Citrus Sinensis ID: 010302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
ccEEccccEEEEEEcccEEEEEEEccccEEEcEEccccccEEEEEEEccccEEEEEEEEccccEEEEEcccccccccEEEEEEccccEEEEEEcccccEEEEEEccccEEEEcccccccccccccEEEcccccHHHHHHccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccEEEcccccEEEEEEEcccEEEEccccEEEEEEccccHHHHHHHHHHHccccccccccccHHHccccccccccccccccEEccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEccccccHHHHHHHHHHHcccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHcccccccccccccEEEEEEEEEcc
ccccccccEEEEEccccEEEEEEEEEcHHHHHHcccccccEEEEEEccccccEEEEEEcccccEEEEEcccccccccEEEEHcccccEEEEEEcccccEEEEEccccEEEEEccccccccccEEEEEEEccccHHHHHHcccccEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcHHHHHHHHHHHccccccccccccccHEEEEHHHHcccccccccEEEEEccccEEEEEcEcEEEEEEEEcccEEEEEcccccccHHHEEEEEccccccccEEEEEHHHcccHHHcccccccEEEEEEEcccEEEEEEccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHcccccccEccEEEcccEEEEcccccccccccccccccEccccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEEcc
mqvsvdgllccsisndksvkiyDVVNYDMMLMIrlpfipgaVEWVYKqgdvkaglaisdrnssfvhiydaradsnepliskkvhmgpvkvmrynpvfdtvisaddkgiieywsphtlqfpesevsfrlkSDTNLFEILKSKTtvsaievspdgkqfsitspdrrIRVFWFRTGKLRRVYDESLEVAQDlqrsdaplyrlEAIDFGRRMAVEKEIEktetappsnaifdessNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYqgdrsskkvrkipaaaananeskepfsdptllccafkrhriylfsrrepeepedatkgrdifnekpppdellavsdignsvttslpdnvILHTtmgdihmklypeecpktVENFTTHCRNEYYNNLIFHRVIKGFMiqtgdplgdgtggqsiwgreFEDEFHkslrhdrpftvsmanagpntngsqffittvatpwldnkhTVFGRVIKGMDVVQAIEKVktdkndkpyqdvkilnvtvpks
mqvsvdgllccsisndksvkIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDaradsnepliskKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSkttvsaievspdgkqfsitspdrrirVFWFrtgklrrvydESLEvaqdlqrsdaplyrLEAIDFGRRMAVEKEIektetappsnaifdESSNFLIYATLLGIKIVNLHTNKVSrilgkvenndrFLRIAlyqgdrsskkvrKIPAAaananeskepfsdPTLLCCAFKRHRIYlfsrrepeepedatkgrdifnekpPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKvktdkndkpyqdvkilnvtvpks
MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
****VDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVS****QFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAV***************IFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQ***************************PTLLCCAFKRHRIYLF****************************AVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHK*******FTV********TNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKT********DVKILN******
*QVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQ**********RLEAIDFGRRMAV*********APPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALY*****************************TLLCCAFKRHRIYLF****************IFNEKP*******************PDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVP**
MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRRE********KGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
****VDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRRE*******TKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
Q8CEC6646 Peptidylprolyl isomerase yes no 0.970 0.770 0.518 1e-154
Q96BP3646 Peptidylprolyl isomerase yes no 0.974 0.773 0.514 1e-154
Q29RZ2644 Peptidylprolyl isomerase yes no 0.974 0.776 0.514 1e-153
Q5NVL7646 Peptidylprolyl isomerase yes no 0.974 0.773 0.514 1e-153
P0C1J0630 Peptidyl-prolyl cis-trans N/A no 0.961 0.782 0.498 1e-143
O74942610 Peptidyl-prolyl cis-trans yes no 0.974 0.819 0.421 1e-106
Q4WCR3161 Peptidyl-prolyl cis-trans no no 0.302 0.962 0.541 1e-45
Q7SF72163 Peptidyl-prolyl cis-trans N/A no 0.302 0.950 0.541 1e-44
Q4I1Y1162 Peptidyl-prolyl cis-trans no no 0.302 0.956 0.529 3e-44
Q5ASQ0162 Peptidyl-prolyl cis-trans no no 0.302 0.956 0.529 4e-44
>sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 Back     alignment and function desciption
 Score =  546 bits (1408), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/519 (51%), Positives = 370/519 (71%), Gaps = 21/519 (4%)

Query: 1   MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDR 60
           + VS +G L CS+ +DK++K++DVVN+DM+ M++L + PG  EW+Y  GD  + +A S++
Sbjct: 139 IAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEK 198

Query: 61  NSSFVHIYDARADSNEPL-ISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWS--PHTL 117
           ++  + IYD R D N+PL I  K+H+ P+  +R NPV+  V+S+D  G+IEYW+  PH  
Sbjct: 199 STGKIFIYDGRGD-NQPLHIFDKLHVSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEY 257

Query: 118 QFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRR 177
           +FP++ V++  K+DT+L+E  K K   ++I  SPDGK+ +    DR++R+F F TGKL R
Sbjct: 258 KFPKN-VNWEYKTDTDLYEFAKCKAYPTSICFSPDGKKIATIGSDRKVRIFRFLTGKLMR 316

Query: 178 VYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYA 237
           V+DESL +  +LQ+    L  +E   FGRRMAVE+E+EK +     N +FDE+ +F++Y 
Sbjct: 317 VFDESLSMFTELQQMRQQLPDME---FGRRMAVERELEKVDAVRLVNIVFDETGHFVLYG 373

Query: 238 TLLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPF 297
           T+LGIK++N+ TN+  RILGK EN  R +++AL+QG   +KK R   AA      S+ P 
Sbjct: 374 TMLGIKVINVETNRCVRILGKQEN-IRVMQLALFQG--IAKKHR--AAATIEMKASENPV 428

Query: 298 -----SDPTLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSV 352
                +DPT++C +FK++R Y+F++REPE+ + A   RD+FNEKP  +E++A +      
Sbjct: 429 LQNIQADPTIVCTSFKKNRFYMFTKREPEDTKTADSDRDVFNEKPSKEEVMAATQAEGPK 488

Query: 353 TTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGD 412
             S  D+ I+HT+MGDIH+KL+P ECPKTVENF  H RN YYN   FHR+IKGFMIQTGD
Sbjct: 489 RVS--DSAIVHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGD 546

Query: 413 PLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKH 472
           P G G GG+SIWG EFEDEFH +LRHDRP+T+SMANAG NTNGSQFFIT V TPWLDNKH
Sbjct: 547 PTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKH 606

Query: 473 TVFGRVIKGMDVVQAIEKVKTD-KNDKPYQDVKILNVTV 510
           TVFGRV KGM+VVQ I  VK + K DKPY+DV I+N+TV
Sbjct: 607 TVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITV 645
Putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 Back     alignment and function description
>sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|P0C1J0|CYP15_RHIO9 Peptidyl-prolyl cis-trans isomerase cyp15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp15 PE=3 SV=1 Back     alignment and function description
>sp|O74942|CYP9_SCHPO Peptidyl-prolyl cis-trans isomerase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp9 PE=1 SV=1 Back     alignment and function description
>sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q7SF72|PPIL1_NEUCR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-1 PE=3 SV=2 Back     alignment and function description
>sp|Q4I1Y1|PPIL1_GIBZE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
255576357 623 WD-repeat protein, putative [Ricinus com 1.0 0.823 0.900 0.0
356550125 616 PREDICTED: peptidylprolyl isomerase doma 1.0 0.832 0.906 0.0
359479380548 PREDICTED: peptidylprolyl isomerase doma 1.0 0.936 0.894 0.0
297734824 5747 unnamed protein product [Vitis vinifera] 1.0 0.089 0.894 0.0
449443428 624 PREDICTED: peptidylprolyl isomerase doma 0.998 0.820 0.898 0.0
356543564 616 PREDICTED: peptidylprolyl isomerase doma 1.0 0.832 0.898 0.0
224103047 620 predicted protein [Populus trichocarpa] 1.0 0.827 0.884 0.0
297818928 631 peptidyl-prolyl cis-trans isomerase cycl 1.0 0.812 0.851 0.0
22331588 631 peptidylprolyl isomerase domain and WD r 1.0 0.812 0.846 0.0
7635482 629 putative protein [Arabidopsis thaliana] 0.996 0.812 0.842 0.0
>gi|255576357|ref|XP_002529071.1| WD-repeat protein, putative [Ricinus communis] gi|223531483|gb|EEF33315.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/513 (90%), Positives = 497/513 (96%)

Query: 1   MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDR 60
           + VSVDGLLCC+ISND+SVK+YDVVNYDMM+MIRLP+IPG+ EWVYKQGDVKA LAISDR
Sbjct: 111 LAVSVDGLLCCTISNDRSVKVYDVVNYDMMVMIRLPYIPGSAEWVYKQGDVKARLAISDR 170

Query: 61  NSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFP 120
           +SSFVHIYDAR+ +NEP+IS++VH+GP+KVM+YNPVFDTVISAD KGIIEYW+P TLQFP
Sbjct: 171 DSSFVHIYDARSGTNEPIISRQVHLGPIKVMKYNPVFDTVISADTKGIIEYWNPTTLQFP 230

Query: 121 ESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYD 180
           ESEV+FRLKSDTNLFEI+K KT+VS +EVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYD
Sbjct: 231 ESEVNFRLKSDTNLFEIVKCKTSVSTMEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYD 290

Query: 181 ESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLL 240
           ESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAP  NA+FDESSNFLIYATLL
Sbjct: 291 ESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPQPNAVFDESSNFLIYATLL 350

Query: 241 GIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDP 300
           GIK+VNLHTNKV+RILGKVENNDRFL+IALYQGD+SSK+VRKIPAAAANANESKEP SDP
Sbjct: 351 GIKVVNLHTNKVARILGKVENNDRFLQIALYQGDQSSKRVRKIPAAAANANESKEPLSDP 410

Query: 301 TLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNV 360
           TLLCCAFK+HRIYLFSRREPEEPEDATKGRD+FNEKPP DELLAVSDIG SVTTSLPDNV
Sbjct: 411 TLLCCAFKKHRIYLFSRREPEEPEDATKGRDVFNEKPPADELLAVSDIGKSVTTSLPDNV 470

Query: 361 ILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGG 420
           ILHTTMGDI ++LYPEECPKTVENFTTHCRN YY+NLIFHRVI+GFMIQTGDPLGDGTGG
Sbjct: 471 ILHTTMGDIQLRLYPEECPKTVENFTTHCRNGYYDNLIFHRVIRGFMIQTGDPLGDGTGG 530

Query: 421 QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIK 480
           QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRV+K
Sbjct: 531 QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVK 590

Query: 481 GMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS 513
           GMDVVQ+IEKVKTDK DKPYQDVKILNVTVPKS
Sbjct: 591 GMDVVQSIEKVKTDKADKPYQDVKILNVTVPKS 623

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356550125|ref|XP_003543440.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359479380|ref|XP_002269959.2| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734824|emb|CBI17058.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449443428|ref|XP_004139479.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Cucumis sativus] gi|449501645|ref|XP_004161425.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356543564|ref|XP_003540230.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224103047|ref|XP_002312902.1| predicted protein [Populus trichocarpa] gi|222849310|gb|EEE86857.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297818928|ref|XP_002877347.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297323185|gb|EFH53606.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22331588|ref|NP_190046.2| peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Arabidopsis thaliana] gi|17065154|gb|AAL32731.1| putative protein [Arabidopsis thaliana] gi|30725438|gb|AAP37741.1| At3g44600 [Arabidopsis thaliana] gi|332644399|gb|AEE77920.1| peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7635482|emb|CAB88542.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
TAIR|locus:2076003631 CYP71 "cyclophilin 71" [Arabid 1.0 0.812 0.846 5.3e-246
UNIPROTKB|F1NAJ2657 PPWD1 "Uncharacterized protein 0.970 0.757 0.520 1.1e-142
RGD|1310204646 Ppwd1 "peptidylprolyl isomeras 0.970 0.770 0.518 1.1e-142
MGI|MGI:2443069646 Ppwd1 "peptidylprolyl isomeras 0.970 0.770 0.518 1.4e-142
UNIPROTKB|F5H7P7616 PPWD1 "Peptidylprolyl isomeras 0.970 0.808 0.516 3.7e-142
UNIPROTKB|Q96BP3646 PPWD1 "Peptidylprolyl isomeras 0.970 0.770 0.516 3.7e-142
UNIPROTKB|F1SKT8646 PPWD1 "Peptidylprolyl isomeras 0.970 0.770 0.514 4.8e-142
UNIPROTKB|Q29RZ2644 PPWD1 "Peptidylprolyl isomeras 0.970 0.773 0.516 6.1e-142
UNIPROTKB|E2RIS6646 PPWD1 "Uncharacterized protein 0.970 0.770 0.514 1.3e-141
ZFIN|ZDB-GENE-070615-16622 ppwd1 "peptidylprolyl isomeras 0.970 0.800 0.506 1.5e-140
TAIR|locus:2076003 CYP71 "cyclophilin 71" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2370 (839.3 bits), Expect = 5.3e-246, P = 5.3e-246
 Identities = 434/513 (84%), Positives = 482/513 (93%)

Query:     1 MQVSVDGLLCCSISNDKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDR 60
             + VS+DGLLCC+ISND +VKIYDVVNYDMM MIRLP+IPGAVEWVYKQGDVKA LA+SDR
Sbjct:   119 LAVSIDGLLCCTISNDHAVKIYDVVNYDMMAMIRLPYIPGAVEWVYKQGDVKAKLAVSDR 178

Query:    61 NSSFVHIYDARADSNEPLISKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPHTLQFP 120
             +S FVHIYD R+ SNEP+ SK++HM P+KVM+YNPV DT+IS D KGIIEYWS  TLQFP
Sbjct:   179 DSLFVHIYDPRSGSNEPIASKEIHMNPIKVMKYNPVSDTMISGDTKGIIEYWSATTLQFP 238

Query:   121 ESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYD 180
             E EV+F+LKSDTNLFEI+K KTT+SAIEVSPDGKQFSIT+PDRRIRVFWFRTGKLRRVYD
Sbjct:   239 EDEVNFKLKSDTNLFEIIKCKTTISAIEVSPDGKQFSITAPDRRIRVFWFRTGKLRRVYD 298

Query:   181 ESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYATLL 240
             ESL VAQDLQRSDAPLYRLEAIDFGRRMAVEKE+EKTE+AP  NA+FDESSNFLIYAT L
Sbjct:   299 ESLVVAQDLQRSDAPLYRLEAIDFGRRMAVEKELEKTESAPQPNAVFDESSNFLIYATFL 358

Query:   241 GIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDP 300
             GIK++NLHTN V+RILGKVE+N+R+LR+ALYQGD+  KKVRKIPAAAAN NESKEP +DP
Sbjct:   359 GIKVINLHTNTVARILGKVESNERYLRVALYQGDQGGKKVRKIPAAAANVNESKEPLTDP 418

Query:   301 TLLCCAFKRHRIYLFSRREPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNV 360
             T+LCCAFK+HRIY+FSRREPEEPEDA++GRD+FNEKP  DEL++VSDIGNS TTSLP+NV
Sbjct:   419 TILCCAFKKHRIYMFSRREPEEPEDASQGRDVFNEKPAADELMSVSDIGNSATTSLPENV 478

Query:   361 ILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGG 420
             I+HTT+GDIHMKLYPEECPKTVENFTTHCRN YY+N +FHRVI+GFMIQTGDPLGDGTGG
Sbjct:   479 IMHTTLGDIHMKLYPEECPKTVENFTTHCRNGYYDNHLFHRVIRGFMIQTGDPLGDGTGG 538

Query:   421 QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIK 480
             QSIWGREFEDEFHKSLRHDRPFT+SMANAGPNTNGSQFFITTVATPWLDNKHTVFGRV+K
Sbjct:   539 QSIWGREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVK 598

Query:   481 GMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS 513
             GMDVVQ IEKVKTDKND+PYQDVKILNVTVPKS
Sbjct:   599 GMDVVQGIEKVKTDKNDRPYQDVKILNVTVPKS 631
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=ISS
GO:0003682 "chromatin binding" evidence=IDA
GO:0009909 "regulation of flower development" evidence=RCA;IMP
GO:0009933 "meristem structural organization" evidence=RCA;IMP
GO:0010082 "regulation of root meristem growth" evidence=IMP
GO:0010305 "leaf vascular tissue pattern formation" evidence=IMP
GO:0010338 "leaf formation" evidence=IMP
GO:0010358 "leaf shaping" evidence=IMP
GO:0031060 "regulation of histone methylation" evidence=IMP
GO:0042393 "histone binding" evidence=IDA
GO:0048440 "carpel development" evidence=IMP
GO:0048443 "stamen development" evidence=IMP
GO:0048453 "sepal formation" evidence=RCA;IMP
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0000003 "reproduction" evidence=RCA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006310 "DNA recombination" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006325 "chromatin organization" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0010074 "maintenance of meristem identity" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
UNIPROTKB|F1NAJ2 PPWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310204 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443069 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7P7 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96BP3 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKT8 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RZ2 PPWD1 "Peptidylprolyl isomerase domain and WD repeat-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIS6 PPWD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070615-16 ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CEC6PPWD1_MOUSE5, ., 2, ., 1, ., 80.51830.97070.7708yesno
O74942CYP9_SCHPO5, ., 2, ., 1, ., 80.42110.97460.8196yesno
Q5NVL7PPWD1_PONAB5, ., 2, ., 1, ., 80.51450.97460.7739yesno
Q96BP3PPWD1_HUMAN5, ., 2, ., 1, ., 80.51450.97460.7739yesno
Q29RZ2PPWD1_BOVIN5, ., 2, ., 1, ., 80.51450.97460.7763yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022051001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (620 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00034779001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence; (467 aa)
   •    0.440
GSVIVG00037110001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (512 aa)
   •    0.431

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-111
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 3e-77
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 1e-70
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 4e-69
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 3e-67
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 4e-67
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-65
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 7e-62
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 2e-60
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 9e-50
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 6e-47
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-46
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-30
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 5e-27
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-26
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 8e-10
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 3e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.001
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.001
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.003
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information 
 Score =  325 bits (834), Expect = e-111
 Identities = 123/148 (83%), Positives = 138/148 (93%)

Query: 361 ILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGG 420
           I+HTT GDIH++L+PEE PKTVENFTTH RN YYNN IFHRVIKGFMIQTGDP GDGTGG
Sbjct: 1   IIHTTKGDIHIRLFPEEAPKTVENFTTHARNGYYNNTIFHRVIKGFMIQTGDPTGDGTGG 60

Query: 421 QSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIK 480
           +SIWG+EFEDEF  SL+HDRP+T+SMANAGPNTNGSQFFITTVATPWLDNKHTVFGRV+K
Sbjct: 61  ESIWGKEFEDEFSPSLKHDRPYTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVK 120

Query: 481 GMDVVQAIEKVKTDKNDKPYQDVKILNV 508
           GMDVVQ IE VKTDKND+PY+D+KI+N+
Sbjct: 121 GMDVVQRIENVKTDKNDRPYEDIKIINI 148

This group consists of several hypothetical and putative eukaryotic and bacterial proteins which have a cyclophilin domain and a WD40 domain. Function of the protein is not known. Length = 148
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PTZ00221249 cyclophilin; Provisional 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.98
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0645312 consensus WD40 repeat protein [General function pr 99.96
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.96
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.95
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0286343 consensus G-protein beta subunit [General function 99.95
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.95
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0295406 consensus WD40 repeat-containing protein [Function 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0295406 consensus WD40 repeat-containing protein [Function 99.94
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.94
KOG0315311 consensus G-protein beta subunit-like protein (con 99.94
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0283712 consensus WD40 repeat-containing protein [Function 99.94
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.93
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.93
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.93
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.93
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.93
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.92
PTZ00420568 coronin; Provisional 99.92
KOG0645312 consensus WD40 repeat protein [General function pr 99.92
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
PLN00181793 protein SPA1-RELATED; Provisional 99.92
PTZ00421493 coronin; Provisional 99.92
PTZ00421493 coronin; Provisional 99.92
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.91
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.91
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.91
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.91
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.9
KOG0296399 consensus Angio-associated migratory cell protein 99.9
PLN00181793 protein SPA1-RELATED; Provisional 99.9
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.88
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.88
KOG0772641 consensus Uncharacterized conserved protein, conta 99.88
KOG0289506 consensus mRNA splicing factor [General function p 99.88
PTZ00420568 coronin; Provisional 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.87
KOG0643327 consensus Translation initiation factor 3, subunit 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.87
KOG1273405 consensus WD40 repeat protein [General function pr 99.87
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.87
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.87
KOG0296399 consensus Angio-associated migratory cell protein 99.87
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.87
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.86
KOG0293519 consensus WD40 repeat-containing protein [Function 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.86
KOG0289506 consensus mRNA splicing factor [General function p 99.86
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.86
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.86
KOG0283712 consensus WD40 repeat-containing protein [Function 99.86
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.85
KOG2096420 consensus WD40 repeat protein [General function pr 99.85
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.85
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.85
KOG0294362 consensus WD40 repeat-containing protein [Function 99.85
KOG4283397 consensus Transcription-coupled repair protein CSA 99.85
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.84
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.83
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.83
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.83
KOG0643327 consensus Translation initiation factor 3, subunit 99.83
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.82
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.82
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.82
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.82
KOG1274 933 consensus WD40 repeat protein [General function pr 99.81
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.81
KOG0641350 consensus WD40 repeat protein [General function pr 99.81
KOG0267 825 consensus Microtubule severing protein katanin p80 99.81
KOG4283397 consensus Transcription-coupled repair protein CSA 99.8
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.8
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.8
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.79
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.79
KOG0641350 consensus WD40 repeat protein [General function pr 99.79
KOG0267 825 consensus Microtubule severing protein katanin p80 99.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.78
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.78
KOG0646476 consensus WD40 repeat protein [General function pr 99.78
KOG4328498 consensus WD40 protein [Function unknown] 99.78
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.78
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.77
KOG1539910 consensus WD repeat protein [General function pred 99.77
KOG0270463 consensus WD40 repeat-containing protein [Function 99.77
KOG0300481 consensus WD40 repeat-containing protein [Function 99.76
KOG0646476 consensus WD40 repeat protein [General function pr 99.76
KOG0294362 consensus WD40 repeat-containing protein [Function 99.76
KOG0772641 consensus Uncharacterized conserved protein, conta 99.76
KOG2048 691 consensus WD40 repeat protein [General function pr 99.76
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.76
KOG0639705 consensus Transducin-like enhancer of split protei 99.76
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.76
KOG0639705 consensus Transducin-like enhancer of split protei 99.76
KOG0303472 consensus Actin-binding protein Coronin, contains 99.75
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.75
KOG0302440 consensus Ribosome Assembly protein [General funct 99.74
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.73
KOG1274 933 consensus WD40 repeat protein [General function pr 99.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.72
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.71
KOG1539910 consensus WD repeat protein [General function pred 99.71
KOG0300481 consensus WD40 repeat-containing protein [Function 99.7
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.7
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.69
KOG2096420 consensus WD40 repeat protein [General function pr 99.69
KOG2055514 consensus WD40 repeat protein [General function pr 99.69
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.68
KOG0303472 consensus Actin-binding protein Coronin, contains 99.68
KOG0270463 consensus WD40 repeat-containing protein [Function 99.68
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.68
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.67
KOG0649325 consensus WD40 repeat protein [General function pr 99.67
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.67
KOG1273405 consensus WD40 repeat protein [General function pr 99.67
KOG2110391 consensus Uncharacterized conserved protein, conta 99.66
KOG2055514 consensus WD40 repeat protein [General function pr 99.66
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.66
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.66
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.65
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.64
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.62
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.62
KOG1188376 consensus WD40 repeat protein [General function pr 99.62
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.61
KOG2048691 consensus WD40 repeat protein [General function pr 99.61
KOG4328498 consensus WD40 protein [Function unknown] 99.61
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.6
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.57
KOG2106626 consensus Uncharacterized conserved protein, conta 99.57
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.57
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.57
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.57
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.56
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.56
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.56
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.55
KOG2106626 consensus Uncharacterized conserved protein, conta 99.55
PRK01742429 tolB translocation protein TolB; Provisional 99.55
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.55
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.54
KOG1188376 consensus WD40 repeat protein [General function pr 99.52
PRK11028330 6-phosphogluconolactonase; Provisional 99.51
COG2319466 FOG: WD40 repeat [General function prediction only 99.5
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.5
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.5
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.5
KOG1310 758 consensus WD40 repeat protein [General function pr 99.49
KOG0771398 consensus Prolactin regulatory element-binding pro 99.49
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.48
COG2319466 FOG: WD40 repeat [General function prediction only 99.48
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.48
KOG4227609 consensus WD40 repeat protein [General function pr 99.47
KOG2110391 consensus Uncharacterized conserved protein, conta 99.47
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.47
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.47
PRK03629429 tolB translocation protein TolB; Provisional 99.44
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.44
PRK02889427 tolB translocation protein TolB; Provisional 99.44
KOG1334559 consensus WD40 repeat protein [General function pr 99.44
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.42
KOG2321 703 consensus WD40 repeat protein [General function pr 99.4
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.4
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.4
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.38
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.38
PRK04922433 tolB translocation protein TolB; Provisional 99.37
KOG2139445 consensus WD40 repeat protein [General function pr 99.37
PRK11028330 6-phosphogluconolactonase; Provisional 99.36
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.36
PRK05137435 tolB translocation protein TolB; Provisional 99.36
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.36
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.35
PRK01742429 tolB translocation protein TolB; Provisional 99.35
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.32
KOG2111346 consensus Uncharacterized conserved protein, conta 99.32
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.29
KOG2111346 consensus Uncharacterized conserved protein, conta 99.29
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.28
KOG1963792 consensus WD40 repeat protein [General function pr 99.27
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.27
KOG1310 758 consensus WD40 repeat protein [General function pr 99.26
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.25
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.25
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.25
KOG4547541 consensus WD40 repeat-containing protein [General 99.24
PRK01029428 tolB translocation protein TolB; Provisional 99.24
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.23
PRK03629429 tolB translocation protein TolB; Provisional 99.23
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.23
PRK05137435 tolB translocation protein TolB; Provisional 99.23
PRK04792448 tolB translocation protein TolB; Provisional 99.22
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.22
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.2
PRK02889427 tolB translocation protein TolB; Provisional 99.2
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.2
KOG0771398 consensus Prolactin regulatory element-binding pro 99.2
KOG0649325 consensus WD40 repeat protein [General function pr 99.2
PRK00178430 tolB translocation protein TolB; Provisional 99.19
PRK04922433 tolB translocation protein TolB; Provisional 99.19
KOG1963 792 consensus WD40 repeat protein [General function pr 99.14
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.14
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.14
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.09
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.09
KOG2139445 consensus WD40 repeat protein [General function pr 99.07
KOG4227609 consensus WD40 repeat protein [General function pr 99.07
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.05
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.03
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.02
PRK00178430 tolB translocation protein TolB; Provisional 99.01
KOG1334559 consensus WD40 repeat protein [General function pr 98.98
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.98
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.97
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.96
PRK04792448 tolB translocation protein TolB; Provisional 98.95
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.92
PRK04043419 tolB translocation protein TolB; Provisional 98.92
COG4946668 Uncharacterized protein related to the periplasmic 98.91
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.89
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.88
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.88
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.84
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.83
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.83
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.82
PRK01029428 tolB translocation protein TolB; Provisional 98.8
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.8
KOG4547541 consensus WD40 repeat-containing protein [General 98.77
KOG2315566 consensus Predicted translation initiation factor 98.75
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.71
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.71
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.67
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.66
KOG2314698 consensus Translation initiation factor 3, subunit 98.64
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.63
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.62
KOG2315566 consensus Predicted translation initiation factor 98.62
KOG2321703 consensus WD40 repeat protein [General function pr 98.61
KOG1409404 consensus Uncharacterized conserved protein, conta 98.6
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.59
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.58
COG4946668 Uncharacterized protein related to the periplasmic 98.57
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.53
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.51
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.48
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.46
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.46
KOG2695425 consensus WD40 repeat protein [General function pr 98.45
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.43
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.42
KOG1409404 consensus Uncharacterized conserved protein, conta 98.41
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.41
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.37
PRK04043419 tolB translocation protein TolB; Provisional 98.36
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.27
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.22
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.21
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.2
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.18
KOG2314698 consensus Translation initiation factor 3, subunit 98.16
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.14
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.13
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.12
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.11
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.1
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.08
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.05
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.05
KOG2695425 consensus WD40 repeat protein [General function pr 98.03
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.03
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.03
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.02
KOG3621 726 consensus WD40 repeat-containing protein [General 97.99
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.96
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.94
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.85
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.84
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.82
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.81
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.8
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.74
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.71
PRK02888635 nitrous-oxide reductase; Validated 97.7
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.69
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.66
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.59
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.57
COG3391381 Uncharacterized conserved protein [Function unknow 97.54
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.51
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.5
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.44
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.44
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.41
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.34
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.33
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.25
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.25
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.24
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.22
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.18
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.15
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.12
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.05
KOG3621 726 consensus WD40 repeat-containing protein [General 96.87
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.86
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.82
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 96.71
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.7
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.69
PRK02888635 nitrous-oxide reductase; Validated 96.68
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.62
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.62
PRK00969 508 hypothetical protein; Provisional 96.57
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.46
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.44
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.44
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.43
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.31
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.18
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.17
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.14
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.1
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.1
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.08
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.03
PRK13616591 lipoprotein LpqB; Provisional 95.95
COG3391381 Uncharacterized conserved protein [Function unknow 95.79
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.79
KOG2395644 consensus Protein involved in vacuole import and d 95.77
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.77
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 95.6
KOG2444238 consensus WD40 repeat protein [General function pr 95.59
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.46
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.44
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.38
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.22
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.05
KOG2395644 consensus Protein involved in vacuole import and d 94.97
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.74
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.74
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.7
PHA02713557 hypothetical protein; Provisional 94.68
PRK00969 508 hypothetical protein; Provisional 94.68
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 94.58
PRK13616591 lipoprotein LpqB; Provisional 94.56
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.56
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.54
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.44
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.41
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.28
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.25
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.25
KOG2444238 consensus WD40 repeat protein [General function pr 94.15
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.12
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.0
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.46
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 93.4
COG3386307 Gluconolactonase [Carbohydrate transport and metab 93.37
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.37
PHA02713557 hypothetical protein; Provisional 93.36
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.33
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 93.15
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 92.84
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 92.84
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 92.72
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.45
PHA03098534 kelch-like protein; Provisional 92.44
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 92.0
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.71
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 91.6
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 91.26
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 90.73
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 90.7
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.69
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 90.62
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 90.14
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 90.07
PHA03098534 kelch-like protein; Provisional 89.92
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 89.82
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 89.6
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.42
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 89.21
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 89.18
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.88
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 88.88
PHA02790480 Kelch-like protein; Provisional 88.72
COG3204316 Uncharacterized protein conserved in bacteria [Fun 88.66
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 88.49
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 88.45
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 88.42
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 87.97
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 87.85
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 87.73
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 86.17
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 85.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.52
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 85.03
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.57
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 84.32
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.61
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 83.23
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 83.21
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 83.15
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 82.81
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 82.6
PF04126120 Cyclophil_like: Cyclophilin-like; InterPro: IPR007 80.83
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 80.52
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.4e-99  Score=703.58  Aligned_cols=497  Identities=56%  Similarity=0.906  Sum_probs=461.8

Q ss_pred             CeEecCCCEEEEEeC-CCcEEEEEccCCceeEEEEcCCCCCcEEEEEEcCCCcceEEEEeCCCCeEEEEecCCCCCcceE
Q 010302            1 MQVSVDGLLCCSISN-DKSVKIYDVVNYDMMLMIRLPFIPGAVEWVYKQGDVKAGLAISDRNSSFVHIYDARADSNEPLI   79 (513)
Q Consensus         1 v~~s~dg~~las~s~-D~~v~iwd~~~~~~~~~~~l~~~~~~v~~v~~s~~~~~~~l~s~~~d~~I~iwd~~~~~~~~i~   79 (513)
                      ++.|-||.+++|.+. |..++++|+++.++...+++...|+.++|+....+....+.++...++.+.++|-..+..+...
T Consensus        59 l~~S~dg~L~~Sv~d~Dhs~KvfDvEn~DminmiKL~~lPg~a~wv~skGd~~s~IAVs~~~sg~i~VvD~~~d~~q~~~  138 (558)
T KOG0882|consen   59 LAVSYDGWLFRSVEDPDHSVKVFDVENFDMINMIKLVDLPGFAEWVTSKGDKISLIAVSLFKSGKIFVVDGFGDFCQDGY  138 (558)
T ss_pred             hhccccceeEeeccCcccceeEEEeeccchhhhcccccCCCceEEecCCCCeeeeEEeecccCCCcEEECCcCCcCccce
Confidence            356789999999887 9999999999999999999999999999998877777678888889999999998865666666


Q ss_pred             EeecCCCCeEEEEEcCCCCEEEEEcCCCcEEEecCC-CCCCCCcceeeeecCCccccccccCCcceEEEEEcCCCCEEEE
Q 010302           80 SKKVHMGPVKVMRYNPVFDTVISADDKGIIEYWSPH-TLQFPESEVSFRLKSDTNLFEILKSKTTVSAIEVSPDGKQFSI  158 (513)
Q Consensus        80 ~~~~h~~~V~~l~~sp~~~~l~s~s~dg~i~iwd~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~v~~spdg~~l~s  158 (513)
                      .-.-|.++|.++.++|.++.++|....|.|..|... .++.|...+.|.+|..+.++.+...++...++.|+|+|..+.+
T Consensus       139 fkklH~sPV~~i~y~qa~Ds~vSiD~~gmVEyWs~e~~~qfPr~~l~~~~K~eTdLy~f~K~Kt~pts~Efsp~g~qist  218 (558)
T KOG0882|consen  139 FKKLHFSPVKKIRYNQAGDSAVSIDISGMVEYWSAEGPFQFPRTNLNFELKHETDLYGFPKAKTEPTSFEFSPDGAQIST  218 (558)
T ss_pred             ecccccCceEEEEeeccccceeeccccceeEeecCCCcccCccccccccccccchhhcccccccCccceEEccccCcccc
Confidence            667899999999999999999999999999999887 7888988899999999999999999999999999999999999


Q ss_pred             EeCCCcEEEEEcCCCeEEEEecccHHHHHHHhcCCCCccccccccccceeeeeeeccccCCCCCCceEEcCCCCEEEEcc
Q 010302          159 TSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRSDAPLYRLEAIDFGRRMAVEKEIEKTETAPPSNAIFDESSNFLIYAT  238 (513)
Q Consensus       159 ~s~D~~I~iwd~~tg~~~~~~~~~~~~i~~~~~~~~~~~~l~~~~~~~r~~~e~e~~~~~~~~~~~i~fd~~g~~li~~s  238 (513)
                      -+.|.+||++++++|++++.+++........+.+   .|.+.+.+++||+++|+|++++.....++++||++|+||+|++
T Consensus       219 l~~DrkVR~F~~KtGklvqeiDE~~t~~~~q~ks---~y~l~~VelgRRmaverelek~~~~~~~~~~fdes~~flly~t  295 (558)
T KOG0882|consen  219 LNPDRKVRGFVFKTGKLVQEIDEVLTDAQYQPKS---PYGLMHVELGRRMAVERELEKHGSTVGTNAVFDESGNFLLYGT  295 (558)
T ss_pred             cCcccEEEEEEeccchhhhhhhccchhhhhcccc---ccccceeehhhhhhHHhhHhhhcCcccceeEEcCCCCEEEeec
Confidence            9999999999999999999999887766665555   6789999999999999999999999999999999999999999


Q ss_pred             ccceEEEEcccCcEEEEeCCCCccchhheeccccCCcCCcceeeeeccccccccCCCCCCCCeEEEeeecCceEEEEecC
Q 010302          239 LLGIKIVNLHTNKVSRILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKEPFSDPTLLCCAFKRHRIYLFSRR  318 (513)
Q Consensus       239 ~~gi~v~d~~t~~~v~~~g~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~l~~s~~~~~~i~i~~~~  318 (513)
                      ..||||+|+.+|.+++++|++| ++||+++++||+....+.+.. ++.|+..+... .++||+++||+++++|||+|  +
T Consensus       296 ~~gikvin~~tn~v~ri~gk~e-~ir~~~~sl~q~~~k~~~~~~-~~~a~~np~~~-~~~dpt~~c~a~kk~rfylf--~  370 (558)
T KOG0882|consen  296 ILGIKVINLDTNTVVRILGKDE-AIRFTRLSLYQGAQKSNLAAL-EVAASNNPLLE-FQKDPTIVCTAFKKNRFYLF--R  370 (558)
T ss_pred             ceeEEEEEeecCeEEEEeccch-hhhhhhHHHHhhhhhccchhh-hhhhccCcccc-cCCCCeEEEeeeecceEEEE--e
Confidence            9999999999999999999999 999999999999865555544 88888866665 67999999999999999999  7


Q ss_pred             CCCCCcccCCCcCccCCCCCccccccccccCCCccCCCCCEEEEEeCCeEEEEEeCCCCChHHHHHHHHhhhccccCCce
Q 010302          319 EPEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLI  398 (513)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~v~~~t~~G~i~i~l~~~~~P~~~~~f~~l~~~~~y~~~~  398 (513)
                      ||+.++   +.||||||+|.++++..+.+..  -+...+..++|||++|+|.|.|||++||+||+||..+|+.|||||..
T Consensus       371 ep~~~~---~~~dvfne~p~~~~~~~~~~~~--g~~~l~~~aiihtt~gdi~~kl~p~ecpktvenf~th~rngyy~~~~  445 (558)
T KOG0882|consen  371 EPEFTE---SDRDVFNEKPLKEELMEARQEE--GNKLLGKAAIIHTTQGDIHIKLYPEECPKTVENFTTHSRNGYYDNHT  445 (558)
T ss_pred             cCCCCc---chhhhhccCcChhHhhhhhhcc--CceecccceEEEecccceEEEecccccchhhhhhhccccCccccCcc
Confidence            787775   5689999999999999988644  56778899999999999999999999999999999999999999999


Q ss_pred             EEEeEeCcEEEeccCCCCCCCCcccCCCCCccccccCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCCCCCeEEEEE
Q 010302          399 FHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRV  478 (513)
Q Consensus       399 ~~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~g~v~~~~~~~~~~~s~f~i~~~~~~~ld~~~~vfG~V  478 (513)
                      ||||+++||||+|||.|+|+||+++||..|+||+++.|+|++|++|+|||.|||+||||||||+.+.||||++|||||||
T Consensus       446 fhriik~fmiqtgdp~g~gtggesiwg~dfedefh~~lrhdrpft~smanag~ntngsqffit~~~tpwld~khtvfgrv  525 (558)
T KOG0882|consen  446 FHRIIKGFMIQTGDPLGDGTGGESIWGKDFEDEFHPNLRHDRPFTVSMANAGPNTNGSQFFITTVPTPWLDGKHTVFGRV  525 (558)
T ss_pred             hHHhhhhheeecCCCCCCCCCCcccccccchhhcCcccccCCCceEEecccCCCCCCceEEEEecCccccCCcceeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCHHHHHHHhcCCCCCCCCcccCeEEEEEEE
Q 010302          479 IKGMDVVQAIEKVKTDKNDKPYQDVKILNVTV  510 (513)
Q Consensus       479 ~~G~~~l~~i~~~~~~~~~~p~~~i~I~~~~v  510 (513)
                      +.||||+++|+++.+++++||++++.|.+++|
T Consensus       526 ~~gm~vvqri~~v~t~k~drp~e~v~iinisv  557 (558)
T KOG0882|consen  526 TAGMDVVQRIEQVKTDKYDRPYEDVKIINISV  557 (558)
T ss_pred             ecchhHHhHhhhcccCcCCCCCCceeEEEEec
Confidence            99999999999999999999999999999987

>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04126 Cyclophil_like: Cyclophilin-like; InterPro: IPR007256 Proteins of this family have no known function Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 5e-67
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 3e-60
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 8e-43
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 9e-43
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 2e-42
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 2e-42
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 2e-42
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 8e-38
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-37
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 2e-36
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 2e-36
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 2e-36
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-36
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 9e-36
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 2e-35
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 2e-35
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-35
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 1e-34
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-34
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 2e-34
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 4e-34
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 6e-34
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 6e-34
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 6e-34
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 9e-34
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 1e-33
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 4e-33
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 6e-33
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 7e-33
1dyw_A173 Biochemical And Structural Characterization Of A Di 9e-33
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 1e-32
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-32
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 3e-32
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 8e-32
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 1e-31
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 1e-31
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 1e-31
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 1e-31
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 2e-31
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 3e-31
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 3e-31
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 4e-31
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 5e-31
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 5e-31
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 5e-31
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 5e-31
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 5e-31
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 6e-31
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 6e-31
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 6e-31
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 8e-31
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-30
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 1e-30
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-30
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 2e-30
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 2e-30
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-30
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 3e-30
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 2e-29
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-29
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 1e-28
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 4e-28
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 5e-28
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 8e-27
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 9e-26
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 4e-25
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 1e-21
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 8e-21
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 2e-19
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 1e-18
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 9e-17
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 1e-16
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 5e-15
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 4e-14
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure 
Iteration: 1

 Score =  251 bits (642), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 136/175 (77%), Gaps = 3/175 (1%)
Query: 337 PPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNN 396
           P  +E++A +        S  D+ I+HT+MGDIH KL+P ECPKTVENF  H RN YYN 
Sbjct: 3   PSKEEVMAATQAEGPKRVS--DSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNG 60
Query: 397 LIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGS 456
             FHR+IKGFMIQTGDP G G GG+SIWG EFEDEFH +LRHDRP+T+SMANAG NTNGS
Sbjct: 61  HTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGS 120
Query: 457 QFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTD-KNDKPYQDVKILNVTV 510
           QFFIT V TPWLDNKHTVFGRV KGM+VVQ I  VK + K DKPY+DV I+N+TV
Sbjct: 121 QFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITV 175
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
2b71_A196 Cyclophilin-like protein; structural genomics, str 1e-113
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 1e-112
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-110
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 1e-107
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-106
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 1e-104
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 1e-104
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-103
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-100
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 1e-100
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 7e-96
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 3e-94
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 7e-76
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-75
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 2e-75
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 4e-75
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 2e-72
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-71
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 5e-71
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 7e-71
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 7e-71
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-70
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 2e-70
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-69
1z81_A229 Cyclophilin; structural genomics, structural genom 3e-69
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 5e-69
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 9e-69
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 2e-68
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 7e-68
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 7e-68
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-67
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 4e-67
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 5e-67
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 2e-66
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 3e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 4e-07
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 1e-06
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 9e-06
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 4e-04
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 1e-04
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 2e-04
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 2e-04
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 6e-04
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
 Score =  331 bits (851), Expect = e-113
 Identities = 79/191 (41%), Positives = 108/191 (56%), Gaps = 2/191 (1%)

Query: 320 PEEPEDATKGRDIFNEKPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECP 379
            ++ E+ +   ++ +EK    E           T      + ++T +GD  ++LY    P
Sbjct: 3   SDDEEEESNAINVVSEKTKSLEEKIAYYKMKGHTER--GYITIYTNLGDFEVELYWYHSP 60

Query: 380 KTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHD 439
           KT  NF T C   +Y+N IFHRVI  F+IQ GDP G G GG+SI+G  FEDE +K L+H 
Sbjct: 61  KTCLNFYTLCEMGFYDNTIFHRVIPNFVIQGGDPTGTGKGGKSIYGEYFEDEINKELKHT 120

Query: 440 RPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKP 499
               +SM+N GPNTN SQFFIT    P LD KHT+F RV K M  ++ I  V+T   +KP
Sbjct: 121 GAGILSMSNNGPNTNSSQFFITLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKP 180

Query: 500 YQDVKILNVTV 510
             D+KIL  + 
Sbjct: 181 IFDLKILRTST 191
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.98
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.98
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.97
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.97
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.96
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.96
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.96
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.96
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
3jrp_A379 Fusion protein of protein transport protein SEC13 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.95
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.95
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.95
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.95
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.95
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.95
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.95
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.95
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.95
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.95
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.95
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.94
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.94
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.94
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.94
3jro_A 753 Fusion protein of protein transport protein SEC13 99.94
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.94
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.94
2pm7_B297 Protein transport protein SEC13, protein transport 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.93
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.93
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.93
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.93
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.93
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.93
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.93
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.93
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.92
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.92
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.92
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.92
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.92
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.92
3jrp_A379 Fusion protein of protein transport protein SEC13 99.92
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.92
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.92
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.92
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.92
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.92
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.92
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.91
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.91
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.91
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.91
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.9
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.9
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.9
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.89
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.89
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.88
3jro_A 753 Fusion protein of protein transport protein SEC13 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.88
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.87
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.86
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.81
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.81
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.81
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.79
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.78
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.77
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.77
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.77
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.77
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.75
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.75
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.75
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.74
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.74
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.71
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.71
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.7
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.7
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.69
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.69
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.69
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.69
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.67
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.67
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.66
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.64
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.64
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.64
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.63
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.61
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.59
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.59
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.58
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.56
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.51
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.5
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.47
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.44
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.44
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.42
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.41
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.4
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.4
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.4
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.39
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.38
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.37
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.34
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.34
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.34
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.32
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.27
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.27
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.25
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.25
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.22
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.21
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.2
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.18
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.15
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.15
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.15
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.13
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.13
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.13
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.11
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.1
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.09
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.09
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.07
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.02
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.96
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.96
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.87
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.86
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.85
2qe8_A343 Uncharacterized protein; structural genomics, join 98.84
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.83
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.83
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.81
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.8
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.78
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.78
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.76
2qe8_A343 Uncharacterized protein; structural genomics, join 98.74
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.71
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.62
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.61
2ece_A462 462AA long hypothetical selenium-binding protein; 98.6
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.58
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.58
2ece_A462 462AA long hypothetical selenium-binding protein; 98.55
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.52
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.52
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.51
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.51
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.47
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.41
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.32
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.32
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.23
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.22
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.13
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.13
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.09
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.07
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.04
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.04
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.99
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.97
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.95
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.93
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.89
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.88
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.79
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.79
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.78
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.71
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.56
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.55
3v65_B386 Low-density lipoprotein receptor-related protein; 97.51
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.46
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.43
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.42
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.42
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.38
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.35
3kya_A496 Putative phosphatase; structural genomics, joint c 97.33
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.32
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.32
3v65_B386 Low-density lipoprotein receptor-related protein; 97.31
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.3
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.28
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.23
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.19
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.16
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.15
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.14
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.12
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.11
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.0
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.99
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.91
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.88
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.87
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.81
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.76
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.73
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.7
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.63
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.62
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.58
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.49
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.37
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.22
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.13
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.09
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 95.95
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.94
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.56
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 95.48
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.46
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.39
3kya_A496 Putative phosphatase; structural genomics, joint c 95.17
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 94.81
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 94.76
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.67
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.31
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.26
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 94.22
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.17
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 93.81
3kop_A188 Uncharacterized protein; protein with A cyclophili 93.5
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.45
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 93.35
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.34
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.13
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 93.13
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 93.02
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 92.22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.06
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.4
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 91.06
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 90.2
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 89.86
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 89.75
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 89.71
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 88.67
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 88.64
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 88.33
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 88.04
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 86.53
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 85.74
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 85.41
1zx8_A136 Hypothetical protein TM1367; structural genomics, 84.3
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 84.03
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 83.45
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 82.85
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 81.28
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=3.2e-50  Score=350.75  Aligned_cols=174  Identities=67%  Similarity=1.154  Sum_probs=155.9

Q ss_pred             CCCccccccccccCCCccCCCCCEEEEEeCCeEEEEEeCCCCChHHHHHHHHhhhccccCCceEEEeEeCcEEEeccCCC
Q 010302          336 KPPPDELLAVSDIGNSVTTSLPDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLG  415 (513)
Q Consensus       336 ~p~~~~~~~~~~~~~~~~~~~~~~v~~~t~~G~i~i~l~~~~~P~~~~~f~~l~~~~~y~~~~~~rv~~~~~iq~G~~~~  415 (513)
                      +|+++++.+++  ..+.+......|+++|+.|+|+||||++.||+||+||++||+.+||+|+.||||+|+|||||||+.+
T Consensus         2 ~~~~~~~~~~~--~~~~~~~~~~~v~~~t~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~FhRvi~~f~iQgGd~~~   79 (176)
T 2a2n_A            2 SPSKEEVMAAT--QAEGPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTG   79 (176)
T ss_dssp             -------------CCCSCCCCCSEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTS
T ss_pred             Ccchhhhhhcc--cCCCCCCCCCEEEEEecCccEEEEEeCCCChHHHHHHHHHhhcCccCCCEEEEEECCcEEEccCCCC
Confidence            57777777765  3556777889999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcccCCCCCccccccCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCCCCCeEEEEEEcCHHHHHHHhcCCCC-
Q 010302          416 DGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTD-  494 (513)
Q Consensus       416 ~~~~~~~~~~~~~~~e~~~~~~~~~~g~v~~~~~~~~~~~s~f~i~~~~~~~ld~~~~vfG~V~~G~~~l~~i~~~~~~-  494 (513)
                      ++.+++++||..|++|+...++|.++|+|+||+.+|++++|||||++.++|+||++|+|||+|++|||||++|++++++ 
T Consensus        80 ~g~gg~si~g~~~~dE~~~~l~h~~~G~lsmA~~gp~s~gSQFFIt~~~~~~LDg~~tVFG~Vv~Gmdvv~~I~~~~t~~  159 (176)
T 2a2n_A           80 TGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNP  159 (176)
T ss_dssp             SSSCCCCTTSSCBCCCCCTTCCSCSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCT
T ss_pred             CCCCCCcccCCccccccccccccCCceEEEEEeCCCCCcccEEEEECCCCCccCCCeeEEEEEeCCHHHHHHHHcCCccC
Confidence            9999999999999999977899999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCCCcccCeEEEEEEEc
Q 010302          495 KNDKPYQDVKILNVTVP  511 (513)
Q Consensus       495 ~~~~p~~~i~I~~~~v~  511 (513)
                      ++++|.++|+|.+++|.
T Consensus       160 ~~~~P~~~v~I~~v~v~  176 (176)
T 2a2n_A          160 KTDKPYEDVSIINITVK  176 (176)
T ss_dssp             TTCCBSSCCBEEEEEEC
T ss_pred             CCCccCCCeEEEEEEEC
Confidence            68999999999999874
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 9e-58
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 9e-57
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 2e-52
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 3e-52
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 3e-49
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 5e-47
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 5e-47
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-46
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-45
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 1e-44
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 7e-44
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 2e-43
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-43
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 6e-43
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 8e-43
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 1e-40
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-40
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-40
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-39
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 8e-38
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 1e-35
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-35
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-04
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  187 bits (475), Expect = 9e-58
 Identities = 79/154 (51%), Positives = 102/154 (66%)

Query: 357 PDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGD 416
           P NV L T+MG I ++LY +  PKT +NF    R  YYN   FHR+IK FMIQ GDP G 
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 417 GTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFG 476
           G GG SI+G++FEDE H  L+      ++MANAGP+TNGSQFF+T   T WLD KHT+FG
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFG 130

Query: 477 RVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTV 510
           RV +G+ +V  +  V+T+  D+P  DVKI+    
Sbjct: 131 RVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYP 164
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.98
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.95
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.91
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.9
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.89
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.89
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.88
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.86
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.84
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.83
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.83
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.82
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.8
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.76
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.75
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.75
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.73
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.7
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.69
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.66
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.66
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.6
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.5
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.5
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.5
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.45
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.42
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.31
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.23
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.11
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.04
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.93
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.9
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.82
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.81
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.78
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.72
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.67
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.67
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.59
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.48
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.46
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.37
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.34
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.34
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.23
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.18
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.04
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.78
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.73
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.43
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.18
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.07
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.39
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.32
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.29
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.96
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.9
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.25
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.7
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.64
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.29
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.82
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.2
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.09
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.51
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 91.03
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 90.9
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 90.54
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 89.8
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 88.29
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 88.13
d1zx8a1124 Hypothetical protein TM1367 {Thermotoga maritima [ 87.21
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.36
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.95
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 84.23
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Putative cyclophilin PFE0505w
species: Plasmodium falciparum [TaxId: 5833]

Probab=100.00  E-value=4e-44  Score=309.04  Aligned_cols=154  Identities=68%  Similarity=1.152  Sum_probs=149.1

Q ss_pred             CCEEEEEeCCeEEEEEeCCCCChHHHHHHHHhhhccccCCceEEEeEeCcEEEeccCCCCCCCCcccCCCCCccccccCC
Q 010302          357 PDNVILHTTMGDIHMKLYPEECPKTVENFTTHCRNEYYNNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSL  436 (513)
Q Consensus       357 ~~~v~~~t~~G~i~i~l~~~~~P~~~~~f~~l~~~~~y~~~~~~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~e~~~~~  436 (513)
                      +.+|+|+|++|+|+||||++.||++|+||++||+++||+|+.|||+++++++|+|++.+.+.++.+.++..+++|....+
T Consensus         1 p~~~~i~T~~G~i~ieL~~~~aP~tv~nF~~l~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~~   80 (155)
T d2fu0a1           1 PKSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHL   80 (155)
T ss_dssp             CCEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTB
T ss_pred             CceEEEEEcccEEEEEEcCCCChHHHHHHhhHhhCCccccceeeeeeecceeeccCCCCCCcCCcccCCCcccccccccc
Confidence            35789999999999999999999999999999999999999999999999999999998888888889999999998899


Q ss_pred             CCCCceEEEEeccCCCCCCceEEEEecCCCCCCCCCeEEEEEEcCHHHHHHHhcCCCCCCCCcccCeEEEEEEE
Q 010302          437 RHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVIKGMDVVQAIEKVKTDKNDKPYQDVKILNVTV  510 (513)
Q Consensus       437 ~~~~~g~v~~~~~~~~~~~s~f~i~~~~~~~ld~~~~vfG~V~~G~~~l~~i~~~~~~~~~~p~~~i~I~~~~v  510 (513)
                      +|.++|+++|++.++++++|||||++++.|+||++|+|||||++|||+|++|++++++++++|+++|+|.+|+|
T Consensus        81 ~~~~~~~~~~~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi~G~~vv~~I~~~~t~~~~~P~~~i~I~~v~i  154 (155)
T d2fu0a1          81 NHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI  154 (155)
T ss_dssp             CSSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCTTSCBSSCCBEEEEEE
T ss_pred             ccCCccEEEecccCCCCCCccceecccCccccccceEEEEEEeccHHHHHHHHhCCCCCCCCcCCCcEEEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999987
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure