116 pfam08477, Miro, Miro-like protein 4e-10
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 1e-09
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 1e-09
cd04133173 cd04133, Rop_like, Rho-related protein from plants 2e-09
cd01871174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 3e-09
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 6e-09
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 1e-08
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 1e-08
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 2e-08
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 6e-08
cd01874175 cd01874, Cdc42, cell division cycle 42 (Cdc42) is 4e-07
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 1e-06
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 2e-06
cd00880161 cd00880, Era_like, E 2e-06
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 2e-06
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-06
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 4e-06
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 5e-06
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 9e-06
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 2e-05
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 3e-05
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 4e-05
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 1e-04
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 1e-04
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 3e-04
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 3e-04
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 4e-04
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 4e-04
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 5e-04
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 5e-04
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 6e-04
COG0486454 COG0486, ThdF, Predicted GTPase [General function 6e-04
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 7e-04
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 0.001
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 0.002
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 0.002
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 0.002
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 0.002
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 0.002
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 0.003
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 0.003
cd04163168 cd04163, Era, E 0.004
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information 
 Score =  241 bits (617), Expect = 5e-78
 Identities = 83/154 (53%), Positives = 109/154 (70%)

Query: 15  TGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSV 74
             VRIV+ G++G GKSSLI++  ++ FP NVP VLP   +P D  P+RVP TI+DT S  
Sbjct: 1   KDVRIVLIGDEGVGKSSLIMSLVSEEFPENVPRVLPEITIPADVTPERVPTTIVDTSSRP 60

Query: 75  EDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDE 134
           +DR  L  E+R+A+ + L Y+ DRP TL+ + T WLP +RRL VKVP+I+VG K DLRD 
Sbjct: 61  QDRANLAAEIRKANVICLVYSVDRPSTLERIRTKWLPLIRRLGVKVPIILVGNKSDLRDG 120

Query: 135 NQQVSLEQVMMPIMQQFREIETCIECSALKQIQV 168
           + Q  LE+ M+PIM +FREIETC+ECSA   I V
Sbjct: 121 SSQAGLEEEMLPIMNEFREIETCVECSAKTLINV 154

Miro1 subfamily. Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the N-terminal GTPase domain of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature. Length = 168
>gnl|CDD|206679 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2), C-terminal Back     alignment and domain information
>gnl|CDD|192013 pfam08356, EF_assoc_2, EF hand associated Back     alignment and domain information
>gnl|CDD|192012 pfam08355, EF_assoc_1, EF hand associated Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 100.0
COG1160 444 Predicted GTPases [General function prediction onl 100.0
PRK03003 472 GTP-binding protein Der; Reviewed 100.0
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 100.0
PRK00093 435 GTP-binding protein Der; Reviewed 100.0
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 100.0
COG0486454 ThdF Predicted GTPase [General function prediction 100.0
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.97
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.96
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.95
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.95
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.95
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.95
KOG0394210 consensus Ras-related GTPase [General function pre 99.95
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.95
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.94
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.94
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.94
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.94
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.94
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.94
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.94
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.94
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.94
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.94
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.94
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.93
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.93
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.93
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.93
KOG0394210 consensus Ras-related GTPase [General function pre 99.93
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.93
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.93
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.93
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.93
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.93
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.93
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.92
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.92
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.92
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.92
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.92
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.92
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.92
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.92
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.92
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.92
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.92
PTZ00369189 Ras-like protein; Provisional 99.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.92
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.92
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.92
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.92
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.92
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.91
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.91
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.91
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.91
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.91
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.91
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.91
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.91
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.91
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.91
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.91
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.91
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.91
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.91
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.91
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.91
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.91
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.91
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.91
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.91
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.91
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.91
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.91
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.91
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.91
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.91
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.9
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.9
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.9
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.9
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.9
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.9
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.9
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.9
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.9
PLN03118211 Rab family protein; Provisional 99.9
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.9
COG1159298 Era GTPase [General function prediction only] 99.9
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.9
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.9
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.9
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.9
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.9
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.9
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.9
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.9
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.9
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.9
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.9
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.9
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.9
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.9
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.9
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.89
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.89
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.89
PLN03110216 Rab GTPase; Provisional 99.89
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.89
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.89
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.89
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.89
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.89
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.89
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.89
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.89
PLN00223181 ADP-ribosylation factor; Provisional 99.89
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.89
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.89
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.89
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.89
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.88
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.88
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.88
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.88
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.88
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.88
PTZ00133182 ADP-ribosylation factor; Provisional 99.88
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.88
PLN03108210 Rab family protein; Provisional 99.88
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.88
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.88
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.88
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.88
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.88
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.88
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.88
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.88
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.88
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.88
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.88
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.88
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.88
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.88
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.88
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.87
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.87
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.87
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.87
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.87
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.87
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.87
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.87
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.87
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.87
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.87
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.87
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.87
PLN00023 334 GTP-binding protein; Provisional 99.87
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.87
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.87
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.87
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.87
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.87
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.87
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.87
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.87
PLN03110216 Rab GTPase; Provisional 99.87
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.87
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.87
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.86
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.86
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.86
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.86
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.86
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.86
PTZ00369189 Ras-like protein; Provisional 99.86
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.86
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.86
PLN03108210 Rab family protein; Provisional 99.86
COG1160444 Predicted GTPases [General function prediction onl 99.86
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.86
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.86
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.86
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.86
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.86
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.86
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.86
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.85
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.85
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.85
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.85
PRK15494339 era GTPase Era; Provisional 99.85
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.85
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.85
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.85
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.85
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.85
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.85
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.85
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.85
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.85
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.85
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.85
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.85
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.85
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.85
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.84
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.84
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.84
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.84
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.84
KOG0395196 consensus Ras-related GTPase [General function pre 99.84
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.84
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.84
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.84
KOG0395196 consensus Ras-related GTPase [General function pre 99.84
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.83
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.83
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.83
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.83
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.83
PRK12299335 obgE GTPase CgtA; Reviewed 99.83
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.83
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.83
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.83
PRK03003472 GTP-binding protein Der; Reviewed 99.83
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.83
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.82
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.82
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.82
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.82
PRK00089292 era GTPase Era; Reviewed 99.82
PLN03118211 Rab family protein; Provisional 99.82
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.82
cd00881189 GTP_translation_factor GTP translation factor fami 99.82
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.82
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.82
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.81
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.81
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.81
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.81
KOG4252246 consensus GTP-binding protein [Signal transduction 99.81
PLN00023334 GTP-binding protein; Provisional 99.81
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.81
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.81
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.81
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.81
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.81
PRK12298390 obgE GTPase CgtA; Reviewed 99.8
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.8
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.8
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.8
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.8
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.8
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.79
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.79
PRK12297424 obgE GTPase CgtA; Reviewed 99.79
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.79
PRK00093435 GTP-binding protein Der; Reviewed 99.79
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.79
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.79
PRK11058426 GTPase HflX; Provisional 99.79
PRK12296500 obgE GTPase CgtA; Reviewed 99.78
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.78
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.78
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.78
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.78
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.78
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.77
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.77
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.77
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.77
KOG4252246 consensus GTP-binding protein [Signal transduction 99.77
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.77
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.77
PLN00223181 ADP-ribosylation factor; Provisional 99.77
COG1100219 GTPase SAR1 and related small G proteins [General 99.77
PRK04213201 GTP-binding protein; Provisional 99.77
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.77
PTZ00133182 ADP-ribosylation factor; Provisional 99.76
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.76
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.76
COG0218200 Predicted GTPase [General function prediction only 99.76
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.76
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.76
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.76
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.76
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.76
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.75
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.75
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.75
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.75
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.74
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.74
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.74
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.74
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.74
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.74
CHL00189742 infB translation initiation factor 2; Provisional 99.73
PRK05306787 infB translation initiation factor IF-2; Validated 99.73
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.73
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.73
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.73
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.73
PF0835576 EF_assoc_1: EF hand associated; InterPro: IPR01356 99.73
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.72
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.72
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.71
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.7
PRK12317425 elongation factor 1-alpha; Reviewed 99.7
PTZ00099176 rab6; Provisional 99.69
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.69
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.69
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.69
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.69
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.69
cd01896233 DRG The developmentally regulated GTP-binding prot 99.69
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.69
cd04105203 SR_beta Signal recognition particle receptor, beta 99.68
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.68
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.68
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.68
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.68
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.68
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.68
COG1100219 GTPase SAR1 and related small G proteins [General 99.68
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.67
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.67
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.67
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.67
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.67
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.67
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.67
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.67
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.67
COG2262411 HflX GTPases [General function prediction only] 99.67
PRK05433600 GTP-binding protein LepA; Provisional 99.67
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.66
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.66
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.66
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.66
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.65
PRK12735396 elongation factor Tu; Reviewed 99.65
PRK12736394 elongation factor Tu; Reviewed 99.65
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.64
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.64
cd04105203 SR_beta Signal recognition particle receptor, beta 99.64
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.64
COG1159 298 Era GTPase [General function prediction only] 99.64
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.64
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.64
PF0835689 EF_assoc_2: EF hand associated; InterPro: IPR01356 99.64
PRK04004586 translation initiation factor IF-2; Validated 99.64
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.64
COG3596296 Predicted GTPase [General function prediction only 99.63
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.63
PRK10218607 GTP-binding protein; Provisional 99.63
COG1163365 DRG Predicted GTPase [General function prediction 99.63
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.63
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.63
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.63
CHL00071409 tufA elongation factor Tu 99.63
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.62
COG2229187 Predicted GTPase [General function prediction only 99.62
PRK12299335 obgE GTPase CgtA; Reviewed 99.62
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.62
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.62
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.61
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.61
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.6
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.6
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.6
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.59
PRK12289352 GTPase RsgA; Reviewed 99.59
PLN03127447 Elongation factor Tu; Provisional 99.59
PRK00049396 elongation factor Tu; Reviewed 99.58
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.58
COG1084346 Predicted GTPase [General function prediction only 99.58
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.58
PTZ00099176 rab6; Provisional 99.58
KOG1673205 consensus Ras GTPases [General function prediction 99.58
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.58
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.58
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.57
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.57
PRK09866741 hypothetical protein; Provisional 99.57
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.57
PRK11058426 GTPase HflX; Provisional 99.57
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.57
PRK15494 339 era GTPase Era; Provisional 99.57
COG0486454 ThdF Predicted GTPase [General function prediction 99.57
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.57
PLN03126478 Elongation factor Tu; Provisional 99.57
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.56
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.56
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.56
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.55
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.55
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.55
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.54
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.54
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.54
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.54
PRK12288347 GTPase RsgA; Reviewed 99.54
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.54
PRK09563287 rbgA GTPase YlqF; Reviewed 99.53
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.53
PRK09602396 translation-associated GTPase; Reviewed 99.52
PRK00089 292 era GTPase Era; Reviewed 99.52
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.52
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.51
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.51
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.51
PRK00741526 prfC peptide chain release factor 3; Provisional 99.51
COG0536369 Obg Predicted GTPase [General function prediction 99.51
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.51
PRK13351 687 elongation factor G; Reviewed 99.51
PRK12297 424 obgE GTPase CgtA; Reviewed 99.5
PRK00098298 GTPase RsgA; Reviewed 99.5
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.5
PRK12298390 obgE GTPase CgtA; Reviewed 99.49
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.49
PRK04213201 GTP-binding protein; Provisional 99.49
PRK12739 691 elongation factor G; Reviewed 99.48
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.48
KOG1673205 consensus Ras GTPases [General function prediction 99.48
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.48
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.48
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.48
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.47
PRK12296 500 obgE GTPase CgtA; Reviewed 99.47
KOG1145683 consensus Mitochondrial translation initiation fac 99.46
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.46
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.46
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.46
TIGR00503527 prfC peptide chain release factor 3. This translat 99.45
KOG1191 531 consensus Mitochondrial GTPase [Translation, ribos 99.45
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.45
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.44
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.43
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.43
PTZ00141446 elongation factor 1- alpha; Provisional 99.43
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.43
cd00881189 GTP_translation_factor GTP translation factor fami 99.43
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.42
PRK00007 693 elongation factor G; Reviewed 99.42
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.42
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.42
KOG0462650 consensus Elongation factor-type GTP-binding prote 99.42
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.42
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.41
PLN00043447 elongation factor 1-alpha; Provisional 99.41
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.41
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.41
COG0218200 Predicted GTPase [General function prediction only 99.4
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.39
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.39
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.39
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.39
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.38
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 99.38
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 99.38
PRK13796365 GTPase YqeH; Provisional 99.37
PRK12740 668 elongation factor G; Reviewed 99.37
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.37
KOG1423 379 consensus Ras-like GTPase ERA [Cell cycle control, 99.37
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.36
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.36
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.35
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.35
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.35
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 99.34
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.33
KOG0090238 consensus Signal recognition particle receptor, be 99.32
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.32
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.32
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.31
COG2262411 HflX GTPases [General function prediction only] 99.31
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.3
COG1084346 Predicted GTPase [General function prediction only 99.3
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.3
COG2229187 Predicted GTPase [General function prediction only 99.3
PTZ00258390 GTP-binding protein; Provisional 99.29
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.29
PRK12317 425 elongation factor 1-alpha; Reviewed 99.28
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.28
PRK13768253 GTPase; Provisional 99.28
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.28
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.27
CHL00189 742 infB translation initiation factor 2; Provisional 99.26
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.26
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.26
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.25
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.25
cd01896233 DRG The developmentally regulated GTP-binding prot 99.25
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.24
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-80  Score=600.37  Aligned_cols=490  Identities=51%  Similarity=0.833  Sum_probs=451.1

Q ss_pred             CCCCceeEEEEEcCCCCCHHHHHHHHhcCCCCCCCCCCCCCcccccceeCCeeEEEEEeCCCCccchhhHHHhhhccCEE
Q 010254           11 PGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAV   90 (514)
Q Consensus        11 ~~~~~~~~I~ivG~~nvGKSsLin~l~~~~~~~~~~~~~~~tt~~~~~~~~~~~~~l~Dt~G~~~~~~~~~~~~~~ad~i   90 (514)
                      .+.+..+||+++|+.||||||||-+|+..++..++++..+.++++..+.++.++..|+||+.-++......+.+++||+|
T Consensus         4 ~~t~kdVRIvliGD~G~GKtSLImSL~~eef~~~VP~rl~~i~IPadvtPe~vpt~ivD~ss~~~~~~~l~~EirkA~vi   83 (625)
T KOG1707|consen    4 DETLKDVRIVLIGDEGVGKTSLIMSLLEEEFVDAVPRRLPRILIPADVTPENVPTSIVDTSSDSDDRLCLRKEIRKADVI   83 (625)
T ss_pred             ccCccceEEEEECCCCccHHHHHHHHHhhhccccccccCCccccCCccCcCcCceEEEecccccchhHHHHHHHhhcCEE
Confidence            45678899999999999999999999999999999999999999999999999999999998777777788899999999


Q ss_pred             EEEEeCCCcccHHHHHHHHHHHHHhcC---CCCcEEEEEecccCcccccchhHhhhhHHHHHHHhccCcEEEcCccccc-
Q 010254           91 VLTYACDRPETLDELSTFWLPELRRLE---VKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQI-  166 (514)
Q Consensus        91 i~v~d~~~~~s~~~~~~~~~~~l~~~~---~~~pvilv~NK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~Sa~~~~-  166 (514)
                      ++||+++++.+++.+..+|++.+++..   .+.|||+||||+|+... ...+.+..+..++.+|.+++.||+|||++.. 
T Consensus        84 ~lvyavd~~~T~D~ist~WLPlir~~~~~~~~~PVILvGNK~d~~~~-~~~s~e~~~~pim~~f~EiEtciecSA~~~~n  162 (625)
T KOG1707|consen   84 CLVYAVDDESTVDRISTKWLPLIRQLFGDYHETPVILVGNKSDNGDN-ENNSDEVNTLPIMIAFAEIETCIECSALTLAN  162 (625)
T ss_pred             EEEEecCChHHhhhhhhhhhhhhhcccCCCccCCEEEEeeccCCccc-cccchhHHHHHHHHHhHHHHHHHhhhhhhhhh
Confidence            999999999999999999999999987   78999999999999876 3334455688999999999999999999876 


Q ss_pred             ----------------------------------------------------------cceecCCCCChhhHHHHHHHHH
Q 010254          167 ----------------------------------------------------------QVKCFNSPLQPSEIVGVKRVVQ  188 (514)
Q Consensus       167 ----------------------------------------------------------~~~~f~~~l~~~~i~~L~~~i~  188 (514)
                                                                                ++.||+.+++++.++.++..+.
T Consensus       163 ~~e~fYyaqKaVihPt~PLyda~~qelkp~~v~al~RIFki~D~d~D~~Lsd~Eln~fQ~~CF~~pl~p~~l~~vk~vv~  242 (625)
T KOG1707|consen  163 VSELFYYAQKAVIHPTSPLYDAEEQELKPRCVKALKRIFKISDSDNDGALSDAELNDFQKKCFNTPLDPQELEDVKNVVQ  242 (625)
T ss_pred             hHhhhhhhhheeeccCccccccccccccHHHHHHHHHHHhhhccccccccchhhhhHHHHHhcCCCCCHHHHHHHHHHHH
Confidence                                                                      6699999999999999999999


Q ss_pred             HHhcCcccCCCcchhhHHHHHHHHHhcCCcchhhHHHhhccCCCccccccCCCCCCCccCCCCCceecChhHHHHHHHHH
Q 010254          189 EKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYSAFKRAPDQSVELTNEAIDFLKGIF  268 (514)
Q Consensus       189 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~~~~~~~L~~~~~~~~~~~~~~~~~~~~l~~~~~~~~elt~~~~~~L~~iF  268 (514)
                      +.+|++..+.++++.||++++.+|++|||++++|.+||+|+|++++++..++++. .+..+++++.|+++.+++||..+|
T Consensus       243 e~~p~gv~~~~ltl~GFLfL~~lfiergr~EttW~iLR~fgY~DsleL~~~~l~p-~~~~~p~~s~ELs~~~~~Fl~~~f  321 (625)
T KOG1707|consen  243 EICPDGVYERGLTLPGFLFLNTLFIERGRHETTWTILRKFGYTDSLELTDEYLPP-RLKVPPDQSVELSPKGYRFLVDVF  321 (625)
T ss_pred             hhcCchhhhccccccchHHHHHHHHHhccccchhhhhhhcCCcchhhhhhhhcCc-cccCCCCcceeccHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999974 999999999999999999999999


Q ss_pred             HhhcCCCCCCCCHHhHHhhhccCCCCCCCCCcccccccccCCCcccHHHHHHHhhhhhcCCHHHHHHHHHHhCCCCC---
Q 010254          269 ELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWALMTLLDPARSVENLIYIGYPGD---  345 (514)
Q Consensus       269 ~~fd~~~d~~l~~~~l~~~f~~~~~~p~~~~~~~~~~~~~~~~~i~~~~~~~~w~~~~~~~~~~~~~~l~~~g~~~~---  345 (514)
                      .+||.|+||+|++.|+..+|+++|..||....+++..+.++.|++|+++|+++|+++|++|+..+++||.|+||+..   
T Consensus       322 ~~~D~d~Dg~L~p~El~~LF~~~P~~pW~~~~~~~~t~~~~~G~ltl~g~l~~WsL~Tlld~~~t~~~L~Ylgf~~~~~~  401 (625)
T KOG1707|consen  322 EKFDRDNDGALSPEELKDLFSTAPGSPWTSSPYKDSTVKNERGWLTLNGFLSQWSLMTLLDPRRTLEYLAYLGFPTDAGS  401 (625)
T ss_pred             HhccCCCCCCcCHHHHHHHhhhCCCCCCCCCcccccceecccceeehhhHHHHHHHHhhccHHHHHHHHHhcCCcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999976   


Q ss_pred             hhhHHHHhhhhhhhhhhhcccCCeEEEEEeCCCCCChHHHHHHhhCCCCCCCCCCCCCccEEEEEEECCCCcEEEEEEec
Q 010254          346 PSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYTPTTDERYAVNVVDQPGGTKKTVVLRE  425 (514)
Q Consensus       346 ~~~a~~~~~~~~~~~~~~~~~~~~~ki~iiG~~~vGKSsLi~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~dt  425 (514)
                      +.++++++|+|+.+++++..+|.+++|+++|+.++|||.|++.|++..+...+..+...++.++.+... ++.+++++.+
T Consensus       402 ~~~ai~vtRkr~~d~~~~~~~R~Vf~C~V~G~k~~GKs~lL~sflgr~~~~~~~~~~~~~~avn~v~~~-g~~k~LiL~e  480 (625)
T KOG1707|consen  402 QASAIRVTRKRKLDRKKKQTDRKVFQCFVVGPKNCGKSALLQSFLGRSMSDNNTGTTKPRYAVNSVEVK-GQQKYLILRE  480 (625)
T ss_pred             cccceehhhhhhhhhccccccceeeeEEEEcCCcCchHHHHHHHhccccccccccCCCCceeeeeeeec-cccceEEEee
Confidence            899999999999999999999999999999999999999999999999988666788889999999999 8999999999


Q ss_pred             CChhHHHhhhcCccccccCcEEEEEEeCCChhhHHHHHHHHHHHHhcCCCCCCCCcEEEEEeCCCCccccc-chhhHHHH
Q 010254          426 IPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCLIVAAKDDLDSFAM-AIQDSTRV  504 (514)
Q Consensus       426 ~g~~~~~~~~~~~~~~~~~d~vilv~D~~~~~s~~~~~~~~~~~~~~~~~~~~~~p~ilv~nK~Dl~~~~~-~~~~~~~~  504 (514)
                      +|..... ....++  ..||+++++||++++.||+.+...+.......     ..||++|++|+|+.+.++ ......++
T Consensus       481 i~~~~~~-~l~~ke--~~cDv~~~~YDsS~p~sf~~~a~v~~~~~~~~-----~~Pc~~va~K~dlDe~~Q~~~iqpde~  552 (625)
T KOG1707|consen  481 IGEDDQD-FLTSKE--AACDVACLVYDSSNPRSFEYLAEVYNKYFDLY-----KIPCLMVATKADLDEVPQRYSIQPDEF  552 (625)
T ss_pred             cCccccc-cccCcc--ceeeeEEEecccCCchHHHHHHHHHHHhhhcc-----CCceEEEeeccccchhhhccCCChHHH
Confidence            9875332 333344  88999999999999999999988877655443     799999999999988653 33445899


Q ss_pred             HHHcCCc
Q 010254          505 FTFLVMV  511 (514)
Q Consensus       505 ~~~~~~~  511 (514)
                      |++++++
T Consensus       553 ~~~~~i~  559 (625)
T KOG1707|consen  553 CRQLGLP  559 (625)
T ss_pred             HHhcCCC
Confidence            9999875

>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PF08355 EF_assoc_1: EF hand associated; InterPro: IPR013566 This region typically appears on the C terminus of EF hands in GTP-binding proteins such as Arht/Rhot (may be involved in mitochondrial homeostasis and apoptosis[]) Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF08356 EF_assoc_2: EF hand associated; InterPro: IPR013567 This region predominantly appears near EF-hands (IPR002048 from INTERPRO) in GTP-binding proteins Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
2nty_C180 Rop4-Gdp-Prone8 Length = 180 2e-10
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 2e-10
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 3e-10
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 1e-09
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 1e-09
2w2t_A185 Rac2 (G12v) In Complex With Gdp Length = 185 2e-09
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 2e-09
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 4e-09
2wkr_A332 Structure Of A Photoactivatable Rac1 Containing The 6e-09
2wkq_A332 Structure Of A Photoactivatable Rac1 Containing The 6e-09
2wkp_A332 Structure Of A Photoactivatable Rac1 Containing Lov 6e-09
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 7e-09
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 8e-09
2w2v_A184 Rac2 (G12v) In Complex With Gtpgs Length = 184 3e-08
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 3e-08
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 5e-08
4gzl_A204 Crystal Structure Of Rac1 Q61l Mutant Length = 204 6e-08
3ryt_C180 The Plexin A1 Intracellular Region In Complex With 8e-08
1ryf_A203 Alternative Splicing Of Rac1 Generates Rac1b, A Sel 9e-08
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 9e-08
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 1e-07
1mh1_A186 Small G-Protein Length = 186 1e-07
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 2e-07
1e96_A192 Structure Of The RacP67PHOX COMPLEX Length = 192 2e-07
1i4t_D192 Crystal Structure Analysis Of Rac1-Gmppnp In Comple 2e-07
1ds6_A192 Crystal Structure Of A Rac-Rhogdi Complex Length = 2e-07
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 2e-07
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 2e-07
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 2e-07
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 2e-07
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 2e-07
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 2e-07
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 3e-07
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 3e-07
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 3e-07
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 3e-07
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 3e-07
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 4e-07
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 4e-07
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 4e-07
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 4e-07
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 4e-07
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 4e-07
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 5e-07
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 5e-07
1s1c_A183 Crystal Structure Of The Complex Between The Human 5e-07
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 5e-07
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 5e-07
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 5e-07
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 5e-07
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 5e-07
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 6e-07
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 6e-07
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 6e-07
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 8e-07
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 8e-07
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 8e-07
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 9e-07
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 1e-06
3gcg_A182 Crystal Structure Of Map And Cdc42 Complex Length = 1e-06
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 1e-06
3vhl_B195 Crystal Structure Of The Dhr-2 Domain Of Dock8 In C 2e-06
3qbv_A178 Structure Of Designed Orthogonal Interaction Betwee 7e-06
1nf3_A195 Structure Of Cdc42 In A Complex With The Gtpase-Bin 1e-05
1gzs_A180 Crystal Structure Of The Complex Between The Gef Do 2e-05
1cf4_A184 Cdc42ACK GTPASE-Binding Domain Complex Length = 184 3e-05
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 3e-05
2kb0_A178 Cdc42(T35a) Length = 178 4e-05
1an0_A190 Cdc42hs-Gdp Complex Length = 190 4e-05
1ees_A178 Solution Structure Of Cdc42hs Complexed With A Pept 5e-05
4did_A193 Crystal Structure Of Salmonella Effector N-Terminal 5e-05
1doa_A191 Structure Of The Rho Family Gtp-Binding Protein Cdc 5e-05
1cee_A179 Solution Structure Of Cdc42 In Complex With The Gtp 5e-05
1aje_A194 Cdc42 From Human, Nmr, 20 Structures Length = 194 6e-05
3eg5_A178 Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W 6e-05
1kz7_B188 Crystal Structure Of The DhPH FRAGMENT OF MURINE DB 6e-05
1am4_D177 Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S 6e-05
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 6e-05
2dfk_B194 Crystal Structure Of The Cdc42-Collybistin Ii Compl 6e-05
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 7e-05
2wm9_B190 Structure Of The Complex Between Dock9 And Cdc42. L 7e-05
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 7e-05
2qrz_A189 Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is 8e-05
2odb_A192 The Crystal Structure Of Human Cdc42 In Complex Wit 8e-05
1grn_A191 Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. 9e-05
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 1e-04
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 1e-04
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 1e-04
1a4r_B191 G12v Mutant Of Human Placental Cdc42 Gtpase In The 1e-04
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 2e-04
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 2e-04
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 3e-04
2ase_A178 Nmr Structure Of The F28l Mutant Of Cdc42hs Length 3e-04
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 4e-04
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 5e-04
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 6e-04
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 6e-04
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 78/162 (48%), Gaps = 10/162 (6%)
Query: 17  VRIVVCGEKGTGKSSLIVTAAADTFPAN-VPPVLPPTRLPEDFYPDRVPITIIDTPSSVE 75
           ++ V  G+   GK+ ++++  ++TFP + VP V            + V + + DT    E
Sbjct: 7   IKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQ-E 65
Query: 76  DRGKLGE-ELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDE 134
           D  +L     R AD  +L ++     + + ++  W+PELR     VP+I+VG KLDLRD+
Sbjct: 66  DYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDD 125
Query: 135 NQQVSLEQVMMPI-MQQFREIETC------IECSALKQIQVK 169
            Q        +PI   Q  E++        IECS+  Q  VK
Sbjct: 126 KQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVK 167
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 Back     alignment and structure
>pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 Back     alignment and structure
>pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 Back     alignment and structure
>pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 Back     alignment and structure
>pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|3GCG|A Chain A, Crystal Structure Of Map And Cdc42 Complex Length = 182 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|3VHL|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock8 In Complex With Cdc42 (T17n Mutant) Length = 195 Back     alignment and structure
>pdb|3QBV|A Chain A, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 178 Back     alignment and structure
>pdb|1NF3|A Chain A, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 195 Back     alignment and structure
>pdb|1GZS|A Chain A, Crystal Structure Of The Complex Between The Gef Domain Of The Salmonella Typhimurium Sope Toxin And Human Cdc42 Length = 180 Back     alignment and structure
>pdb|1CF4|A Chain A, Cdc42ACK GTPASE-Binding Domain Complex Length = 184 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|2KB0|A Chain A, Cdc42(T35a) Length = 178 Back     alignment and structure
>pdb|1AN0|A Chain A, Cdc42hs-Gdp Complex Length = 190 Back     alignment and structure
>pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Complexed With A Peptide Derived From P-21 Activated Kinase, Nmr, 20 Structures Length = 178 Back     alignment and structure
>pdb|4DID|A Chain A, Crystal Structure Of Salmonella Effector N-Terminal Domain Sopb In Complex With Cdc42 Length = 193 Back     alignment and structure
>pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 Back     alignment and structure
>pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Complex With The Gtpase Binding Domain Of Wasp Length = 179 Back     alignment and structure
>pdb|1AJE|A Chain A, Cdc42 From Human, Nmr, 20 Structures Length = 194 Back     alignment and structure
>pdb|3EG5|A Chain A, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 178 Back     alignment and structure
>pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 188 Back     alignment and structure
>pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 177 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure
>pdb|2QRZ|A Chain A, Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is Required Length = 189 Back     alignment and structure
>pdb|2ODB|A Chain A, The Crystal Structure Of Human Cdc42 In Complex With The Crib Domain Of Human P21-Activated Kinase 6 (Pak6) Length = 192 Back     alignment and structure
>pdb|1GRN|A Chain A, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. Length = 191 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cdc42 Gtpase In The Gdp Form Length = 191 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|2ASE|A Chain A, Nmr Structure Of The F28l Mutant Of Cdc42hs Length = 178 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 2e-21
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 4e-21
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-20
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 2e-20
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 4e-20
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 5e-20
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 3e-19
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 4e-19
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 4e-19
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 8e-19
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 2e-18
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 4e-18
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 1e-13
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 1e-11
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 2e-11
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 1e-10
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 2e-10
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 5e-09
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 2e-08
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 2e-08
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 3e-08
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 3e-08
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 3e-08
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 3e-08
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 8e-08
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 1e-07
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 1e-07
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 2e-07
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 2e-07
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 2e-07
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 2e-07
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 2e-07
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 2e-07
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 2e-07
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 3e-07
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 4e-07
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 7e-07
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 1e-06
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 2e-06
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 3e-06
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 4e-06
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 4e-06
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 7e-06
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 8e-06
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 1e-05
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 1e-05
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-05
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 3e-05
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 3e-05
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 4e-05
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 4e-05
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 4e-05
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 5e-05
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 7e-05
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 8e-05
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 9e-05
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 9e-05
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 1e-04
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 1e-04
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 1e-04
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 2e-04
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 2e-04
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 2e-04
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 2e-04
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 3e-04
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 3e-04
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 3e-04
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 3e-04
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 3e-04
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 4e-04
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 4e-04
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 4e-04
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 4e-04
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 5e-04
3lxx_A239 GTPase IMAP family member 4; structural genomics c 5e-04
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 6e-04
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 7e-04
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 8e-04
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 8e-04
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 8e-04
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 9e-04
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
 Score = 91.3 bits (227), Expect = 2e-21
 Identities = 48/188 (25%), Positives = 81/188 (43%), Gaps = 34/188 (18%)

Query: 4   ASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYP--- 60
                +G     GV+ V+ G+   GK+SL+V+   + +P        PT    D +    
Sbjct: 8   GGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYP----TEYIPT--AFDNFSAVV 61

Query: 61  ----DRVPITIIDTPSSVE-DRGKLGEELRR-----ADAVVLTYACDRPETLDELSTFWL 110
                 V + + DT    E D+      LR       D  +L ++   P +   +S  W+
Sbjct: 62  SVDGRPVRLQLCDTAGQDEFDK------LRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWV 115

Query: 111 PELRRLEVKVPVIVVGCKLDLRDENQQVSL--EQVMMPIMQQF-----REI--ETCIECS 161
           PE+R    K P+I+VG + DLR++ + +    +    P+ ++       EI   + IECS
Sbjct: 116 PEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLLAEEIKAASYIECS 175

Query: 162 ALKQIQVK 169
           AL Q  +K
Sbjct: 176 ALTQKNLK 183
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 100.0
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 100.0
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 100.0
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.95
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.95
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.93
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.93
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.93
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.93
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.93
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.93
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.93
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.92
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.92
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.92
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.92
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.92
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.92
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.92
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.92
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.92
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.92
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.92
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.92
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.92
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.92
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.92
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.92
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.92
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.92
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.92
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.92
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.92
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.92
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.92
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.92
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.92
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.92
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.92
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.92
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.92
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.92
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.92
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.92
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.91
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.91
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.91
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.91
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.91
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.91
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.91
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.91
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.91
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.91
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.91
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.91
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.91
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.91
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.91
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.91
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.91
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.91
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.91
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.91
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.91
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.91
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.91
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.91
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.91
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.91
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.91
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.91
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.91
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.91
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.91
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.91
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.9
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.9
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.9
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.9
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.9
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.9
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.9
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.9
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.9
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.9
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.9
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.9
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.9
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.9
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.9
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.9
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.9
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.89
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.89
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.89
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.89
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.89
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.89
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.89
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.88
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.88
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.88
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.88
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.88
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.88
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.88
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.88
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.88
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.8
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.87
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.87
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.87
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.87
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.87
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.87
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.87
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.87
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.87
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.87
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.87
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.87
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.87
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.87
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.87
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.86
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.86
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.86
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.86
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.86
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.86
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.86
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.86
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.86
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.86
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.86
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.86
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.86
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.86
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.86
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.86
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.86
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.86
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.86
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.86
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.86
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.86
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.86
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.86
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.86
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.86
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.86
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.85
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.85
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.85
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.85
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.85
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.85
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.85
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.85
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.85
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.85
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.85
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.85
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.85
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.85
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.84
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.84
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.84
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.84
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.84
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.84
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.84
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.84
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.84
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.84
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.84
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.84
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.84
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.84
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.84
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.84
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.84
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.83
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.83
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.83
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.83
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.83
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.83
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.83
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.82
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.82
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.82
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.82
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.82
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.82
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.82
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.82
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.82
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.82
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.82
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.82
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.81
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.81
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.81
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.81
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.81
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.81
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.81
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.8
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.8
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.8
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.8
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.8
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.79
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.79
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.79
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.79
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.79
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.78
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.78
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.78
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.77
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.77
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.77
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.77
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.77
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.77
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.77
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.77
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.77
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.77
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.76
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.76
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.76
2ged_A193 SR-beta, signal recognition particle receptor beta 99.76
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.76
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.76
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.76
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.75
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.61
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.75
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.75
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.75
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.75
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.74
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.74
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.74
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.73
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.73
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.73
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.73
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.73
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.72
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.72
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.72
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.72
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.72
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.71
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.71
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.71
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.71
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.71
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.71
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.71
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.7
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.7
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.7
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.69
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.69
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.69
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.69
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.69
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.68
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.68
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.68
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.68
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.67
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.67
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.67
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.67
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.67
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.67
2ged_A193 SR-beta, signal recognition particle receptor beta 99.66
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.66
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.66
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 99.66
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.65
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.65
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.65
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.65
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.65
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.65
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.64
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.63
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.63
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.62
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.62
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.62
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.62
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.61
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.6
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.6
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.59
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.58
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.58
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.58
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.58
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.58
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.57
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.57
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.56
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.56
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.55
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.53
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.53
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.51
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.51
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.51
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.5
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.49
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.49
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.48
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.47
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.47
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.47
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.47
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.46
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.46
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.45
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.44
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.44
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.44
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.43
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.43
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.42
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.42
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.4
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.4
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.39
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.39
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.39
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.37
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.37
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.35
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.35
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.34
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.34
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.33
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.33
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.33
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.33
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.32
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.31
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.31
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.31
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.31
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.3
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.3
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.28
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.28
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.28
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.27
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.27
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.27
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.26
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 99.25
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.25
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.24
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.24
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.24
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.23
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.23
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.23
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.22
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.21
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.21
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.19
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.19
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.18
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.18
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.16
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.16
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.16
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.13
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.13
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.12
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.11
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.1
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.1
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 99.1
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.09
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.07
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 99.05
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.05
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 99.03
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.01
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.01
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.0
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.99
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.99
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.94
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.91
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.89
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.88
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.85
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.83
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.83
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.82
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.73
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.72
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.72
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.72
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.68
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 98.61
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.57
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.53
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.51
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 98.5
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.46
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 98.44
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.39
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.32
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.32
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.31
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.27
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.26
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.26
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.25
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.2
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.2
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.07
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.05
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.97
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.93
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.82
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 97.68
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 97.67
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.47
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.47
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.46
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.46
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.38
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.37
2xxa_A433 Signal recognition particle protein; protein trans 97.36
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.25
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.17
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.07
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.06
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.01
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.97
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.91
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.88
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.76
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.7
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.65
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.57
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.56
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.56
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.48
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.37
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.37
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.37
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.33
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.18
3cwq_A209 Para family chromosome partitioning protein; alpha 96.14
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.04
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.03
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.96
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.95
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.92
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.9
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.89
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.86
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.81
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.8
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.77
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.75
2xxa_A 433 Signal recognition particle protein; protein trans 95.75
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.63
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.62
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.61
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.6
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.58
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.56
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.56
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.53
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 95.5
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.45
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.43
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.43
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.41
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.4
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 95.39
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.36
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.34
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
Probab=100.00  E-value=9.5e-40  Score=332.16  Aligned_cols=278  Identities=16%  Similarity=0.123  Sum_probs=187.0

Q ss_pred             eeEEEEEcCCCCCHHHHHHHHhcCCCCCCCCCCCCCccccc---ceeCCeeEEEEEeCCCCc--------cchhhHHHhh
Q 010254           16 GVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPE---DFYPDRVPITIIDTPSSV--------EDRGKLGEEL   84 (514)
Q Consensus        16 ~~~I~ivG~~nvGKSsLin~l~~~~~~~~~~~~~~~tt~~~---~~~~~~~~~~l~Dt~G~~--------~~~~~~~~~~   84 (514)
                      ..+|+|+|+||||||||+|+|++.++  +++...+++|...   .+...+..+.+|||||++        ........++
T Consensus         3 ~~~V~ivG~~nvGKStL~n~l~~~~~--~~v~~~~g~T~d~~~~~~~~~~~~~~l~DT~G~~~~~~~~~~~~~~~~~~~~   80 (436)
T 2hjg_A            3 KPVVAIVGRPNVGKSTIFNRIAGERI--SIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGIDIGDEPFLAQIRQQAEIAM   80 (436)
T ss_dssp             CCEEEEECSTTSSHHHHHHHHEEEEC--C-----------CEEEECTTCSSCCEEEC---------CHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCc--eeecCCCCCccceEEEEEEECCceEEEEECCCCCCcchhHHHHHHHHHHHHH
Confidence            47999999999999999999999884  4455566776433   344567889999999986        3344556789


Q ss_pred             hccCEEEEEEeCCCcccHHHHHHHHHHHHHhcCCCCcEEEEEecccCcccccchhHhhhhHHHHHHHhccCcEEEcCccc
Q 010254           85 RRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALK  164 (514)
Q Consensus        85 ~~ad~ii~v~d~~~~~s~~~~~~~~~~~l~~~~~~~pvilv~NK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~Sa~~  164 (514)
                      ++||++|+|+|++++.+..+.  .+...+++.  ++|+++|+||+|+... +     ....++. .+ ++.+++++||++
T Consensus        81 ~~ad~il~vvD~~~~~~~~d~--~~~~~l~~~--~~pvilv~NK~D~~~~-~-----~~~~~~~-~l-g~~~~~~iSA~~  148 (436)
T 2hjg_A           81 DEADVIIFMVNGREGVTAADE--EVAKILYRT--KKPVVLAVNKLDNTEM-R-----ANIYDFY-SL-GFGEPYPISGTH  148 (436)
T ss_dssp             HHCSEEEEEEETTTCSCHHHH--HHHHHHTTC--CSCEEEEEECCCC-----------CCCSSG-GG-SSCCCEECBTTT
T ss_pred             HhCCEEEEEEeCCCCCCHHHH--HHHHHHHHc--CCCEEEEEECccCccc-h-----hhHHHHH-Hc-CCCCeEEEeCcC
Confidence            999999999999988776553  266667665  8999999999998754 1     1111111 12 233789999999


Q ss_pred             cccceecCCCCChhhHHHHHHHHHHHhcCcccCCCcchhhHHHHHHHHHhcCCcchhhHHHhhccCCCccccccCCCCCC
Q 010254          165 QIQVKCFNSPLQPSEIVGVKRVVQEKLREGVNERGLTLAGFLFLHALFIEKGRLETTWTVLRKFGYNNDIKLADELIPYS  244 (514)
Q Consensus       165 ~~~~~~f~~~l~~~~i~~L~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~~~~~~~L~~~~~~~~~~~~~~~~~~~  244 (514)
                      |.            |+++|++.+.+.+++....                                               
T Consensus       149 g~------------gv~~L~~~i~~~l~~~~~~-----------------------------------------------  169 (436)
T 2hjg_A          149 GL------------GLGDLLDAVAEHFKNIPET-----------------------------------------------  169 (436)
T ss_dssp             TB------------THHHHHHHHHHTGGGCCSS-----------------------------------------------
T ss_pred             CC------------ChHHHHHHHHHhcCccccc-----------------------------------------------
Confidence            99            9999999988766431000                                               


Q ss_pred             CccCCCCCceecChhHHHHHHHHHHhhcCCCCCCCCHHhHHhhhccCCCCCCCCCcccccccccCCCcccHHHHHHHhhh
Q 010254          245 AFKRAPDQSVELTNEAIDFLKGIFELFDADDDNSLRPIEVEDLFSTAPECPWDEAPYKDAAEKTALGGLSLDGFLSEWAL  324 (514)
Q Consensus       245 ~l~~~~~~~~elt~~~~~~L~~iF~~fd~~~d~~l~~~~l~~~f~~~~~~p~~~~~~~~~~~~~~~~~i~~~~~~~~w~~  324 (514)
                                                                                                      
T Consensus       170 --------------------------------------------------------------------------------  169 (436)
T 2hjg_A          170 --------------------------------------------------------------------------------  169 (436)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhcCCHHHHHHHHHHhCCCCChhhHHHHhhhhhhhhhhhcccCCeEEEEEeCCCCCChHHHHHHhhCCCCCCCCC-CCCC
Q 010254          325 MTLLDPARSVENLIYIGYPGDPSSAIRVTRKRRIDRKKQQAERNVFQCFVFGPKKAGKSVLLNSFLGRPFSDNYT-PTTD  403 (514)
Q Consensus       325 ~~~~~~~~~~~~l~~~g~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ki~iiG~~~vGKSsLi~~l~~~~~~~~~~-~~~~  403 (514)
                                                             ......+||+++|++|||||||+|+|++.++..++. +++|
T Consensus       170 ---------------------------------------~~~~~~~ki~lvG~~nvGKSSLin~l~~~~~~~~~~~~gtT  210 (436)
T 2hjg_A          170 ---------------------------------------KYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNVAGTT  210 (436)
T ss_dssp             ---------------------------------------CCCTTCEEEEEECSTTSSHHHHHHHHHTSTTEEEC------
T ss_pred             ---------------------------------------cccccCcEEEEEcCCCCCHHHHHHHHhCCCceeecCCCCce
Confidence                                                   001124799999999999999999999998764443 3333


Q ss_pred             ccEEEEEEECCCCcEEEEEEecCCh----------hHHHhhhcCccccccCcEEEEEEeCCChhhHHHHHHHHHHHHhcC
Q 010254          404 ERYAVNVVDQPGGTKKTVVLREIPE----------EAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYG  473 (514)
Q Consensus       404 ~~~~~~~~~~~~~~~~~~i~dt~g~----------~~~~~~~~~~~~~~~~d~vilv~D~~~~~s~~~~~~~~~~~~~~~  473 (514)
                      .+.....+... + ..+.+|||+|.          +.|..+. ...+++.+|++++|+|++++.+++.. .|+..+... 
T Consensus       211 ~d~~~~~~~~~-~-~~~~l~DT~G~~~~~~~~~~~e~~~~~~-~~~~~~~ad~~llv~D~~~~~s~~~~-~~~~~~~~~-  285 (436)
T 2hjg_A          211 RDAVDTSFTYN-Q-QEFVIVDTAGMRKKGKVYETTEKYSVLR-ALKAIDRSEVVAVVLDGEEGIIEQDK-RIAGYAHEA-  285 (436)
T ss_dssp             ---CCEEEEET-T-EEEEETTHHHHTCBTTBCCCCSHHHHHH-HHHHHHHCSEEEEEEETTTCCCHHHH-HHHHHHHHT-
T ss_pred             eeeeEEEEEEC-C-eEEEEEECCCcCcCccccchHHHHHHHH-HHHHHHhCCEEEEEEcCCcCCcHHHH-HHHHHHHHc-
Confidence            33333344444 3 45779999997          6665443 23578899999999999998887765 465555442 


Q ss_pred             CCCCCCCcEEEEEeCCCCcccc
Q 010254          474 EDTGFEVPCLIVAAKDDLDSFA  495 (514)
Q Consensus       474 ~~~~~~~p~ilv~nK~Dl~~~~  495 (514)
                           ++|+++|+||||+...+
T Consensus       286 -----~~~iiiv~NK~Dl~~~~  302 (436)
T 2hjg_A          286 -----GKAVVIVVNKWDAVDKD  302 (436)
T ss_dssp             -----TCEEEEEEECGGGSCCC
T ss_pred             -----CCcEEEEEECccCCCcc
Confidence                 69999999999997654
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 514
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 2e-16
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 9e-16
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-15
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 6e-04
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 2e-14
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 8e-05
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 5e-14
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 8e-14
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 2e-05
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 1e-13
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 1e-06
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 5e-13
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 0.002
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 9e-13
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 0.004
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 9e-13
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 1e-12
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-12
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-05
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-12
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 5e-12
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 7e-12
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 0.002
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 3e-11
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 0.003
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 1e-10
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 1e-10
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-10
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 1e-10
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 1e-10
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 4e-10
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 5e-10
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.001
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 6e-10
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9e-10
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 2e-09
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 3e-09
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 5e-05
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 6e-09
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 0.001
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-09
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-08
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 1e-08
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 7e-04
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-08
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 4e-08
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 6e-08
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-04
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 8e-08
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 9e-08
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 2e-07
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 2e-07
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 3e-07
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 5e-07
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 0.002
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 7e-07
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 7e-07
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 1e-06
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 3e-06
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-06
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 1e-05
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 6e-05
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 2e-04
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 3e-04
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 6e-04
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 0.001
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 0.003
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.004
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 0.004
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.4 bits (184), Expect = 2e-16
 Identities = 34/163 (20%), Positives = 66/163 (40%), Gaps = 10/163 (6%)

Query: 17  VRIVVCGEKGTGKSSLIVTAAADTFPAN-VPPVLPPTRLPEDFYPDRVPITIIDTPSSVE 75
           ++ VV G+   GK+ L+++   + FP+  VP V     +      +   + + DT    +
Sbjct: 4   IKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQED 63

Query: 76  DRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDEN 135
                     + D  ++ ++   P + + +   W+PE+     K P ++VG ++DLRD+ 
Sbjct: 64  YDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDP 123

Query: 136 QQVSLEQVMMPIMQQFREIE---------TCIECSALKQIQVK 169
             +                E           +ECSAL Q  +K
Sbjct: 124 STIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLK 166
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.93
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.93
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.93
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.93
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.92
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.92
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.92
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.92
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.91
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.91
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.91
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.91
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.91
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.91
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.9
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.9
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.9
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.9
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.9
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.9
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.9
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.9
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.9
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.89
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.89
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.89
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.89
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.89
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.88
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.88
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.87
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.87
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.87
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.87
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.87
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.87
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.86
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.86
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.85
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.84
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.84
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.83
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.83
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.82
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.82
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.81
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.81
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.81
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.79
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.79
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.78
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.78
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.77
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.76
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.76
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.76
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.75
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.74
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.74
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.74
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.73
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.7
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.7
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.68
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.66
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.66
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.66
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.64
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.64
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.64
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.62
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.58
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.56
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.55
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.55
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.54
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.54
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.53
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.53
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.52
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.52
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.51
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.51
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.51
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.48
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.47
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.46
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.45
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.45
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.44
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.44
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.43
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.43
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.42
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.42
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.41
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.39
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.34
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.31
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.29
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.27
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.25
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.25
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.23
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.21
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.2
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.18
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.18
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.13
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.12
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.1
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.05
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.04
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.02
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.97
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.96
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.94
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.89
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 98.88
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 98.8
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.74
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.71
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.67
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.64
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.36
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.34
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 98.32
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.31
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.29
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 98.26
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.14
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 98.01
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.9
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.86
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 97.51
d1okkd2207 GTPase domain of the signal recognition particle r 97.46
d1vmaa2213 GTPase domain of the signal recognition particle r 97.41
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.29
d2qy9a2211 GTPase domain of the signal recognition particle r 97.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.26
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.09
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.08
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.98
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.84
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.65
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.64
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.49
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.48
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.47
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.36
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.36
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.31
d1okkd2207 GTPase domain of the signal recognition particle r 96.23
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.16
d2qy9a2211 GTPase domain of the signal recognition particle r 96.15
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.13
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.13
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.09
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.09
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.08
d1vmaa2213 GTPase domain of the signal recognition particle r 96.07
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.99
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.99
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.98
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.95
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.95
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.95
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.93
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 95.86
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.81
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.79
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.78
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.77
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.71
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.71
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.71
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.69
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.66
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.66
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.66
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.65
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.64
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.63
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.63
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.58
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.56
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.56
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.55
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.53
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.5
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.47
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.47
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.45
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.44
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.4
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.39
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.39
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.38
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.37
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.35
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.32
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.31
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.3
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.27
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.26
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.24
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.21
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.21
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.18
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.17
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.14
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.13
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.12
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.12
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.11
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.09
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.09
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.08
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.05
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.05
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.04
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.99
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.99
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.98
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.97
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.96
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.96
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.95
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.93
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.91
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.91
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.86
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.85
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.83
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.8
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.79
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.78
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.73
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.7
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.67
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.65
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.65
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.59
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.58
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.57
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.55
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.55
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.54
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.52
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.49
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.48
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.44
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.42
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.38
d1g2912240 Maltose transport protein MalK, N-terminal domain 94.38
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.36
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.33
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.31
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.28
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.23
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.22
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.21
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.2
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 94.18
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.17
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.12
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.12
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.09
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.06
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.03
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.03
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.97
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.94
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.93
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.92
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.91
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.89
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.87
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.86
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.84
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.82
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.82
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.77
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.76
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.76
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 93.7
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.69
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.52
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.5
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.5
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.48
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.37
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.36
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.34
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.3
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.24
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 93.09
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.07
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.94
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.65
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.58
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.57
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 92.57
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.56
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.5
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.45
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.42
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 92.42
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 92.3
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.26
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 92.24
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 92.12
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.08
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.98
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.95
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.92
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.84
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 91.76
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 91.66
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.63
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.63
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.62
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.56
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 91.55
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.38
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.35
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 91.27
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.24
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.09
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 91.08
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.02
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.92
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 90.86
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 90.86
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.86
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.81
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.76
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.75
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.66
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.61
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.6
d1svma_362 Papillomavirus large T antigen helicase domain {Si 90.6
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.6
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 90.48
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.45
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.43
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.37
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.3
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.2
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.15
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 89.91
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.91
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 89.8
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.77
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.64
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.58
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.57
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.53
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.27
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.17
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.85
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 88.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.76
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.76
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.75
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 88.73
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.71
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.65
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 88.63
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 88.51
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 88.51
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.42
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 88.4
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 88.29
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 88.17
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.08
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 88.07
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.07
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 87.97
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 87.88
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.87
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.82
d1svma_362 Papillomavirus large T antigen helicase domain {Si 87.8
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.79
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 87.76
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 87.62
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 87.59
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.54
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.45
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 87.33
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 87.31
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 87.28
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 87.1
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 86.97
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 86.96
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 86.6
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 86.58
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.44
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.39
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 86.34
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 86.31
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 86.3
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.2
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.19
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 86.12
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 86.11
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 86.08
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 86.02
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 86.02
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 85.95
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.94
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.9
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.78
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 85.77
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 85.72
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.7
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.61
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 85.59
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.57
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.55
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 85.41
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.32
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.24
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 85.2
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.18
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.09
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 84.81
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.77
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.68
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 84.63
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.55
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.43
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 84.15
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.83
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 83.75
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.74
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.94  E-value=4.8e-27  Score=204.15  Aligned_cols=159  Identities=20%  Similarity=0.279  Sum_probs=130.6

Q ss_pred             eeEEEEEcCCCCCHHHHHHHHhcCCCCCCCCCCCCCcc--cccceeCCeeEEEEEeCCCCccchhhHHHhhhccCEEEEE
Q 010254           16 GVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTR--LPEDFYPDRVPITIIDTPSSVEDRGKLGEELRRADAVVLT   93 (514)
Q Consensus        16 ~~~I~ivG~~nvGKSsLin~l~~~~~~~~~~~~~~~tt--~~~~~~~~~~~~~l~Dt~G~~~~~~~~~~~~~~ad~ii~v   93 (514)
                      .+||+++|++|||||||+|+|+++++...+.++.....  .........+.+.+|||+|.+++......+++++|++++|
T Consensus         2 ~iKv~liG~~~vGKSsLi~rl~~~~~~~~~~~ti~~~~~~~~~~~~~~~~~~~i~d~~g~~~~~~~~~~~~~~~~~~i~v   81 (164)
T d1z2aa1           2 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLV   81 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHHCCCCCCSSCCCSSSEEEEEEEETTEEEEEEEECCTTGGGTTCCCHHHHTTCCEEEEE
T ss_pred             eEEEEEECCCCcCHHHHHHHHHhCCCCcccccccccccceeeeeecCceeeeeeeccCCccchhhhhhhhhccCceEEEE
Confidence            48999999999999999999999887666555444322  2233345578899999999999888888999999999999


Q ss_pred             EeCCCcccHHHHHHHHHHHHHhcCCCCcEEEEEecccCcccccchhHhhhhHHHHHHHhccCcEEEcCccccccceecCC
Q 010254           94 YACDRPETLDELSTFWLPELRRLEVKVPVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSALKQIQVKCFNS  173 (514)
Q Consensus        94 ~d~~~~~s~~~~~~~~~~~l~~~~~~~pvilv~NK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~i~~Sa~~~~~~~~f~~  173 (514)
                      ||++++.+++.+.. |++.+.+..+++|+++|+||+|+.+. +.+..+ ..+.++++++.  ++++|||++|.       
T Consensus        82 ~d~~~~~s~~~~~~-~~~~i~~~~~~~~iilVgnK~Dl~~~-~~v~~~-~~~~~~~~~~~--~~~e~Sak~g~-------  149 (164)
T d1z2aa1          82 FSTTDRESFEAISS-WREKVVAEVGDIPTALVQNKIDLLDD-SCIKNE-EAEGLAKRLKL--RFYRTSVKEDL-------  149 (164)
T ss_dssp             EETTCHHHHHTHHH-HHHHHHHHHCSCCEEEEEECGGGGGG-CSSCHH-HHHHHHHHHTC--EEEECBTTTTB-------
T ss_pred             Eeccchhhhhhccc-ccccccccCCCceEEEeeccCCcccc-eeeeeh-hhHHHHHHcCC--EEEEeccCCCc-------
Confidence            99999999999875 99998887778999999999999776 545444 34677888765  89999999999       


Q ss_pred             CCChhhHHHHHHHHHHHh
Q 010254          174 PLQPSEIVGVKRVVQEKL  191 (514)
Q Consensus       174 ~l~~~~i~~L~~~i~~~~  191 (514)
                           |++++.+.|.+.+
T Consensus       150 -----~v~e~f~~l~~~~  162 (164)
T d1z2aa1         150 -----NVSEVFKYLAEKH  162 (164)
T ss_dssp             -----SSHHHHHHHHHHH
T ss_pred             -----CHHHHHHHHHHHH
Confidence                 8888888776643
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure