Citrus Sinensis ID: 010316

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MPSVSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKTSPGNQLSSPPPS
cccHHHHHHHHHHHHHHcccccccEEEEEcccccccccccEEEEEcccccccccccEEccccccccccEEEEccccccccccEEEEcccccEEEEEEEEEcccccccccccEEEEEEEcEEEEEEEccccccccccEEEEEEEEEccccEEEEEEEccccccccEEEEEEEEEcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHccccccccccEEEccccccccccEEEEEEEEcccccccccEEEEEEEEccEEccccccccccccEEEEEEEEccccEEEEEcccccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHcccccccccccccccccccccEEEEccccccEEEEEEccccccEEEccccccccccccEEEccccccccccccccccccccEEEccccccccccccHHHccccccEEEccccccccccccccccccccEEEcccccccccccc
cHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccEEEccccHccccccccccHHHccccccEEEEcccccccccEEEEEEccccEEEEEEEEEEccccccccccEEEEEEccccEEEEEEcccccccccEEEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccccccccccccEEEEEEEEccccccccEEEccccccccEEEcccccccccccccEccccccccccHHHHHHHcccccccccEEEEccccccccccEEEEEEEHHHHccccccEEEEEEEEcccEccccccccHccccEEEcccccccEEEEEEEEccccccccEEEEEEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccccEccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHcccccccEEEEcccccccccccHHHHccccccEEEEccccccccccHHHHccccEEEEcccccccccccc
MPSVSLLLLSLLSLLslsssqspsgtlidcgtvnvytinglkwlpdndyvtggipkNVTVAVAVptlstvrsfpnklhqkfcyvvpvfrggkylVRTTYfyggvngrdsppvfdqmvdgtfwsEVNTTVDYVHGLASYYEGVFLAQGKhmslcigsnnytdsdpfisalefvpleesvynstdfgKFGLRLIARhsfgysgadnirypddpfdrfweplvdnkkpepgnlnvsvsgfwnlppskiFKTALAtrpaermeltwppvflsssRYYIALYfadnpsssregtrVFDIIIngipyhrnlnvtpdGVAVFAthwplsgatnitlnpapgsnkgplinggeIFQVLELGGRTLTRDVIALETLRnslqnppldwsgdpclphgyswtgitctydrrIRIVTLNLtnmglsgslpsnisRLTALSGIwlgnnnlsgtipdlsslmrletlhlednqfsgeipsslGKIQSLRELFLQnnnltgqipsslikpglnlktspgnqlssppps
MPSVSLLLLSLLSLLSlsssqspsgtlidcGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLstvrsfpnklhqKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSvsgfwnlppsKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFadnpsssregTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLrnslqnppldwSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLnlktspgnqlssppps
MPsvsllllsllsllslsssqsPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKTSPGNQLSSPPPS
*****LLLLSLLSLLS********GTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDN*****GNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADN*****EGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLED************KIQSLRELFLQNNNL*****************************
**SVSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVT*AVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKTSPGNQLSSPPP*
MPSVSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKT************
*PSVSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKTSPGNQLS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSVSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIKPGLNLKTSPGNQLSSPPPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
C0LGI2 929 Probable LRR receptor-lik no no 0.914 0.504 0.310 1e-58
Q9ZQQ7 886 Putative leucine-rich rep no no 0.914 0.529 0.313 1e-52
Q9ZQR3 868 Leucine-rich repeat recep no no 0.869 0.513 0.303 1e-47
C0LGR6 913 Probable LRR receptor-lik no no 0.886 0.498 0.293 1e-43
C0LGG6 876 Probable LRR receptor-lik no no 0.877 0.513 0.298 5e-42
Q9LIG2 899 Receptor-like protein kin no no 0.902 0.515 0.302 2e-41
O81069 884 Probable leucine-rich rep no no 0.881 0.511 0.268 4e-41
C0LGD8 864 Probable LRR receptor-lik no no 0.877 0.520 0.288 2e-40
Q9SI06 892 Putative leucine-rich rep no no 0.890 0.512 0.294 1e-39
Q9SNA3 889 Putative receptor-like pr no no 0.890 0.514 0.273 1e-39
>sp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1 Back     alignment and function desciption
 Score =  227 bits (579), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 265/525 (50%), Gaps = 56/525 (10%)

Query: 4   VSLLLLSLLSLLSLSSSQSPSGTLIDCGTVNVYT--INGLKWLPDNDYVTGGIPKNVTVA 61
           ++ L ++ L L+    SQ      IDCG  + YT    GL W+ D++ +  G P  VT+A
Sbjct: 5   LAQLAVTCLFLVPFVLSQVTEFVSIDCGCSSNYTDPRTGLGWVSDSEIIKQGKP--VTLA 62

Query: 62  VA---VPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVD 118
                       R FP   ++K+CY +      +Y+VRTT+ YGG+   ++ P F   +D
Sbjct: 63  NTNWNSMQYRRRRDFPTD-NKKYCYRLSTKERRRYIVRTTFLYGGLGSEEAYPKFQLYLD 121

Query: 119 GTFWSEVNTTVDYVHGLASYY--EGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEE 176
            T W+ V      +  ++  Y  E +  A   ++ +C+         PF+S LE  PL  
Sbjct: 122 ATKWATVT-----IQEVSRVYVEELIVRATSSYVDVCVCCA--ITGSPFMSTLELRPLNL 174

Query: 177 SVYNSTDFGKFGLRLIARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPE------PGNL 230
           S+Y +     F L++ AR +FG    D +RYPDDP+DR WE  + NK+P       PG  
Sbjct: 175 SMYATDYEDNFFLKVAARVNFGAPNMDALRYPDDPYDRIWESDI-NKRPNYLVGVAPGTT 233

Query: 231 NVSVSGFWN-----LPPSKIFKTALATRP---AERMELTWPPVFLSSSRYYIALYFADNP 282
            ++ S   N      PP K+ +TA+       + R+ L     F +++R Y   YFA+  
Sbjct: 234 RINTSKTINTLTREYPPMKVMQTAVVGTQGLISYRLNL---EDFPANARAYA--YFAEIE 288

Query: 283 SSSREGTRVFDIIINGIPYHRN--LNVTPDGVAVFATHWPLSGATNITLN--------PA 332
                 TR F ++    P + N  +N+  +    +  + P     N+TL+          
Sbjct: 289 ELGANETRKFKLVQPYFPDYSNAVVNIAENANGSYTLYEP--SYMNVTLDFVLTFSFGKT 346

Query: 333 PGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDWS---GDPCLPHGYS 389
             S +GPL+N  EI + L +  +T   DV  L+ +R+   +P  DW+   GDPC+P  +S
Sbjct: 347 KDSTQGPLLNAIEISKYLPISVKTDRSDVSVLDAIRS--MSPDSDWASEGGDPCIPVLWS 404

Query: 390 WTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMR 449
           W  + C+     R+  + L+   L G +P  I+ + AL+ +WL +N L+GT+PD+S L+ 
Sbjct: 405 W--VNCSSTSPPRVTKIALSRKNLRGEIPPGINYMEALTELWLDDNELTGTLPDMSKLVN 462

Query: 450 LETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIK 494
           L+ +HLE+NQ SG +P  L  + +L+EL ++NN+  G+IPS+L+K
Sbjct: 463 LKIMHLENNQLSGSLPPYLAHLPNLQELSIENNSFKGKIPSALLK 507

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ZQQ7|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQR3|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 OS=Arabidopsis thaliana GN=At2g14510 PE=2 SV=1 Back     alignment and function description
>sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 Back     alignment and function description
>sp|C0LGG6|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2 Back     alignment and function description
>sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 Back     alignment and function description
>sp|O81069|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1 Back     alignment and function description
>sp|C0LGD8|Y1755_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07550 OS=Arabidopsis thaliana GN=At1g07550 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 Back     alignment and function description
>sp|Q9SNA3|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
225432596514 PREDICTED: probable LRR receptor-like se 0.964 0.963 0.663 0.0
224099765514 predicted protein [Populus trichocarpa] 0.980 0.978 0.645 0.0
357444307508 Receptor-like protein kinase [Medicago t 0.951 0.960 0.633 1e-180
356574398510 PREDICTED: putative leucine-rich repeat 0.943 0.949 0.639 1e-175
356534228510 PREDICTED: leucine-rich repeat receptor- 0.951 0.956 0.638 1e-174
147790058503 hypothetical protein VITISV_012184 [Viti 0.904 0.922 0.651 1e-170
449444995519 PREDICTED: putative leucine-rich repeat 0.955 0.944 0.622 1e-169
15230596517 leucine-rich repeat-containing protein [ 0.939 0.932 0.607 1e-168
255552327557 serine-threonine protein kinase, plant-t 0.879 0.809 0.644 1e-167
224111226449 predicted protein [Populus trichocarpa] 0.773 0.884 0.681 1e-151
>gi|225432596|ref|XP_002281432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720 [Vitis vinifera] gi|297737017|emb|CBI26218.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/502 (66%), Positives = 387/502 (77%), Gaps = 7/502 (1%)

Query: 15  LSLSSSQSPSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFP 74
           L+ S SQSP G  IDCG      I+G +WLPD  YV+ G  KN+T     P LSTVRSFP
Sbjct: 15  LAQSQSQSPRGVFIDCGATVASLIDGRQWLPDATYVSSGTAKNLTDPNVAPILSTVRSFP 74

Query: 75  --NKLHQKFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYV 132
                ++KFCYVVPVFR GKY+VRTTY+YGGVNGRDSPPVFDQ+VDGT W  VNTT DY 
Sbjct: 75  LQGNTNKKFCYVVPVFRTGKYMVRTTYYYGGVNGRDSPPVFDQIVDGTLWGIVNTTDDYA 134

Query: 133 HGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLI 192
            GL SYYEGVF+A GK MSLCI +N  TDSDPFISALEFV L +S+YNSTDFG++GL L+
Sbjct: 135 RGLVSYYEGVFVAAGKTMSLCIAANTNTDSDPFISALEFVLLGDSLYNSTDFGQYGLSLV 194

Query: 193 ARHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALAT 252
           ARHSFG++G+  IRYPDD FDR+WEP V +        NV VS FWNLPP K+F+T L +
Sbjct: 195 ARHSFGHNGSI-IRYPDDQFDRYWEPFVLSNPTMAILRNVPVSDFWNLPPVKVFETELTS 253

Query: 253 RPAERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGV 312
              E +E  WPP  L +S YYIALYFAD  +SS   +RVF+I INGI Y+ NL+VT DGV
Sbjct: 254 SGMEPIEFQWPPASLPNSTYYIALYFADGRNSS---SRVFNISINGITYYHNLSVTSDGV 310

Query: 313 AVFATHWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQ 372
           AVFAT W L G TNI L PA GS+ GPLIN GE+F +L LGGRTLTRDVIALE+++ SL+
Sbjct: 311 AVFATQWLLGGLTNIILTPAAGSDIGPLINAGEVFNLLRLGGRTLTRDVIALESVKKSLE 370

Query: 373 NPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWL 432
           NPP DW+GDPC P  YSWTG+TC+   RIR+V+LNL+NMGLSGSL  +++ LTAL+ IWL
Sbjct: 371 NPPHDWNGDPCFPSQYSWTGVTCSEGPRIRVVSLNLSNMGLSGSLSPSVANLTALTNIWL 430

Query: 433 GNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSL 492
           GNN+LSG+IPDLSSL RLE LHLEDNQFSGEIPSSLG I SL+ELFLQNNNLTGQ+P+SL
Sbjct: 431 GNNSLSGSIPDLSSLKRLEILHLEDNQFSGEIPSSLGNIDSLQELFLQNNNLTGQVPNSL 490

Query: 493 I-KPGLNLKTSPGNQLSSPPPS 513
             KPGLNLK  PGN  SS PPS
Sbjct: 491 TGKPGLNLKIFPGNNFSSSPPS 512

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099765|ref|XP_002311609.1| predicted protein [Populus trichocarpa] gi|222851429|gb|EEE88976.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357444307|ref|XP_003592431.1| Receptor-like protein kinase [Medicago truncatula] gi|355481479|gb|AES62682.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356574398|ref|XP_003555335.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Back     alignment and taxonomy information
>gi|356534228|ref|XP_003535659.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510-like [Glycine max] Back     alignment and taxonomy information
>gi|147790058|emb|CAN75980.1| hypothetical protein VITISV_012184 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449444995|ref|XP_004140259.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cucumis sativus] gi|449481196|ref|XP_004156110.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15230596|ref|NP_187250.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|6671958|gb|AAF23217.1|AC013454_4 hypothetical protein [Arabidopsis thaliana] gi|30102730|gb|AAP21283.1| At3g05990 [Arabidopsis thaliana] gi|110743247|dbj|BAE99514.1| hypothetical protein [Arabidopsis thaliana] gi|332640806|gb|AEE74327.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255552327|ref|XP_002517208.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223543843|gb|EEF45371.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111226|ref|XP_002315786.1| predicted protein [Populus trichocarpa] gi|222864826|gb|EEF01957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
TAIR|locus:2083023517 AT3G05990 [Arabidopsis thalian 0.947 0.940 0.607 6.3e-163
TAIR|locus:2094103519 AT3G19230 [Arabidopsis thalian 0.947 0.936 0.481 1.9e-129
TAIR|locus:2057991 934 AT2G37050 [Arabidopsis thalian 0.883 0.485 0.339 2.4e-60
TAIR|locus:2008565 929 AT1G67720 [Arabidopsis thalian 0.900 0.497 0.322 1.1e-58
TAIR|locus:2055160 886 AT2G14440 [Arabidopsis thalian 0.851 0.493 0.319 3.5e-53
TAIR|locus:2055165 868 AT2G14510 [Arabidopsis thalian 0.822 0.486 0.308 2.7e-48
TAIR|locus:2032221626 RLP4 "receptor like protein 4" 0.888 0.728 0.306 1.1e-46
TAIR|locus:2017572 882 AT1G51790 [Arabidopsis thalian 0.840 0.488 0.314 3.1e-44
TAIR|locus:2066158 884 AT2G28990 [Arabidopsis thalian 0.832 0.483 0.3 6.7e-44
TAIR|locus:2059804 892 AT2G04300 [Arabidopsis thalian 0.857 0.493 0.314 8.8e-44
TAIR|locus:2083023 AT3G05990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1586 (563.4 bits), Expect = 6.3e-163, P = 6.3e-163
 Identities = 300/494 (60%), Positives = 367/494 (74%)

Query:    23 PSGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKL---HQ 79
             PS  LIDCG  +   I+G +W PD  +V+ G PKNV+  V    L TVRSFP  L   H 
Sbjct:    25 PSAILIDCGASSSSVIDGRQWQPDETFVSSGTPKNVSDQVLDEILFTVRSFPLSLDGTHH 84

Query:    80 KFCYVVPVFRGGKYLVRTTYFYGGVNGRDSPP-VFDQMVDGTFWSEVNTTVDYVHGLASY 138
             KFCYV+ V RG KY++RTTY+YGGVNG+ +PP VFDQ+VDGT W  VNTT DY  GLASY
Sbjct:    85 KFCYVMSVSRGWKYMIRTTYYYGGVNGKGTPPPVFDQIVDGTLWGIVNTTADYADGLASY 144

Query:   139 YEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIARHSFG 198
             YEGVFLAQGK +S+C+ SN+YT SDPFISALE V L+ ++YNSTDF   G+ L+ARH+FG
Sbjct:   145 YEGVFLAQGKSISVCVASNSYTTSDPFISALELVRLDGTLYNSTDFTTVGMSLVARHAFG 204

Query:   199 YSGADNIRYPDDPFDRFWEPLVDNKKPEPGNLNVSVSGFWNLPPSKIFKTALATRPAERM 258
             YSG   IR+PDD FDRFWEP   N    P N  + VSGFWNLPPS+IF T L     + +
Sbjct:   205 YSGPI-IRFPDDQFDRFWEPYSLNSTV-PNNRKLEVSGFWNLPPSRIFNTDLRATQVQPL 262

Query:   259 ELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVTPDGVAVFATH 318
             E TWPP+ L  + YYIALYFA +  S  +G+RVFD+ +NGI Y++ L+VTP G  +FA+ 
Sbjct:   263 EFTWPPMPLKMATYYIALYFAHDSDSMGDGSRVFDVSVNGITYYKELSVTPAGAVIFASR 322

Query:   319 WPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPLDW 378
             WPL G T + L+P  GSN  PLINGGE+F++L LGG+TL RDV AL  ++NS +N P DW
Sbjct:   323 WPLEGLTTLALSPRSGSNLPPLINGGEMFELLSLGGKTLVRDVTALNAIKNSFKNAPADW 382

Query:   379 SGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLS 438
             SGDPCLP  YSW+GI+C+   RIR+V LNLTNMG+SGSL   +++LTALS IWLGNN+LS
Sbjct:   383 SGDPCLPKNYSWSGISCSEGPRIRVVALNLTNMGVSGSLAPAVAKLTALSSIWLGNNSLS 442

Query:   439 GTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLI-KPGL 497
             G++PD SSL RLE+LH EDN FSG IPSSLG +  LRELFLQNNNLTGQ+PS+L+ KPGL
Sbjct:   443 GSLPDFSSLKRLESLHFEDNLFSGSIPSSLGGVPHLRELFLQNNNLTGQVPSNLLQKPGL 502

Query:   498 NLKTSPGNQLSSPP 511
             NL+TS GN   + P
Sbjct:   503 NLRTS-GNPFLTQP 515
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2094103 AT3G19230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057991 AT2G37050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008565 AT1G67720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055160 AT2G14440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055165 AT2G14510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032221 RLP4 "receptor like protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017572 AT1G51790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066158 AT2G28990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059804 AT2G04300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00081408
hypothetical protein (515 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 9e-81
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.002
>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information 
 Score =  254 bits (651), Expect = 9e-81
 Identities = 111/347 (31%), Positives = 168/347 (48%), Gaps = 37/347 (10%)

Query: 28  IDCG----TVNVYTINGLKWLPDNDYVTGGIPKNVTVA----VAVPTLSTVRSFPNKLHQ 79
           IDCG            G+ W+ D  ++  G   N++             T+RSFP+   +
Sbjct: 1   IDCGLPSNESYTDPSTGITWVSDAGFIDTGKSGNISKENSSSFLSKPYKTLRSFPDG--K 58

Query: 80  KFCYVVPVF--RGGKYLVRTTYFYGGVNGRDS---PPVFDQMVDGTFWSEVNTTVDYVHG 134
           + CY +PV   +G KYL+R T+ YG  +G +S   PP FD  +    W+ VN       G
Sbjct: 59  RNCYTLPVTPGKGTKYLIRATFLYGNYDGLNSVSSPPSFDLYLGVNLWTTVNL--SNDSG 116

Query: 135 LASYYEGVF-LAQGKHMSLCIGSNNYTDSDPFISALEFVPLEESVYNSTDFGKFGLRLIA 193
            +   E +  + +   +S+C+ +       PFISALE  PL +S+Y S+  G   L+L+A
Sbjct: 117 DSVVKEYIIHVTKSDTLSVCLVNTGTGT--PFISALELRPLPDSLYPSS-GGSQALKLVA 173

Query: 194 RHSFGYSGADNIRYPDDPFDRFWEPLVDNKKPE----PGNLNVSVSGFWNLPPSKIFKTA 249
           R +FG S    IRYPDD +DR WEP   +          ++++S +    +PPS + +TA
Sbjct: 174 RLNFGGSEGT-IRYPDDVYDRIWEPFFSSPGWSQISTSLSVDISSNNAPYIPPSAVLQTA 232

Query: 250 LATRPA-ERMELTWPPVFLSSSRYYIALYFADNPSSSREGTRVFDIIINGIPYHRNLNVT 308
           +    A   +  TW  V   +  YY+ L+FA+  S     TR FDI ING   + +++  
Sbjct: 233 VTPTNASAPLNFTWDLV-DPNFEYYVYLHFAEIQSLE---TREFDIYINGKTVYGDVSPK 288

Query: 309 P---DGVAV---FATHWPLSGATNITLNPAPGSNKGPLINGGEIFQV 349
               D  A+   F  +    G  NI+L P  GS   PL+N  EIF+V
Sbjct: 289 YLGTDTGALYLDFPVNVSGGGLLNISLVPTSGSTLPPLLNALEIFKV 335

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. The domain is found on a number of plant receptor kinases. Length = 335
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
PLN03150623 hypothetical protein; Provisional 100.0
PF12819347 Malectin_like: Carbohydrate-binding protein of the 100.0
PLN03150623 hypothetical protein; Provisional 99.72
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.54
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.31
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.22
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.17
KOG0617264 consensus Ras suppressor protein (contains leucine 99.14
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.11
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.64
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.61
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.5
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.46
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.38
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.26
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.24
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.21
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.11
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.09
PF12819347 Malectin_like: Carbohydrate-binding protein of the 98.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.02
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.0
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.98
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.6
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.49
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.48
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.45
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.36
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.26
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.92
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.86
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.81
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.57
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.06
PRK15386 426 type III secretion protein GogB; Provisional 95.9
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 95.51
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.47
PRK15386 426 type III secretion protein GogB; Provisional 95.22
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.41
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.69
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 92.32
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.73
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.57
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.96
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 89.05
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.4
KOG3593355 consensus Predicted receptor-like serine/threonine 86.82
smart0037026 LRR Leucine-rich repeats, outliers. 86.13
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 85.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.94
smart0037026 LRR Leucine-rich repeats, outliers. 84.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 81.14
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.7e-87  Score=731.18  Aligned_cols=486  Identities=29%  Similarity=0.449  Sum_probs=399.7

Q ss_pred             hhccccCCCceEEccCCCCccc--ccceEEeeCCCccccCCcceeccCCCCCCccceeeeCCCCCCCcceEEecccCCeE
Q 010316           16 SLSSSQSPSGTLIDCGTVNVYT--INGLKWLPDNDYVTGGIPKNVTVAVAVPTLSTVRSFPNKLHQKFCYVVPVFRGGKY   93 (513)
Q Consensus        16 ~~~~~~~~~~f~IdCG~~~~~~--~~~~~~~~D~~~~~~g~~~~~~~~~~~~~y~t~R~Fp~~~~~~~~Y~~~~~~~~~y   93 (513)
                      .+++++++++|+||||++++++  .+||+|++|..|..+.......++...++|+|||+||...++++||+||++++|+|
T Consensus        16 ~~~~~~~~~~~~I~CGs~~~~~~d~~~~~w~~D~~~~~~~~~~~~~~~~~~~~~~t~R~F~~~~g~~~cY~~~~~~~g~y   95 (623)
T PLN03150         16 ASLASPEPFTMRISCGARVNVRTAPTNTLWYKDFAYTGGIPANATRPSFIAPPLKTLRYFPLSDGPENCYNINRVPKGHY   95 (623)
T ss_pred             cccccCCCccEEEeCCCCCCcccCCCCCEEcCCcccccCccccccCcccccchhhccccCCcccccccceEeeecCCCcE
Confidence            3333455667899999987764  58999999977653222222233344568999999996446799999999999999


Q ss_pred             eEEEEEEecCCCCCCCCCeEEEEEeceeeEEEEecccccCCcceEEEEEEEecCCceeEEEEecCCCCCCCceeeeEeee
Q 010316           94 LVRTTYFYGGVNGRDSPPVFDQMVDGTFWSEVNTTVDYVHGLASYYEGVFLAQGKHMSLCIGSNNYTDSDPFISALEFVP  173 (513)
Q Consensus        94 lvRl~F~y~nyd~~~~~p~F~v~~~~~~~~~v~~~~~~~~~~~~~~e~~~~~~~~~~~~cl~~~~~~~s~pFIn~iEl~~  173 (513)
                      ||||||+|||||+.++.|.|||++|++.|.+|....... ...+++|+++.++++.+.|||+.++.  ++||||+|||||
T Consensus        96 lVRl~F~~~~y~~~~~~~~Fdv~~~~~~~~tv~~~~~~~-~~~v~~E~i~~~~~~~l~vcf~~~~~--~~pFIs~iEv~~  172 (623)
T PLN03150         96 SVRVFFGLVAEPNFDSEPLFDVSVEGTQISSLKSGWSSH-DEQVFAEALVFLTDGSASICFHSTGH--GDPAILSIEILQ  172 (623)
T ss_pred             EEEEEeecCCcCCCCCCCceEEEECcEEEEEEecCcccC-CCcEEEEEEEEecCCcEEEEEecCCC--CCCceeEEEEEE
Confidence            999999999999999999999999999999987532211 23578999999999999999997654  599999999999


Q ss_pred             cCCcccccC--CccceeEEEEEeeccCCCC-CCCCCCCCCCC--CcccccCCCC---C-CCCccceeecc-CCCCCCChH
Q 010316          174 LEESVYNST--DFGKFGLRLIARHSFGYSG-ADNIRYPDDPF--DRFWEPLVDN---K-KPEPGNLNVSV-SGFWNLPPS  243 (513)
Q Consensus       174 l~~~~y~~~--~~~~~~l~~~~R~n~G~~~-~~~i~~~~D~~--dR~W~~~~~~---~-~~~~~~~~i~~-~~~~~~~P~  243 (513)
                      ||+++|...  ...+.+|+++||+|+||.. ...+||++|+|  ||+|.++.++   . ..+++...|+. .+.++.||+
T Consensus       173 l~~~~y~~~~~~~~~~~L~~~~R~n~G~~~~~~~~d~~~D~~~~dR~W~~d~~~~~~~~~~~st~~~I~~~~~~~~~~P~  252 (623)
T PLN03150        173 VDDKAYNFGPSWGQGVILRTAKRLSCGAGKSKFDEDYSGDHWGGDRFWNRMQTFGSGSDQAISTENVIKKASNAPNFYPE  252 (623)
T ss_pred             cCcccccccccccCceEEEEEEEEEecCcccccccCCCCCcccCccccCcCcccCCCcccccccccccccccCCCccChH
Confidence            999999632  1235679999999999863 23589999998  9999987653   1 23455555552 245678999


Q ss_pred             HHHHhhhcCCCCCccEEEcCCCCCCCcceEEEEEeecCCC-CCCCceEEEEEEECCeecCCCcccccC----cceeeee-
Q 010316          244 KIFKTALATRPAERMELTWPPVFLSSSRYYIALYFADNPS-SSREGTRVFDIIINGIPYHRNLNVTPD----GVAVFAT-  317 (513)
Q Consensus       244 ~V~~TA~~~~~~~~~~~tw~~~~~~~~~y~v~lhFae~~~-~~~~~~R~F~i~in~~~~~~~~~~~~~----~~~~~~~-  317 (513)
                      .|||||+++.++ ..+++|.++++++..|+|||||||++. ....++|+|+|||||+.+.+++|+...    ..+++.. 
T Consensus       253 ~VyqTA~~~~~~-~~~lty~~~v~~~~~Y~VrLhFaEi~~~~~~~~~R~F~V~ing~~~~~~~di~~~~g~~~~~~~~~~  331 (623)
T PLN03150        253 SLYQSALVSTDT-QPDLSYTMDVDPNRNYSVWLHFAEIDNSITAEGKRVFDVLINGDTAFKDVDIVKMSGERYTALVLNK  331 (623)
T ss_pred             HHhhhhccccCC-CCceEEEeecCCCCCEEEEEEEEeccCccCCCceEEEEEEECCEEeecccChhhhcCCcccceEEEe
Confidence            999999999863 367888888999999999999999874 456689999999999998888887543    1222211 


Q ss_pred             -eccCCcceEEEecCCCCCCCCCccceeeeeeeeeccCcccchhhHHHHHHHHhcCCCCC-CCCCCCCCCCCCceeEEec
Q 010316          318 -HWPLSGATNITLNPAPGSNKGPLINGGEIFQVLELGGRTLTRDVIALETLRNSLQNPPL-DWSGDPCLPHGYSWTGITC  395 (513)
Q Consensus       318 -~~~~~g~~~l~l~~~~~s~l~p~ln~~ei~~~~~l~~~t~~~d~~aL~~l~~~~~~~~~-~w~g~pC~~~~~~w~gv~c  395 (513)
                       .....|.++|++++...+  +|+|||+|+++++..+..+.+.|+.||+.+|+.+..+.. +|.++||.|..+.|.|+.|
T Consensus       332 ~v~~~~g~l~isl~p~~~s--~pilNaiEI~~~~~~~~~t~~~~~~aL~~~k~~~~~~~~~~W~g~~C~p~~~~w~Gv~C  409 (623)
T PLN03150        332 TVAVSGRTLTIVLQPKKGT--HAIINAIEVFEIITAESKTLLEEVSALQTLKSSLGLPLRFGWNGDPCVPQQHPWSGADC  409 (623)
T ss_pred             EEeecCCeEEEEEeeCCCC--cceeeeeeeeeccccccccCchHHHHHHHHHHhcCCcccCCCCCCCCCCccccccccee
Confidence             111237789999987644  699999999999998888899999999999999876543 8999999988889999999


Q ss_pred             CCCC---ceeEEEeeecCCcCCcCCChhhhcCcCCCEEEccCCcccccCCC-CCCCCCCCEEEccCccCcccCCccccCC
Q 010316          396 TYDR---RIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPD-LSSLMRLETLHLEDNQFSGEIPSSLGKI  471 (513)
Q Consensus       396 ~~~~---l~~l~~L~Ls~n~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~~p~-l~~l~~L~~L~Ls~N~l~g~lP~~l~~l  471 (513)
                      ....   ...++.|+|++|++.|.+|+.+++|++|+.|+|++|.+.|.+|. ++.+++|+.|+|++|+++|.+|+.++++
T Consensus       410 ~~~~~~~~~~v~~L~L~~n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L  489 (623)
T PLN03150        410 QFDSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQL  489 (623)
T ss_pred             eccCCCCceEEEEEECCCCCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcC
Confidence            6432   24699999999999999999999999999999999999999995 8999999999999999999999999999


Q ss_pred             CCccEEEcccCcCCCcCCCCcC--CCCcCEEECCCCCC
Q 010316          472 QSLRELFLQNNNLTGQIPSSLI--KPGLNLKTSPGNQL  507 (513)
Q Consensus       472 ~~L~~L~L~~N~l~g~lp~~l~--l~~L~~L~l~~N~l  507 (513)
                      ++|++|+|++|+|+|.+|..+.  +..+..+++.+|..
T Consensus       490 ~~L~~L~Ls~N~l~g~iP~~l~~~~~~~~~l~~~~N~~  527 (623)
T PLN03150        490 TSLRILNLNGNSLSGRVPAALGGRLLHRASFNFTDNAG  527 (623)
T ss_pred             CCCCEEECcCCcccccCChHHhhccccCceEEecCCcc
Confidence            9999999999999999999887  45778899999874

>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-09
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-09
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 6e-04
2y5q_A 362 Listeria Monocytogenes Inlb (Internalin B) Residues 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 3/99 (3%)
Query: 397 YDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPD-LSSLMRLETLHL 455
           Y + +  + L+  +  L+G +PS +S  T L+ I L NN L+G IP  +  L  L  L L
Sbjct: 464 YVKTLETLILDFND--LTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKL 521
Query: 456 EDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLIK 494
            +N FSG IP+ LG  +SL  L L  N   G IP+++ K
Sbjct: 522 SNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK 560
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|2Y5Q|A Chain A, Listeria Monocytogenes Inlb (Internalin B) Residues 36-392 Length = 362 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-19
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 9e-10
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 8e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  120 bits (304), Expect = 9e-31
 Identities = 44/142 (30%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 360 DVIALETLRNSLQNPPL--DWSG--DPCLPHGYSWTGITCTYDRR-IRIVTLNLTNMGLS 414
           D  AL  ++  L NP     W    D C     +W G+ C  D +  R+  L+L+ + L 
Sbjct: 7   DKQALLQIKKDLGNPTTLSSWLPTTDCC---NRTWLGVLCDTDTQTYRVNNLDLSGLNLP 63

Query: 415 GS--LPSNISRLTALSGIWLGN-NNLSGTIPD-LSSLMRLETLHLEDNQFSGEIPSSLGK 470
               +PS+++ L  L+ +++G  NNL G IP  ++ L +L  L++     SG IP  L +
Sbjct: 64  KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ 123

Query: 471 IQSLRELFLQNNNLTGQIPSSL 492
           I++L  L    N L+G +P S+
Sbjct: 124 IKTLVTLDFSYNALSGTLPPSI 145
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.82
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.82
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.69
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.5
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.5
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.44
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.42
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.4
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.39
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.39
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.38
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.35
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.32
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.31
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.3
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.3
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.3
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.2
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.2
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.2
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.18
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.16
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.1
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.1
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.07
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.06
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.0
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.98
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.97
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.97
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.95
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.94
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.91
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.88
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.74
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.74
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.66
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.64
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.58
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.58
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.35
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.3
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.02
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.93
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.74
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.53
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.48
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.23
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.82
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 87.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.24
2w47_A144 Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1. 84.44
2w3j_A145 Carbohydrate binding module; sugar-binding protein 83.68
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
Probab=99.82  E-value=8.4e-20  Score=167.91  Aligned_cols=147  Identities=15%  Similarity=0.078  Sum_probs=103.2

Q ss_pred             CceEEccCCCCcccccceEEeeCCCccccCCcc----ee--ccCC--CCCCccceeeeCCCCCCCcceEEecccCCeEeE
Q 010316           24 SGTLIDCGTVNVYTINGLKWLPDNDYVTGGIPK----NV--TVAV--AVPTLSTVRSFPNKLHQKFCYVVPVFRGGKYLV   95 (513)
Q Consensus        24 ~~f~IdCG~~~~~~~~~~~~~~D~~~~~~g~~~----~~--~~~~--~~~~y~t~R~Fp~~~~~~~~Y~~~~~~~~~ylv   95 (513)
                      ..|+||||++...+..||+|.+|..|...|...    .+  ....  ..++|+|||+||.    ..+|.||+.++|+|+|
T Consensus         6 ~~~~INcGg~~~~d~~gr~w~~D~~~~~~g~~~~~~~~~~~~~~~~~~~~lY~TaR~~~~----~~tY~f~v~~~G~Y~V   81 (174)
T 2jwp_A            6 VIWAVNAGGESHVDVHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNED----SFGYDIPIKEEGEYVL   81 (174)
T ss_dssp             EEEEEEETSSSEEETTTEEECSSCSSTTCCCCCCCCTTSCCSSSCHHHHHTTTCCCCCCS----CEEEEEECCSCEEEEE
T ss_pred             EEEEEECCCCCccCCCCCEEcCCcCcccCCcccccccceEecccCCCCchhhhhhccCCC----CeEEEEEeCCCeEEEE
Confidence            357999999765556899999998664333221    11  1001  1238999999964    8999999988899999


Q ss_pred             EEEEEecCCCCCCCCCeEEEEEeceee-EEEEecccccCCcceEEEEEEEecC-----------CceeEEEEecCCCCCC
Q 010316           96 RTTYFYGGVNGRDSPPVFDQMVDGTFW-SEVNTTVDYVHGLASYYEGVFLAQG-----------KHMSLCIGSNNYTDSD  163 (513)
Q Consensus        96 Rl~F~y~nyd~~~~~p~F~v~~~~~~~-~~v~~~~~~~~~~~~~~e~~~~~~~-----------~~~~~cl~~~~~~~s~  163 (513)
                      ||||..-.|... ....|||++++... ..++.........+.++++.+.+..           ....++|.|.|.....
T Consensus        82 rLhF~ei~~~~~-~~rvFdV~ing~~~l~~fdi~~~ag~~~~~~~~~~~~v~~~~l~i~~~~~~~~g~L~I~f~p~~~~~  160 (174)
T 2jwp_A           82 VLKFAEVYFAQS-QQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYYDN  160 (174)
T ss_dssp             EEEEECCSCCCS-SSSCEEEEETTEEEEEEECHHHHHSSSSCEEEEEEEEEETTEEEETTEEEECCSEEEEEEECSSSCS
T ss_pred             EEEEeccccCCC-CCeEeEEEECCEEeecCcCHHHhhCCCeeEEEEEEEEEecCceeeeeeecccCCeEEEEEeccCCCC
Confidence            999997777653 34679999999664 4565433222233566777766422           3457899998865568


Q ss_pred             CceeeeEeeecC
Q 010316          164 PFISALEFVPLE  175 (513)
Q Consensus       164 pFIn~iEl~~l~  175 (513)
                      ||||||||++-+
T Consensus       161 a~inaIEI~~~~  172 (174)
T 2jwp_A          161 PKVCALFIMKGT  172 (174)
T ss_dssp             SSEEEEEEESSC
T ss_pred             cEEEEEEEEeCc
Confidence            999999999754
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2w47_A Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1.40A {Clostridium thermocellum} PDB: 2w1w_A Back     alignment and structure
>2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d1h6ta2 210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 62.7 bits (151), Expect = 3e-11
 Identities = 23/109 (21%), Positives = 39/109 (35%), Gaps = 5/109 (4%)

Query: 374 PPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTLNLTNMGLSGSLPSNISRLTALSGIWLG 433
           P    +    L    +             +  L L    +S   P  +S LT L  ++  
Sbjct: 280 PLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFA 337

Query: 434 NNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNN 482
           NN +S  +  L++L  +  L    NQ S   P  L  +  + +L L + 
Sbjct: 338 NNKVSD-VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.28
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.18
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.17
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.97
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.84
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.78
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.7
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.51
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.48
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.37
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.31
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.98
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.38
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.28
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.41
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 93.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 90.61
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.78  E-value=1.7e-19  Score=178.55  Aligned_cols=154  Identities=33%  Similarity=0.587  Sum_probs=135.3

Q ss_pred             ccchhhHHHHHHHHhcCCCCC--CCC--CCCCCCCCCceeEEecCCCC-ceeEEEeeecCCcCCc--CCChhhhcCcCCC
Q 010316          356 TLTRDVIALETLRNSLQNPPL--DWS--GDPCLPHGYSWTGITCTYDR-RIRIVTLNLTNMGLSG--SLPSNISRLTALS  428 (513)
Q Consensus       356 t~~~d~~aL~~l~~~~~~~~~--~w~--g~pC~~~~~~w~gv~c~~~~-l~~l~~L~Ls~n~l~g--~ip~~l~~l~~L~  428 (513)
                      |.++|.+||++||+.+.++..  +|.  +|+|.   +.|.||.|+..+ ..+|+.|+|+++++.|  .+|+++++|++|+
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~---~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~   79 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCN---RTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTT---TCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCC---CcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccc
Confidence            678999999999999987643  784  46662   469999998643 4589999999999997  5899999999999


Q ss_pred             EEEccC-CcccccCCC-CCCCCCCCEEEccCccCcccCCccccCCCCccEEEcccCcCCCcCCCCcC-CCCcCEEECCCC
Q 010316          429 GIWLGN-NNLSGTIPD-LSSLMRLETLHLEDNQFSGEIPSSLGKIQSLRELFLQNNNLTGQIPSSLI-KPGLNLKTSPGN  505 (513)
Q Consensus       429 ~L~Ls~-N~l~g~~p~-l~~l~~L~~L~Ls~N~l~g~lP~~l~~l~~L~~L~L~~N~l~g~lp~~l~-l~~L~~L~l~~N  505 (513)
                      +|+|++ |++.|.+|. ++.+++|++|+|++|++.+..|..+..+..|+.+++++|++.+.+|..+. ++.|+.+++++|
T Consensus        80 ~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            999997 899998884 89999999999999999998898899999999999999999989999998 999999999999


Q ss_pred             CCCCCCC
Q 010316          506 QLSSPPP  512 (513)
Q Consensus       506 ~l~~~pp  512 (513)
                      .+++..|
T Consensus       160 ~l~~~ip  166 (313)
T d1ogqa_         160 RISGAIP  166 (313)
T ss_dssp             CCEEECC
T ss_pred             ccccccc
Confidence            9886655
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure