Citrus Sinensis ID: 010426

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-
MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVCRDGQFV
ccccccccEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccHHcccccccccEEEEccccccccHHHHHHccccccccccEEEEEEcccccccccccccccHHHHHHHHccccccccccEEEEEEccccccccccccccccccEEEEEEccccccccccccccccccEEEEccccccEEEccccccccccccccEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccEEccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccHHHHHcccccccccEEcccEEEEccEEc
cccccHEEEEEccccccccccHHHHHHHHHHEEEEccccHHHcccccccccccccEEEEccccccccccccccccccccEccEEEEccccccccHHHHccHHHccccEEEccccccccHHHHHHHHHcccccccEEEEEEccccccccccccccccHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccEEcccHcccccccccccEEEEcccHHHHHccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHcHccHHHccccccccccccEEEEEccccccccccccccccccccccccEEEEEcccccccccHHHcccccccEEEEEcccccccccccccccccHcEEEEcccHHHHHHccccccccccEEEccEEEEccccc
msgwkhlrylnlsdtrirnlpkptcsliNLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFivgtdtkssglkdlkSLAFvggelsisglenviypweasEAMLCEKQYLEALSLQWRSqlqwgsqfddsrneSREELvlgklkpctsikkltikgyggkkipswiadpsfskmevlglencenctslpsfgllsslkHLTVKGLRKlksmgygehcsnpfqsletlwfedlpeweywdtkfeengvagfsslrELSILncskfsgilplcknsqleslcIRYCDSLTFIArrklpsslkwleiencekleslpndmhELNYLQHLcinrcpsivrfpeegfptnlVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWiegcdddeaecfpdeemgmmlptsLSYLNIIGfrnlkmlsskgfqsltsleflwiddcpnltsfpeaglpssilwlniwscpkleKVCKWHtkegskianiprvcrdgqfv
msgwkhlrylnlsdtrirnlpkptcSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREelvlgklkpctsikkltikgyggkkipsWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTkegskianiprvcrdgqfv
MSGWKHLRYLNLSDTRIRNLPKPTCSLINlqvlllrdcyyllklPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVCRDGQFV
***WKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQ***********LVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVC******
MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQW**********SREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIAR*KLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEK******KEGSKIANIPRVCRDGQFV
MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVCRDGQFV
MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVCRDGQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWSCPKLEKVCKWHTKEGSKIANIPRVCRDGQFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query511 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.726 0.351 0.350 2e-51
Q9LRR5 1424 Putative disease resistan no no 0.557 0.200 0.388 8e-45
Q7XA39988 Putative disease resistan N/A no 0.771 0.398 0.321 5e-35
Q7XBQ9970 Disease resistance protei N/A no 0.741 0.390 0.317 6e-31
Q7XA40992 Putative disease resistan N/A no 0.731 0.377 0.299 5e-28
Q7XA42979 Putative disease resistan N/A no 0.673 0.351 0.311 1e-27
Q9T048985 Disease resistance protei no no 0.150 0.078 0.440 2e-07
P23799630 Putative adenylate cyclas N/A no 0.477 0.387 0.270 9e-07
O23530 1301 Protein SUPPRESSOR OF npr no no 0.802 0.315 0.239 2e-06
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.837 0.417 0.249 5e-06
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  204 bits (518), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 145/414 (35%), Positives = 215/414 (51%), Gaps = 43/414 (10%)

Query: 6   HLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLI 65
           H R+L+LS T +  LPK  C + NLQ LLL  C  L +LP+ + NLINLR+LD++G  L 
Sbjct: 603 HARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKL- 661

Query: 66  KEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEA 125
           +++P     LK+LQ L+ F V   +  S + +L  L  + G+L I  L+ V+   +A+EA
Sbjct: 662 RQMPRRFGRLKSLQTLTTFFVSA-SDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEA 720

Query: 126 MLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKI 185
            L  K++L  +   WR+         +      E  V  KL+P   I+KL I+ Y G++ 
Sbjct: 721 NLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRF 780

Query: 186 PSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCS---- 241
           P W++DPSFS++  + L  C+ CTSLPS G L  LK L + G+  L+S+G   + S    
Sbjct: 781 PDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQL 840

Query: 242 -----NPFQSLETLWFEDLPEWEYW-DTKFEENGVAGFSSLRELSILNCSKFSGILPLCK 295
                 PF+SLETL F++LP+W+ W D +     +  F SL++L IL C + +G LP   
Sbjct: 841 RDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGDL--FPSLKKLFILRCPELTGTLP--- 895

Query: 296 NSQLESLCIRYCDSLTFIARRKLPSSLKWLEIENCEKLESLPNDMHELNY--LQHLCI-N 352
                          TF+       SL  L I  C  L+  P D HE +Y  LQ L I +
Sbjct: 896 ---------------TFLP------SLISLHIYKCGLLDFQP-DHHEYSYRNLQTLSIKS 933

Query: 353 RCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDD 406
            C ++V+FP   F  NL +LE+ +        + +  L    +LR L I  C +
Sbjct: 934 SCDTLVKFPLNHF-ANLDKLEVDQCTSLYSLELSNEHLRGPNALRNLRINDCQN 986
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query511
297736335 2534 unnamed protein product [Vitis vinifera] 0.970 0.195 0.384 3e-80
296090374 908 unnamed protein product [Vitis vinifera] 0.876 0.493 0.428 2e-77
359487176 1308 PREDICTED: putative disease resistance R 0.906 0.353 0.397 1e-76
225464007 1327 PREDICTED: putative disease resistance p 0.909 0.350 0.389 3e-76
296087826 918 unnamed protein product [Vitis vinifera] 0.898 0.5 0.384 4e-76
359487225 1373 PREDICTED: putative disease resistance R 0.913 0.340 0.402 3e-74
296087822 945 unnamed protein product [Vitis vinifera] 0.898 0.485 0.372 6e-74
359495024 1390 PREDICTED: putative disease resistance p 0.933 0.343 0.389 9e-74
147767435 1486 hypothetical protein VITISV_003329 [Viti 0.898 0.308 0.398 1e-72
359495896 1548 PREDICTED: putative disease resistance p 0.902 0.297 0.370 2e-72
>gi|297736335|emb|CBI24973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  305 bits (781), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 219/569 (38%), Positives = 297/569 (52%), Gaps = 73/569 (12%)

Query: 1    MSGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIM 60
            + G KHLRYLNLS T+I+ LP    +L NLQ L+L +C +L +LPSK+ NLI+LRHL+++
Sbjct: 1978 IGGLKHLRYLNLSFTQIKLLPDSVTNLYNLQTLILSNCKHLTRLPSKIGNLISLRHLNVV 2037

Query: 61   GAYLIKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPW 120
            G  L +++P  + +LK LQ LS+FIV +     G+K+LK L+ + GE+ IS LENV+   
Sbjct: 2038 GCSL-QDMPQQIGKLKKLQTLSDFIV-SKRGFLGIKELKDLSHLRGEICISKLENVVDVQ 2095

Query: 121  EASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGY 180
            +A +A L  K  +E LS+ W  +L      D S +E  E  VL  L+P TS+KKL I+GY
Sbjct: 2096 DARDANLKAKLNVERLSMIWSKEL------DGSHDEDAEMEVLLSLQPHTSLKKLNIEGY 2149

Query: 181  GGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGY---G 237
            GG++ P+WI DPS+ K+  L L  C  C S+PS G L  LK L +K +  +KS+G    G
Sbjct: 2150 GGRQFPNWICDPSYIKLVELSLIGCIRCISVPSVGQLPFLKKLVIKRMDGVKSVGLEFEG 2209

Query: 238  EHC--SNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPLCK 295
            +    + PFQ LE+LWFED+ EWE W           FS L +L I NC +    LP   
Sbjct: 2210 QVSLHAKPFQCLESLWFEDMMEWEEWCW-----SKKSFSCLHQLEIKNCPRLIKKLPTHL 2264

Query: 296  NS---------------------QLESLCIRYCDSLT----------------------- 311
             S                      LE L I YC  +T                       
Sbjct: 2265 TSLVKLSIENCPEMMVPLPTDLPSLEELNIYYCPEMTPQFDNHEFPLMPLRGASRSAIGI 2324

Query: 312  ----FIARRK---LPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEG 364
                ++   +   LP +L+ LEI  C+KLE LP  +     L  L I  CP +V FPE+G
Sbjct: 2325 TSHIYLEEEEEQGLPYNLQHLEIRKCDKLEKLPRGLQSYTSLAELIIEDCPKLVSFPEKG 2384

Query: 365  FPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTS 424
            FP  L  L I   +  M   +  WGL RLTSLR L I G   +            +LPT+
Sbjct: 2385 FPLMLRGLAISNCESLM--PLSEWGLARLTSLRTLTIGGIFLEATSFSNHHHHFFLLPTT 2442

Query: 425  LSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSF-PEAGLPSSILWLNIWSCPK 483
            L  + I  F+NL+ L+    Q+LTSL  L +  CP L SF P+ GLP  +  L I  CP 
Sbjct: 2443 LVEVCISSFQNLESLAFLSLQTLTSLRKLGVFQCPKLQSFIPKEGLPDMLSELYIRDCPL 2502

Query: 484  LEKVCKWHTKEG-SKIANIPRVCRDGQFV 511
            L + C     E   KIA+IP V  DG+ +
Sbjct: 2503 LIQRCSKEKGEDWPKIAHIPCVKIDGKLI 2531

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296090374|emb|CBI40193.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487176|ref|XP_003633526.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464007|ref|XP_002264663.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087826|emb|CBI35082.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087822|emb|CBI35078.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495024|ref|XP_002267933.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767435|emb|CAN66722.1| hypothetical protein VITISV_003329 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495896|ref|XP_003635111.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query511
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.675 0.327 0.345 2.6e-44
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.542 0.194 0.375 3.5e-43
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.407 0.115 0.301 5.6e-17
TAIR|locus:2151476 1168 VICTR "VARIATION IN COMPOUND T 0.448 0.196 0.312 2.4e-15
TAIR|locus:2151466 1353 VICTL "VARIATION IN COMPOUND T 0.448 0.169 0.312 3e-15
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.516 0.209 0.274 5.8e-09
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.495 0.195 0.258 6e-09
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.532 0.223 0.284 7.2e-09
TAIR|locus:2028681 1161 AT1G31540 [Arabidopsis thalian 0.432 0.190 0.278 1.8e-08
TAIR|locus:2129221 1147 RPP4 "recognition of peronospo 0.463 0.206 0.268 3.9e-08
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 477 (173.0 bits), Expect = 2.6e-44, P = 2.6e-44
 Identities = 126/365 (34%), Positives = 192/365 (52%)

Query:     6 HLRYLNLSDTRIRNLPKPTCSLINXXXXXXXXXXXXXXXPSKLRNLINLRHLDIMGAYLI 65
             H R+L+LS T +  LPK  C + N               P+ + NLINLR+LD++G  L 
Sbjct:   603 HARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKL- 661

Query:    66 KEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASEA 125
             +++P     LK+LQ L+ F V   +  S + +L  L  + G+L I  L+ V+   +A+EA
Sbjct:   662 RQMPRRFGRLKSLQTLTTFFVSA-SDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEA 720

Query:   126 MLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKKI 185
              L  K++L  +   WR+         +      E  V  KL+P   I+KL I+ Y G++ 
Sbjct:   721 NLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRF 780

Query:   186 PSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSN--- 242
             P W++DPSFS++  + L  C+ CTSLPS G L  LK L + G+  L+S+G   + S+   
Sbjct:   781 PDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQL 840

Query:   243 ------PFQSLETLWFEDLPEWEYW-DTKFEENGVAGFSSLRELSILNCSKFSGILPLCK 295
                   PF+SLETL F++LP+W+ W D +     +  F SL++L IL C + +G LP   
Sbjct:   841 RDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGDL--FPSLKKLFILRCPELTGTLPTFL 898

Query:   296 NSQLESLCIRYCDSLTFIARRKLPS--SLKWLEIEN-CEKLESLPNDMHELNYLQHLCIN 352
              S L SL I  C  L F       S  +L+ L I++ C+ L   P + H  N L  L ++
Sbjct:   899 PS-LISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSCDTLVKFPLN-HFAN-LDKLEVD 955

Query:   353 RCPSI 357
             +C S+
Sbjct:   956 QCTSL 960
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028681 AT1G31540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129221 RPP4 "recognition of peronospora parasitica 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-08
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-08
PRK15386 426 PRK15386, PRK15386, type III secretion protein Gog 0.004
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 56.0 bits (135), Expect = 4e-08
 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 28/244 (11%)

Query: 253 EDLPEWEYWDTKFEE--NGVAGFSSLRELSILNCSKFSGILPLCKNSQLESLCIRYCDSL 310
           E+L + +   +K E+  +GV   + LR + +        I  L   + LE+L +  C SL
Sbjct: 611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSL 670

Query: 311 TFIARRKLPSSLKWL------EIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEG 364
                 +LPSS+++L      ++  CE LE LP  ++ L  L  L ++ C  +  FP+  
Sbjct: 671 V-----ELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKSLYRLNLSGCSRLKSFPD-- 722

Query: 365 FPTNLVELEIRRVDVKMYKAIIHWGLHRLTSLRRLWIEGCDDDEAECF----PDEEMGMM 420
             TN+  L++    ++ + + +   L  L  L       C+    + +    P   +  M
Sbjct: 723 ISTNISWLDLDETAIEEFPSNLR--LENLDELIL-----CEMKSEKLWERVQPLTPLMTM 775

Query: 421 LPTSLSYLNIIGFRNLKMLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLPSSILWLNIWS 480
           L  SL+ L +    +L  L S   Q+L  LE L I++C NL + P      S+  L++  
Sbjct: 776 LSPSLTRLFLSDIPSLVELPSS-IQNLHKLEHLEIENCINLETLPTGINLESLESLDLSG 834

Query: 481 CPKL 484
           C +L
Sbjct: 835 CSRL 838

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 511
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
KOG4237498 consensus Extracellular matrix protein slit, conta 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
KOG4341483 consensus F-box protein containing LRR [General fu 99.37
KOG0617264 consensus Ras suppressor protein (contains leucine 99.35
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.3
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.19
KOG4341483 consensus F-box protein containing LRR [General fu 99.16
KOG0617264 consensus Ras suppressor protein (contains leucine 99.16
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
PRK15386 426 type III secretion protein GogB; Provisional 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.55
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.53
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.44
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.43
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.36
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
PRK15386 426 type III secretion protein GogB; Provisional 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.12
PLN03150623 hypothetical protein; Provisional 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PLN03150623 hypothetical protein; Provisional 98.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.92
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.89
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.87
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.58
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.52
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.15
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.94
smart0037026 LRR Leucine-rich repeats, outliers. 91.94
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.71
smart0037026 LRR Leucine-rich repeats, outliers. 87.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.3
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-32  Score=303.74  Aligned_cols=450  Identities=18%  Similarity=0.207  Sum_probs=237.6

Q ss_pred             CceeccEeecCCCccc-cCCccccccccccEEeccCccccccccccccCcCccceEEecCcccccccCCcccCcCCCccC
Q 010426            3 GWKHLRYLNLSDTRIR-NLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQAL   81 (511)
Q Consensus         3 ~l~~Lr~L~L~~n~i~-~l~~~~~~l~~L~~L~L~~n~~~~~l~~~~~~l~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L   81 (511)
                      ++++||+|++++|.+. .+|.  +.+++|++|++++|.....+|..++.+++|++|++++|.....+|..++++++|++|
T Consensus       116 ~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  193 (968)
T PLN00113        116 TSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFL  193 (968)
T ss_pred             cCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCee
Confidence            5677777887777775 3443  346777777777774445666667777777777777776334566667777777777


Q ss_pred             CceeeecCC-CccCccccccccccCceEEEccccCCCChhhhHHhccccccccceeEEeeecccccCCC----CCCCcc-
Q 010426           82 SNFIVGTDT-KSSGLKDLKSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQ----FDDSRN-  155 (511)
Q Consensus        82 ~~~~~~~~~-~~~~~~~l~~L~~l~~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~----~~~~~~-  155 (511)
                      +++++.+.. .|..+..+.+|+.+  .+..+.+..      ..+..+..+++|+.|++++|......+.    ...... 
T Consensus       194 ~L~~n~l~~~~p~~l~~l~~L~~L--~L~~n~l~~------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  265 (968)
T PLN00113        194 TLASNQLVGQIPRELGQMKSLKWI--YLGYNNLSG------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYL  265 (968)
T ss_pred             eccCCCCcCcCChHHcCcCCccEE--ECcCCccCC------cCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEE
Confidence            766665432 22334444444433  222222111      1122344556666666665511100000    000000 


Q ss_pred             ----hhhhhhhhcCCCCCCCCceEEEecCCCc-cCCcccCCCCCCCccEEEEecCCCCCCCC-CCCCCCCccEEEecCCc
Q 010426          156 ----ESREELVLGKLKPCTSIKKLTIKGYGGK-KIPSWIADPSFSKMEVLGLENCENCTSLP-SFGLLSSLKHLTVKGLR  229 (511)
Q Consensus       156 ----~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~~~~~~~~~~~~L~~L~l~~~~~~~~~~-~l~~l~~L~~L~l~~~~  229 (511)
                          ..........+..+++|+.|++++|... .+|.++.  .+++|+.|++++|......| .+..+++|+.|++++|.
T Consensus       266 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~--~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~  343 (968)
T PLN00113        266 FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI--QLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNK  343 (968)
T ss_pred             ECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHc--CCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCC
Confidence                0000001112223344444444444432 2333332  34455555555544333333 34445555555555444


Q ss_pred             cceEeccCCCCCCCCCCCCeEEcCCCCCchhhhhhccccccccCCCcCeeeeccCCCcCcCCCC--CCCCCCCEEEEEcc
Q 010426          230 KLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPL--CKNSQLESLCIRYC  307 (511)
Q Consensus       230 ~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~--~~~~~L~~L~l~~~  307 (511)
                      ....++   ..+..+++|+.|+++++.....+.     .....+++|+.++++++ .+.+.+|.  ..+++|+.|++++|
T Consensus       344 l~~~~p---~~l~~~~~L~~L~Ls~n~l~~~~p-----~~~~~~~~L~~L~l~~n-~l~~~~p~~~~~~~~L~~L~L~~n  414 (968)
T PLN00113        344 FSGEIP---KNLGKHNNLTVLDLSTNNLTGEIP-----EGLCSSGNLFKLILFSN-SLEGEIPKSLGACRSLRRVRLQDN  414 (968)
T ss_pred             CcCcCC---hHHhCCCCCcEEECCCCeeEeeCC-----hhHhCcCCCCEEECcCC-EecccCCHHHhCCCCCCEEECcCC
Confidence            322222   122234555555555443111110     00123445555555553 33323332  24667777777775


Q ss_pred             CCcceeccc--CCCCCcCeEeeccCcccccccccccCCCCcCeEEecCCCCCcccCCCCCCCCCceEEEEecccccccch
Q 010426          308 DSLTFIARR--KLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEIRRVDVKMYKAI  385 (511)
Q Consensus       308 ~~l~~~~~~--~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~L~~L~l~~~~~~~l~~~  385 (511)
                      .....++..  .+ ++|+.+++++|.....++..+..+++|++|++++|.....++.....++|+.|++   +.+.+...
T Consensus       415 ~l~~~~p~~~~~l-~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~l---s~n~l~~~  490 (968)
T PLN00113        415 SFSGELPSEFTKL-PLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDL---SRNQFSGA  490 (968)
T ss_pred             EeeeECChhHhcC-CCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEEC---cCCccCCc
Confidence            433222211  12 4777777777755555566666777777777777754444444444567788888   44455555


Q ss_pred             hhhhhccCCcccEEEEecCCCCCccccCcccccccCCCccceEeecCCcCCc-ccCccccCCCCCcCEEeEecCCCCccc
Q 010426          386 IHWGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLK-MLSSKGFQSLTSLEFLWIDDCPNLTSF  464 (511)
Q Consensus       386 ~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~-~l~~~~~~~l~~L~~L~l~~c~~l~~~  464 (511)
                      .+..+..+++|+.|++++ |.. ...+|. .+  ..+++|++|++++|. ++ .+| ..+..+++|++|++++|.....+
T Consensus       491 ~~~~~~~l~~L~~L~Ls~-N~l-~~~~p~-~~--~~l~~L~~L~Ls~N~-l~~~~p-~~~~~l~~L~~L~Ls~N~l~~~~  563 (968)
T PLN00113        491 VPRKLGSLSELMQLKLSE-NKL-SGEIPD-EL--SSCKKLVSLDLSHNQ-LSGQIP-ASFSEMPVLSQLDLSQNQLSGEI  563 (968)
T ss_pred             cChhhhhhhccCEEECcC-Ccc-eeeCCh-HH--cCccCCCEEECCCCc-ccccCC-hhHhCcccCCEEECCCCcccccC
Confidence            555677788888888888 443 334554 44  567788888888887 54 444 67777888888888886554455


Q ss_pred             CCC-CCCCcccEEEecCCcch
Q 010426          465 PEA-GLPSSILWLNIWSCPKL  484 (511)
Q Consensus       465 ~~~-~~~~~L~~L~l~~c~~l  484 (511)
                      |.. ...++|+++++++|+-.
T Consensus       564 p~~l~~l~~L~~l~ls~N~l~  584 (968)
T PLN00113        564 PKNLGNVESLVQVNISHNHLH  584 (968)
T ss_pred             ChhHhcCcccCEEeccCCcce
Confidence            541 12367888888877643

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 8e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 84/199 (42%), Gaps = 38/199 (19%)
Query: 170 TSIKKLTIKGYGGKKIPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLR 229
             ++ LT+     + +P+ IA  S +++  L +  C   T LP   L S+      +GL 
Sbjct: 127 AGLETLTLARNPLRALPASIA--SLNRLRELSIRACPELTELPE-PLASTDASGEHQGLV 183
Query: 230 KLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSG 289
            L+S+            LE      LP             +A   +L+ L I N S  S 
Sbjct: 184 NLQSL-----------RLEWTGIRSLPA-----------SIANLQNLKSLKIRN-SPLSA 220
Query: 290 ILPLCKN-SQLESLCIRYCDSLTFIARRKLP------SSLKWLEIENCEKLESLPNDMHE 342
           + P   +  +LE L +R C +L     R  P      + LK L +++C  L +LP D+H 
Sbjct: 221 LGPAIHHLPKLEELDLRGCTAL-----RNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHR 275
Query: 343 LNYLQHLCINRCPSIVRFP 361
           L  L+ L +  C ++ R P
Sbjct: 276 LTQLEKLDLRGCVNLSRLP 294

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score = 72.9 bits (179), Expect = 1e-13
 Identities = 89/511 (17%), Positives = 155/511 (30%), Gaps = 81/511 (15%)

Query: 2   SGWKHLRYLNLSDTRIRNLPKPT-CSLINLQVLLLRDCY--YLLKLPSKLRNLINLRHLD 58
               +LR L+L  ++I  L       L +L  L L  C     +      RNL  L  LD
Sbjct: 70  RNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGYFRNLKALTRLD 129

Query: 59  IMGAYLIK-EIPFGMKELKNLQAL---SNFIVGTDTKSSGLKDLKSLAFVGGELSISGLE 114
           +    +    +     +L +L+++   SN I         L+ L+        L+ + L 
Sbjct: 130 LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQI--FLVCEHELEPLQGKTLSFFSLAANSLY 187

Query: 115 NVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKK 174
           + +               LE L +   S   W      + + +  +     L     I  
Sbjct: 188 SRVSVDWGKCMNPFRNMVLEILDV---SGNGWTVDITGNFSNAISKSQAFSLILAHHIMG 244

Query: 175 LTIKGYGGKKIPSWIADP-SFSKMEVLGLENCENCTSLPS--FGLLSSLKHLTV------ 225
                +  K          + S +  L L +     SL S  F  L  LK L +      
Sbjct: 245 AGFGFHNIKDPDQNTFAGLARSSVRHLDLSHG-FVFSLNSRVFETLKDLKVLNLAYNKIN 303

Query: 226 -------KGLRKLKSMGYGEHCS-NPFQSLETLWFEDLPEWEY---WDTKFEENGVAGFS 274
                   GL  L+ +    + S N    L +  F  LP+  Y               F 
Sbjct: 304 KIADEAFYGLDNLQVL----NLSYNLLGELYSSNFYGLPKVAYIDLQKNHIAIIQDQTFK 359

Query: 275 SLRELSILNCSKFSGILPLCKNSQLESLCIRYCD--SLTFIARRKLPSSLKWLEIENCEK 332
            L +L  L+    + +  +     +  + +      +L  I        L    +EN + 
Sbjct: 360 FLEKLQTLDLR-DNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDI 418

Query: 333 LESLPNDMHELNYLQHLCINRCPSIVRFPEEGFPTNLVELEI-----RRVDVKMYKAIIH 387
           L  L      + +LQ L +N+         +  P+    LE        + +     +  
Sbjct: 419 LYFLLR----VPHLQILILNQN-RFSSCSGDQTPSENPSLEQLFLGENMLQLAWETELCW 473

Query: 388 WGLHRLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLKMLSSKGFQSL 447
                L+ L+ L++                                  L  L    F  L
Sbjct: 474 DVFEGLSHLQVLYLNHN------------------------------YLNSLPPGVFSHL 503

Query: 448 TSLEFLWIDDCPNLTSFPEAGLPSSILWLNI 478
           T+L  L ++    LT      LP+++  L+I
Sbjct: 504 TALRGLSLNSN-RLTVLSHNDLPANLEILDI 533
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query511
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.63
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.35
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.34
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.32
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.32
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.32
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.03
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.98
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.97
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.96
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.9
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.88
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.59
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.26
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 82.42
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-36  Score=322.89  Aligned_cols=474  Identities=16%  Similarity=0.088  Sum_probs=276.9

Q ss_pred             CCceeccEeecCCCccccCCccccccccccEEeccCccccccccccccCcCccceEEecCcccccccCCcccCcCCCccC
Q 010426            2 SGWKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQAL   81 (511)
Q Consensus         2 ~~l~~Lr~L~L~~n~i~~l~~~~~~l~~L~~L~L~~n~~~~~l~~~~~~l~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L   81 (511)
                      +++++|++|++++|.+...+..++.+++|++|++++|.....+|..++.+++|++|++++|.....+|..  .+++|++|
T Consensus       197 ~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L  274 (768)
T 3rgz_A          197 SRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYL  274 (768)
T ss_dssp             TTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEE
T ss_pred             ccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEE
Confidence            4677888888888887754334788888888888888544566777778888888888877732333322  66666666


Q ss_pred             CceeeecC-CCccCcccc-ccccccCceEEEccccCCCChhhhHHhccccccccceeEEeeecccccCCC-----CCCC-
Q 010426           82 SNFIVGTD-TKSSGLKDL-KSLAFVGGELSISGLENVIYPWEASEAMLCEKQYLEALSLQWRSQLQWGSQ-----FDDS-  153 (511)
Q Consensus        82 ~~~~~~~~-~~~~~~~~l-~~L~~l~~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~-----~~~~-  153 (511)
                      ++..+.+. ..|..+... ..|+.+  .+..+.+..      ..+..+..+++|+.|++++|......+.     .... 
T Consensus       275 ~L~~n~l~~~ip~~~~~~~~~L~~L--~Ls~n~l~~------~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~  346 (768)
T 3rgz_A          275 SLAENKFTGEIPDFLSGACDTLTGL--DLSGNHFYG------AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK  346 (768)
T ss_dssp             ECCSSEEEESCCCCSCTTCTTCSEE--ECCSSEEEE------CCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCC
T ss_pred             ECcCCccCCccCHHHHhhcCcCCEE--ECcCCcCCC------ccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCC
Confidence            66655543 222222221 333322  111111111      1112234445555555554411000000     0000 


Q ss_pred             --cch--hhhhhhhcCCCCCC-CCceEEEecCCCc-cCCcccCCCCCCCccEEEEecCCCCCCCC-CCCCCCCccEEEec
Q 010426          154 --RNE--SREELVLGKLKPCT-SIKKLTIKGYGGK-KIPSWIADPSFSKMEVLGLENCENCTSLP-SFGLLSSLKHLTVK  226 (511)
Q Consensus       154 --~~~--~~~~~~~~~l~~~~-~L~~L~l~~~~~~-~~~~~~~~~~~~~L~~L~l~~~~~~~~~~-~l~~l~~L~~L~l~  226 (511)
                        ...  .........+..++ +|+.|+++++... .++.++....+++|++|++++|...+.+| .++.+++|++|+++
T Consensus       347 ~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls  426 (768)
T 3rgz_A          347 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS  426 (768)
T ss_dssp             EEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECC
T ss_pred             EEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECc
Confidence              000  00000111122222 5666666655442 23333332235667777777776544555 56677777777777


Q ss_pred             CCccceEeccCCCCCCCCCCCCeEEcCCCCCchhhhhhccccccccCCCcCeeeeccCCCcCcCCCC--CCCCCCCEEEE
Q 010426          227 GLRKLKSMGYGEHCSNPFQSLETLWFEDLPEWEYWDTKFEENGVAGFSSLRELSILNCSKFSGILPL--CKNSQLESLCI  304 (511)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~--~~~~~L~~L~l  304 (511)
                      +|.....++   ..+..+++|+.|++.++.....+.     .....+++|++|++++| .+.+.+|.  ..+++|+.|++
T Consensus       427 ~N~l~~~~p---~~l~~l~~L~~L~L~~n~l~~~~p-----~~~~~l~~L~~L~L~~N-~l~~~~p~~l~~l~~L~~L~L  497 (768)
T 3rgz_A          427 FNYLSGTIP---SSLGSLSKLRDLKLWLNMLEGEIP-----QELMYVKTLETLILDFN-DLTGEIPSGLSNCTNLNWISL  497 (768)
T ss_dssp             SSEEESCCC---GGGGGCTTCCEEECCSSCCCSCCC-----GGGGGCTTCCEEECCSS-CCCSCCCGGGGGCTTCCEEEC
T ss_pred             CCcccCccc---HHHhcCCCCCEEECCCCcccCcCC-----HHHcCCCCceEEEecCC-cccCcCCHHHhcCCCCCEEEc
Confidence            765332333   233446777777777765322221     11346778888888885 44445553  36788888888


Q ss_pred             EccCCcceeccc--CCCCCcCeEeeccCcccccccccccCCCCcCeEEecCCCCCcccCC--------------------
Q 010426          305 RYCDSLTFIARR--KLPSSLKWLEIENCEKLESLPNDMHELNYLQHLCINRCPSIVRFPE--------------------  362 (511)
Q Consensus       305 ~~~~~l~~~~~~--~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~l~~~~~--------------------  362 (511)
                      ++|.....++..  .+ ++|++|++++|.....+|..+..+++|++|++++|.....+|.                    
T Consensus       498 ~~N~l~~~~p~~~~~l-~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~  576 (768)
T 3rgz_A          498 SNNRLTGEIPKWIGRL-ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYV  576 (768)
T ss_dssp             CSSCCCSCCCGGGGGC-TTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEE
T ss_pred             cCCccCCcCChHHhcC-CCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccc
Confidence            886544344321  22 4888888888866667888888888888888888843222221                    


Q ss_pred             ---------------------------------------------------CCCCCCCceEEEEecccccccchhhhhhc
Q 010426          363 ---------------------------------------------------EGFPTNLVELEIRRVDVKMYKAIIHWGLH  391 (511)
Q Consensus       363 ---------------------------------------------------~~~~~~L~~L~l~~~~~~~l~~~~~~~~~  391 (511)
                                                                         ...+++|+.|++   +.+.+++..+..++
T Consensus       577 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdL---s~N~l~g~ip~~l~  653 (768)
T 3rgz_A          577 YIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDM---SYNMLSGYIPKEIG  653 (768)
T ss_dssp             EEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEEC---CSSCCBSCCCGGGG
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEEC---cCCcccccCCHHHh
Confidence                                                               112467889999   67778877777899


Q ss_pred             cCCcccEEEEecCCCCCccccCcccccccCCCccceEeecCCcCCc-ccCccccCCCCCcCEEeEecCCCCcccCCCCCC
Q 010426          392 RLTSLRRLWIEGCDDDEAECFPDEEMGMMLPTSLSYLNIIGFRNLK-MLSSKGFQSLTSLEFLWIDDCPNLTSFPEAGLP  470 (511)
Q Consensus       392 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~-~l~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~  470 (511)
                      .++.|+.|++++ +.. ...+|. .+  ..+++|++|++++|. ++ .+| ..+..+++|++|++++|+--..+|..+.+
T Consensus       654 ~l~~L~~L~Ls~-N~l-~g~ip~-~l--~~L~~L~~LdLs~N~-l~g~ip-~~l~~l~~L~~L~ls~N~l~g~iP~~~~~  726 (768)
T 3rgz_A          654 SMPYLFILNLGH-NDI-SGSIPD-EV--GDLRGLNILDLSSNK-LDGRIP-QAMSALTMLTEIDLSNNNLSGPIPEMGQF  726 (768)
T ss_dssp             GCTTCCEEECCS-SCC-CSCCCG-GG--GGCTTCCEEECCSSC-CEECCC-GGGGGCCCCSEEECCSSEEEEECCSSSSG
T ss_pred             ccccCCEEeCcC-Ccc-CCCCCh-HH--hCCCCCCEEECCCCc-ccCcCC-hHHhCCCCCCEEECcCCcccccCCCchhh
Confidence            999999999999 443 346676 55  778999999999999 66 666 88899999999999996555567877766


Q ss_pred             CcccEEEecCCcchH----HHHhcC-CCCCcceeeeeeEe
Q 010426          471 SSILWLNIWSCPKLE----KVCKWH-TKEGSKIANIPRVC  505 (511)
Q Consensus       471 ~~L~~L~l~~c~~l~----~~~~~~-~~~~~~~~~~~~~~  505 (511)
                      .++....+.+++.|=    ..|... +++|++|+|.|+++
T Consensus       727 ~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          727 ETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             GGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             ccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            666666666766542    257777 99999999998764
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 511
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 43.1 bits (100), Expect = 6e-05
 Identities = 39/334 (11%), Positives = 94/334 (28%), Gaps = 26/334 (7%)

Query: 5   KHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYL 64
            +L  +N S+ ++ ++  P  +L  L  +L+ +       P      +    L       
Sbjct: 66  NNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITD 124

Query: 65  IKEIPFGMKELKNLQALSNFIVGTDTKSSGLKDLKSLAFVGGELSISGLENVIYPWEASE 124
           I  +       +   + +            +  L  L  +      + + ++      + 
Sbjct: 125 IDPLKNLTNLNRLELSSNTISD--------ISALSGLTSLQQLSFGNQVTDLKPLANLTT 176

Query: 125 AMLCEKQYLEALSLQWRSQLQWGSQFDDSRNESREELVLGKLKPCTSIKKLTIKGYGGKK 184
               +    +   +   ++L        + N+      +  + P   +  L      G +
Sbjct: 177 LERLDISSNKVSDISVLAKLTNLESLIATNNQ------ISDITPLGILTNLDELSLNGNQ 230

Query: 185 IPSWIADPSFSKMEVLGLENCENCTSLPSFGLLSSLKHLTVKGLRKLKSMGYGEHCSNPF 244
           +       S + +  L L N    ++L     L+ L  L +   +           +   
Sbjct: 231 LKDIGTLASLTNLTDLDLANN-QISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTN 289

Query: 245 QSLETLWFEDLPEWEYWDTKFEEN-------GVAGFSSLRELSILNCS--KFSGILPLCK 295
             L     ED+                     ++  SSL +L  L  +  K S +  L  
Sbjct: 290 LELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVSSLAN 349

Query: 296 NSQLESLCIRYCDSLTFIARRKLPSSLKWLEIEN 329
            + +  L   +           L   +  L + +
Sbjct: 350 LTNINWLSAGHNQISDLTPLANLT-RITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query511
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.07
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.89
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.72
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.89  E-value=3e-22  Score=195.15  Aligned_cols=82  Identities=21%  Similarity=0.257  Sum_probs=69.9

Q ss_pred             ceeccEeecCCCccccCCccccccccccEEeccCccccccccccccCcCccceEEecCcccccccCCcccCcCCCccCCc
Q 010426            4 WKHLRYLNLSDTRIRNLPKPTCSLINLQVLLLRDCYYLLKLPSKLRNLINLRHLDIMGAYLIKEIPFGMKELKNLQALSN   83 (511)
Q Consensus         4 l~~Lr~L~L~~n~i~~l~~~~~~l~~L~~L~L~~n~~~~~l~~~~~~l~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~~   83 (511)
                      +.+|++|+++++.|+.+ +++..+++|++|++++| .+..+|+ ++++++|++|++++|. +..++ .++.+++|+.|++
T Consensus        43 l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N-~l~~l~~-l~~L~~L~~L~L~~n~-i~~i~-~l~~l~~L~~L~~  117 (384)
T d2omza2          43 LDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNN-QLTDITP-LKNLTKLVDILMNNNQ-IADIT-PLANLTNLTGLTL  117 (384)
T ss_dssp             HTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSS-CCCCCGG-GTTCTTCCEEECCSSC-CCCCG-GGTTCTTCCEEEC
T ss_pred             hCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCC-cCCCCcc-ccCCcccccccccccc-ccccc-ccccccccccccc
Confidence            56799999999999988 56889999999999999 7888876 9999999999999998 77664 4889999999987


Q ss_pred             eeeecCC
Q 010426           84 FIVGTDT   90 (511)
Q Consensus        84 ~~~~~~~   90 (511)
                      ..+....
T Consensus       118 ~~~~~~~  124 (384)
T d2omza2         118 FNNQITD  124 (384)
T ss_dssp             CSSCCCC
T ss_pred             ccccccc
Confidence            6665544
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure