Citrus Sinensis ID: 010471


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MATSPHTNLHSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC
ccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccEEEEEcEEEEcccccccccccccEEEEccccEEEEEccccccHHHHHHHHHHcccccccccc
ccccccccEcEEEEccccccccccEEEcccccccccccEEEEEcccccccccEEEEccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEc
matsphtnlhsvtafypthtkplpiftvkiphfkskhqfqiisnnkkfkrvsfpitnsaftdsgvpnnesndniIKFFDYFQDLVAFIRQvfpggswwnlsdgqeaenptakpITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLfqdvyffdteavggltsRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLtlswpltlSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSimigqvspeQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDllpsnqflsEGVKLQRLMGHVQFVNisfhypsrptvpilnhvcLTIEANEVVAIVGLSGSGKSTFVNLLLRLyepsdgqvc
matsphtnlhsvtafypthtkPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPItnsaftdsgvpnnESNDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYgteekelgrykiWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRlyepsdgqvc
MATSPHTNLHSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWivlvavaslivaavsEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC
*********HSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTD********NDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQ***NPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLY********
************************IFTVKIPH*****************************************************************************************RMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLL**************LMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV*
********LHSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC
*****HTNLHSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFP*******************PITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSPHTNLHSVTAFYPTHTKPLPIFTVKIPHFKSKHQFQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
Q8RY46 700 ABC transporter B family yes no 0.919 0.67 0.554 1e-156
Q9JJ59 762 ATP-binding cassette sub- yes no 0.796 0.532 0.310 1e-48
Q9QYJ4 762 ATP-binding cassette sub- yes no 0.796 0.532 0.310 2e-48
Q9NP78 766 ATP-binding cassette sub- yes no 0.8 0.532 0.314 4e-48
Q03519 686 Antigen peptide transport no no 0.750 0.558 0.309 8e-42
P36372 703 Antigen peptide transport no no 0.652 0.473 0.332 2e-41
Q54BU4 909 ABC transporter B family yes no 0.764 0.429 0.275 3e-40
Q9FNU2 641 ABC transporter B family no no 0.807 0.642 0.28 4e-39
P36371 702 Antigen peptide transport no no 0.733 0.532 0.305 4e-38
Q9NRK6 738 ATP-binding cassette sub- no no 0.598 0.413 0.317 1e-37
>sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=1 SV=1 Back     alignment and function desciption
 Score =  550 bits (1417), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/471 (55%), Positives = 348/471 (73%), Gaps = 2/471 (0%)

Query: 39  FQIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWW 98
            Q  + N +   ++    N A  ++        DN+    +  +  + F+R + PGGSWW
Sbjct: 46  LQSSTRNYRLPSINCSTVNGAVAETAEYYEGEGDNV-SLAEKIRQCIDFLRTILPGGSWW 104

Query: 99  NLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEA 158
           + SD  +     AKP+TVW ALSRMW L+  D+W++  A ++LIVAA+SEIT+P  L  +
Sbjct: 105 SFSDEVDGRF-IAKPVTVWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTAS 163

Query: 159 VFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQD 218
           +FSAQ  +  VFH++ + LV LCVTSGI SG+R   F IAN++LVKR+RETLYS LLFQD
Sbjct: 164 IFSAQSGDIAVFHRNVKLLVTLCVTSGICSGIRGCFFGIANMILVKRMRETLYSTLLFQD 223

Query: 219 VYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSAL 278
           + FFD++ VG LTSRL +DCQ++S VIGND+NMI RN LQG GA I LL LSWPL L  L
Sbjct: 224 ISFFDSQTVGDLTSRLGSDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTL 283

Query: 279 LICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKI 338
           +IC  L+ ++ VYG YQK+ + L QE  A AN VAQET  +MRTVRVYGTE++E  RY  
Sbjct: 284 VICCILAAVMFVYGMYQKKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNH 343

Query: 339 WLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCE 398
           WL++LA I +R+S AYG+WN SF TLY +TQ++AVL+GG+SI+ GQ++ EQLTK++LY E
Sbjct: 344 WLQRLADISLRQSAAYGIWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSE 403

Query: 399 WLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFH 458
           WLIYATW + DNLSSL+QS+GA+EKVFQ++DL PS+QF+S+G +LQRL GH++FV++SF 
Sbjct: 404 WLIYATWWVGDNLSSLMQSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFS 463

Query: 459 YPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV 509
           YPSR  V ++ +V +++   EVVAIVGLSGSGKST VNLLL+LYEP+ GQ+
Sbjct: 464 YPSRDEVAVVQNVNISVHPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQI 514





Arabidopsis thaliana (taxid: 3702)
>sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 Back     alignment and function description
>sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 Back     alignment and function description
>sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 Back     alignment and function description
>sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 Back     alignment and function description
>sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 Back     alignment and function description
>sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
225452338 658 PREDICTED: ABC transporter B family memb 0.819 0.635 0.677 1e-167
225470565 705 PREDICTED: ABC transporter B family memb 0.962 0.696 0.589 1e-166
255560910 682 abc transporter, putative [Ricinus commu 0.892 0.667 0.615 1e-165
357485675 712 ABC transporter B family member [Medicag 0.866 0.620 0.612 1e-161
296080955587 unnamed protein product [Vitis vinifera] 0.784 0.681 0.657 1e-156
449450191 699 PREDICTED: ABC transporter B family memb 0.990 0.722 0.555 1e-155
356501630 701 PREDICTED: ABC transporter B family memb 0.988 0.718 0.520 1e-155
30698733 700 ABC transporter B family member 26 [Arab 0.919 0.67 0.554 1e-154
356497303 701 PREDICTED: ABC transporter B family memb 0.870 0.633 0.578 1e-153
297838869 700 ATTAP1 [Arabidopsis lyrata subsp. lyrata 0.919 0.67 0.554 1e-153
>gi|225452338|ref|XP_002272855.1| PREDICTED: ABC transporter B family member 26, chloroplastic [Vitis vinifera] gi|296087608|emb|CBI34864.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  595 bits (1535), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 286/422 (67%), Positives = 349/422 (82%), Gaps = 4/422 (0%)

Query: 88  IRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVS 147
           IR V PGGSWW LS+ +E     AK   V   L R+W L+  ++W++ VAV SL +AA+S
Sbjct: 55  IRSVLPGGSWWKLSEYEE----EAKAREVMPTLRRIWVLVEDERWVIFVAVGSLTLAALS 110

Query: 148 EITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLR 207
           EI+MP ++A +VFSAQ  E MVF+++S+ L+LLC+ SGI SGLRSGCF+IANI LVKRLR
Sbjct: 111 EISMPNLIAASVFSAQSGETMVFYRNSQLLILLCILSGICSGLRSGCFAIANITLVKRLR 170

Query: 208 ETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLL 267
           ETL SA+LFQD+ FF+TEAVG LTSRL ADCQ+LSN+IGNDINMILRN LQGAGA I+LL
Sbjct: 171 ETLCSAILFQDIDFFETEAVGDLTSRLGADCQQLSNIIGNDINMILRNFLQGAGALIHLL 230

Query: 268 TLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYG 327
           TLSWPL LS ++ICS LS I  VYGQY+++A++ TQE  A AN VAQET  +MRTVR YG
Sbjct: 231 TLSWPLALSTIVICSVLSAIFLVYGQYRRKAAMFTQEFTACANEVAQETFSLMRTVRTYG 290

Query: 328 TEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSP 387
           TEE EL RYK WL+KLAF+ IRES+AYG W +SF TLYRSTQV+AVLLGGMSI+ G V+P
Sbjct: 291 TEENELRRYKQWLDKLAFVSIRESVAYGFWGLSFNTLYRSTQVIAVLLGGMSILTGHVTP 350

Query: 388 EQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLM 447
           EQLTKY+LYCEWLIY T R+ DN +SLLQS+GA+ KVFQL+DLLPS+QF SEGVKL+RLM
Sbjct: 351 EQLTKYILYCEWLIYGTLRLGDNFASLLQSVGASGKVFQLMDLLPSDQFKSEGVKLKRLM 410

Query: 448 GHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDG 507
           GH++F N+SF+YPSR  VP+L HV ++++ANEVVAIVG+SGSGKS+ VNLLLRLYEP+ G
Sbjct: 411 GHIEFANVSFYYPSRVMVPVLEHVNISVQANEVVAIVGISGSGKSSLVNLLLRLYEPTTG 470

Query: 508 QV 509
           Q+
Sbjct: 471 QI 472




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225470565|ref|XP_002272060.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560910|ref|XP_002521468.1| abc transporter, putative [Ricinus communis] gi|223539367|gb|EEF40958.1| abc transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357485675|ref|XP_003613125.1| ABC transporter B family member [Medicago truncatula] gi|355514460|gb|AES96083.1| ABC transporter B family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|296080955|emb|CBI18648.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449450191|ref|XP_004142847.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356501630|ref|XP_003519627.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|30698733|ref|NP_177218.3| ABC transporter B family member 26 [Arabidopsis thaliana] gi|75330788|sp|Q8RY46.1|AB26B_ARATH RecName: Full=ABC transporter B family member 26, chloroplastic; Short=ABC transporter ABCB.26; Short=AtABCB26; AltName: Full=Antigen peptide transporter-like 1; AltName: Full=Transporter associated with antigen processing-like protein 1; Short=AtTAP1; Flags: Precursor gi|19335722|gb|AAL85485.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|110737412|dbj|BAF00650.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|332196967|gb|AEE35088.1| ABC transporter B family member 26 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356497303|ref|XP_003517500.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297838869|ref|XP_002887316.1| ATTAP1 [Arabidopsis lyrata subsp. lyrata] gi|297333157|gb|EFH63575.1| ATTAP1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
TAIR|locus:2026790 700 ABCB26 "ATP-binding cassette B 0.915 0.667 0.543 7.4e-137
UNIPROTKB|A8JBH0 560 CHLREDRAFT_121501 "Predicted p 0.562 0.512 0.379 4.2e-53
WB|WBGene00001812 761 haf-2 [Caenorhabditis elegans 0.643 0.431 0.349 8e-53
UNIPROTKB|O02086 761 haf-2 "Protein HAF-2" [Caenorh 0.643 0.431 0.349 8e-53
ZFIN|ZDB-GENE-050517-12 789 abcb9 "ATP-binding cassette, s 0.703 0.455 0.331 1.5e-49
UNIPROTKB|F1NN89 609 ABCB9 "Uncharacterized protein 0.639 0.535 0.345 1.1e-46
UNIPROTKB|F1Q234 766 ABCB9 "Uncharacterized protein 0.694 0.462 0.328 1.2e-46
UNIPROTKB|E2R807 930 ABCB9 "Uncharacterized protein 0.694 0.380 0.328 3.3e-46
UNIPROTKB|Q9NP78 766 ABCB9 "ATP-binding cassette su 0.7 0.466 0.326 3.5e-46
UNIPROTKB|Q6P2Q0 769 ABCB9 "ATP-binding cassette su 0.7 0.464 0.326 3.6e-46
TAIR|locus:2026790 ABCB26 "ATP-binding cassette B26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1340 (476.8 bits), Expect = 7.4e-137, P = 7.4e-137
 Identities = 256/471 (54%), Positives = 338/471 (71%)

Query:    40 QIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWN 99
             Q  + N +   ++    N A  ++        DN+    +  +  + F+R + PGGSWW+
Sbjct:    47 QSSTRNYRLPSINCSTVNGAVAETAEYYEGEGDNV-SLAEKIRQCIDFLRTILPGGSWWS 105

Query:   100 LSDGQEAENPTAKPITVWIALSRMWNLIGRDKWXXXXXXXXXXXXXXXEITMPRILAEAV 159
              SD  +     AKP+TVW ALSRMW L+  D+W               EIT+P  L  ++
Sbjct:   106 FSDEVDGRF-IAKPVTVWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTASI 164

Query:   160 FSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCF-SIANIVLVKRLRETLYSALLFQD 218
             FSAQ  +  VFH++ + LV LCVTSGI SG+R GCF  IAN++LVKR+RETLYS LLFQD
Sbjct:   165 FSAQSGDIAVFHRNVKLLVTLCVTSGICSGIR-GCFFGIANMILVKRMRETLYSTLLFQD 223

Query:   219 VYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSAL 278
             + FFD++ VG LTSRL +DCQ++S VIGND+NMI RN LQG GA I LL LSWPL L  L
Sbjct:   224 ISFFDSQTVGDLTSRLGSDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTL 283

Query:   279 LICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKI 338
             +IC  L+ ++ VYG YQK+ + L QE  A AN VAQET  +MRTVRVYGTE++E  RY  
Sbjct:   284 VICCILAAVMFVYGMYQKKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNH 343

Query:   339 WLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCE 398
             WL++LA I +R+S AYG+WN SF TLY +TQ++AVL+GG+SI+ GQ++ EQLTK++LY E
Sbjct:   344 WLQRLADISLRQSAAYGIWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSE 403

Query:   399 WLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFH 458
             WLIYATW + DNLSSL+QS+GA+EKVFQ++DL PS+QF+S+G +LQRL GH++FV++SF 
Sbjct:   404 WLIYATWWVGDNLSSLMQSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFS 463

Query:   459 YPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV 509
             YPSR  V ++ +V +++   EVVAIVGLSGSGKST VNLLL+LYEP+ GQ+
Sbjct:   464 YPSRDEVAVVQNVNISVHPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQI 514




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005215 "transporter activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0000302 "response to reactive oxygen species" evidence=RCA
GO:0010039 "response to iron ion" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0055072 "iron ion homeostasis" evidence=RCA
UNIPROTKB|A8JBH0 CHLREDRAFT_121501 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
WB|WBGene00001812 haf-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O02086 haf-2 "Protein HAF-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-12 abcb9 "ATP-binding cassette, sub-family B (MDR/TAP), member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN89 ABCB9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q234 ABCB9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R807 ABCB9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NP78 ABCB9 "ATP-binding cassette sub-family B member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P2Q0 ABCB9 "ATP-binding cassette sub-family B member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RY46AB26B_ARATHNo assigned EC number0.55410.91960.67yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
TIGR00958 711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 7e-79
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-58
TIGR02204 576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-50
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-48
PRK11176 582 PRK11176, PRK11176, lipid transporter ATP-binding/ 3e-26
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-25
cd03249 238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 3e-22
cd03228 171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-21
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 3e-19
cd03251 234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 7e-19
cd03248 226 cd03248, ABCC_TAP, ATP-binding cassette domain of 7e-19
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 1e-17
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-17
COG5265 497 COG5265, ATM1, ABC-type transport system involved 4e-16
TIGR03797 686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-15
cd03245 220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 3e-15
cd03254 229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 4e-15
PRK11160 574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-14
cd03253 236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-14
cd03225 211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 7e-14
cd03244 221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 7e-14
TIGR03375 694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-13
TIGR01846 694 TIGR01846, type_I_sec_HlyB, type I secretion syste 1e-13
TIGR03796 710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-13
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 3e-13
cd03293 220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 2e-12
TIGR02868 530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-12
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-12
cd03257 228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 3e-12
COG4608 268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-11
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 2e-11
cd03229 178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-11
COG1122 235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-11
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 2e-11
COG4987 573 COG4987, CydC, ABC-type transport system involved 3e-11
cd03252 237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 4e-11
cd03246 173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 6e-11
COG1136 226 COG1136, SalX, ABC-type antimicrobial peptide tran 6e-11
cd03255 218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 8e-11
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-10
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-10
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 1e-10
cd03214 180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-10
cd03230 173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-10
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 3e-10
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-10
TIGR02857 529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 9e-10
cd03261 235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 9e-10
TIGR01193 708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-09
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 3e-09
COG1125 309 COG1125, OpuBA, ABC-type proline/glycine betaine t 3e-09
cd03259 213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 3e-09
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 3e-09
COG1134 249 COG1134, TagH, ABC-type polysaccharide/polyol phos 3e-09
cd03247 178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-09
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 4e-09
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 4e-09
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 5e-09
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 5e-09
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 5e-09
cd03292 214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 6e-09
COG4615 546 COG4615, PvdE, ABC-type siderophore export system, 6e-09
cd03294 269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-08
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 1e-08
cd03216 163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-08
COG4988 559 COG4988, CydD, ABC-type transport system involved 2e-08
COG1123 539 COG1123, COG1123, ATPase components of various ABC 2e-08
COG1123 539 COG1123, COG1123, ATPase components of various ABC 2e-08
COG1127 263 COG1127, Ttg2A, ABC-type transport system involved 2e-08
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-08
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 3e-08
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 5e-08
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 5e-08
TIGR03608 206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 6e-08
COG4181 228 COG4181, COG4181, Predicted ABC-type transport sys 7e-08
cd03295 242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 9e-08
cd03219 236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 9e-08
COG1126 240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-07
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-07
COG2884 223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-07
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 1e-07
cd03260 227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-07
cd03235 213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 2e-07
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-07
PRK10419 268 PRK10419, nikE, nickel transporter ATP-binding pro 2e-07
cd03258 233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-07
TIGR01842 544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-07
COG0411 250 COG0411, LivG, ABC-type branched-chain amino acid 2e-07
TIGR02673 214 TIGR02673, FtsE, cell division ATP-binding protein 3e-07
cd03262 213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 3e-07
cd03263 220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-07
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 4e-07
PRK09493 240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 4e-07
cd03220 224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 4e-07
PRK13635 279 PRK13635, cbiO, cobalt transporter ATP-binding sub 4e-07
cd03250 204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 5e-07
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 8e-07
TIGR02769 265 TIGR02769, nickel_nikE, nickel import ATP-binding 8e-07
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 1e-06
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 1e-06
TIGR02211 221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 1e-06
TIGR02315 243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 1e-06
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 2e-06
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-06
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 2e-06
cd03369 207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-06
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 2e-06
cd03226 205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-06
PRK10522 547 PRK10522, PRK10522, multidrug transporter membrane 3e-06
cd03296 239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-06
TIGR01194 555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 3e-06
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 4e-06
PRK13648 269 PRK13648, cbiO, cobalt transporter ATP-binding sub 4e-06
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 4e-06
TIGR02324 224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 4e-06
PRK14250 241 PRK14250, PRK14250, phosphate ABC transporter ATP- 6e-06
COG4619 223 COG4619, COG4619, ABC-type uncharacterized transpo 6e-06
PRK11247 257 PRK11247, ssuB, aliphatic sulfonates transport ATP 6e-06
cd03298 211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 6e-06
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 1e-05
cd03224 222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-05
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-05
cd03301 213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 1e-05
COG3840 231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-05
PRK13650 279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-05
PRK11264 250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-05
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-05
TIGR03864 236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-05
COG1117 253 COG1117, PstB, ABC-type phosphate transport system 2e-05
cd03269 210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-05
PRK13637 287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-05
PRK11629 233 PRK11629, lolD, lipoprotein transporter ATP-bindin 3e-05
COG0396 251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-05
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 4e-05
COG1119 257 COG1119, ModF, ABC-type molybdenum transport syste 4e-05
cd03217 200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-05
cd03268 208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 5e-05
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP- 5e-05
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-04
PRK11248 255 PRK11248, tauB, taurine transporter ATP-binding su 1e-04
COG4778 235 COG4778, PhnL, ABC-type phosphonate transport syst 1e-04
COG4598 256 COG4598, HisP, ABC-type histidine transport system 1e-04
PRK13651 305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-04
PRK14258 261 PRK14258, PRK14258, phosphate ABC transporter ATP- 2e-04
smart00382 148 smart00382, AAA, ATPases associated with a variety 2e-04
PRK10575 265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-04
TIGR00968 237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-04
PRK11701 258 PRK11701, phnK, phosphonate C-P lyase system prote 2e-04
TIGR00972 247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 3e-04
PRK13644 274 PRK13644, cbiO, cobalt transporter ATP-binding sub 3e-04
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 3e-04
PRK11300 255 PRK11300, livG, leucine/isoleucine/valine transpor 3e-04
PRK14260 259 PRK14260, PRK14260, phosphate ABC transporter ATP- 3e-04
PRK10247 225 PRK10247, PRK10247, putative ABC transporter ATP-b 3e-04
TIGR01277 213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-04
cd03300 232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 4e-04
COG4604 252 COG4604, CeuD, ABC-type enterochelin transport sys 4e-04
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 5e-04
PRK11308 327 PRK11308, dppF, dipeptide transporter ATP-binding 5e-04
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding pr 5e-04
cd03213 194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 5e-04
COG4133 209 COG4133, CcmA, ABC-type transport system involved 5e-04
PRK11174 588 PRK11174, PRK11174, cysteine/glutathione ABC trans 6e-04
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 6e-04
PRK14274 259 PRK14274, PRK14274, phosphate ABC transporter ATP- 6e-04
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 7e-04
cd03291 282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 7e-04
COG4555 245 COG4555, NatA, ABC-type Na+ transport system, ATPa 7e-04
PRK13640 282 PRK13640, cbiO, cobalt transporter ATP-binding sub 8e-04
PRK13633 280 PRK13633, PRK13633, cobalt transporter ATP-binding 8e-04
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 8e-04
PRK10619 257 PRK10619, PRK10619, histidine/lysine/arginine/orni 9e-04
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 9e-04
TIGR01184 230 TIGR01184, ntrCD, nitrate transport ATP-binding su 0.001
PRK13649 280 PRK13649, cbiO, cobalt transporter ATP-binding sub 0.001
cd03237 246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.001
PRK13642 277 PRK13642, cbiO, cobalt transporter ATP-binding sub 0.001
CHL00131 252 CHL00131, ycf16, sulfate ABC transporter protein; 0.001
TIGR01978 243 TIGR01978, sufC, FeS assembly ATPase SufC 0.001
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 0.001
cd03267 236 cd03267, ABC_NatA_like, ATP-binding cassette domai 0.001
COG2401 593 COG2401, COG2401, ABC-type ATPase fused to a predi 0.001
PRK13634 290 PRK13634, cbiO, cobalt transporter ATP-binding sub 0.001
COG0410 237 COG0410, LivF, ABC-type branched-chain amino acid 0.002
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 0.002
cd03264 211 cd03264, ABC_drug_resistance_like, ABC-type multid 0.002
PRK15112 267 PRK15112, PRK15112, antimicrobial peptide ABC syst 0.002
cd03234 226 cd03234, ABCG_White, White pigment protein homolog 0.002
PRK10584 228 PRK10584, PRK10584, putative ABC transporter ATP-b 0.002
cd03215 182 cd03215, ABC_Carb_Monos_II, Second domain of the A 0.002
COG1101 263 COG1101, PhnK, ABC-type uncharacterized transport 0.002
PRK13641 287 PRK13641, cbiO, cobalt transporter ATP-binding sub 0.002
PRK14241 258 PRK14241, PRK14241, phosphate transporter ATP-bind 0.002
TIGR03410 230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 0.002
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.002
PRK14238 271 PRK14238, PRK14238, phosphate transporter ATP-bind 0.003
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 0.003
TIGR03740 223 TIGR03740, galliderm_ABC, gallidermin-class lantib 0.003
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 0.003
PRK13646 286 PRK13646, cbiO, cobalt transporter ATP-binding sub 0.003
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 0.004
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 0.004
PRK14248 268 PRK14248, PRK14248, phosphate ABC transporter ATP- 0.004
cd03266 218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 0.004
TIGR01166 190 TIGR01166, cbiO, cobalt transport protein ATP-bind 0.004
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 0.004
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 0.004
PRK14240 250 PRK14240, PRK14240, phosphate transporter ATP-bind 0.004
PRK15079 331 PRK15079, PRK15079, oligopeptide ABC transporter A 0.004
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
 Score =  260 bits (666), Expect = 7e-79
 Identities = 139/395 (35%), Positives = 219/395 (55%), Gaps = 10/395 (2%)

Query: 120 LSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPR---ILAEAVFSAQREEAMVFHKSSRF 176
           L R+  L GRD   ++ A   L ++++ E+ +P     + + +   +   A     +  F
Sbjct: 149 LFRLLGLSGRDWPWLISAFVFLTLSSLGEMFIPFYTGRVIDTLGGDKGPPA--LASAIFF 206

Query: 177 LVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTA 236
           + LL + S + +GLR G F+     +  R+RE L+ +LL QD+ FFD    G LTSRL++
Sbjct: 207 MCLLSIASSVSAGLRGGSFNYTMARINLRIREDLFRSLLRQDLGFFDENKTGELTSRLSS 266

Query: 237 DCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQK 296
           D Q +S  +  ++N++LRN +   G    +L LS  LT+  L+    + +   V+G+  +
Sbjct: 267 DTQTMSRSLSLNVNVLLRNLVMLLGLLGFMLWLSPRLTMVTLINLPLVFLAEKVFGKRYQ 326

Query: 297 RASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG- 355
             S   QE  A AN VA+E L  MRTVR +  EE E  R+K  LE+   +  R+++AY  
Sbjct: 327 LLSEELQEAVAKANQVAEEALSGMRTVRSFAAEEGEASRFKEALEETLQLNKRKALAYAG 386

Query: 356 -LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSL 414
            LW  S + +    QV+ +  GG  ++ G+VS   L  ++LY E L  A   +    S +
Sbjct: 387 YLWTTSVLGML--IQVLVLYYGGQLVLTGKVSSGNLVSFLLYQEQLGEAVRVLSYVYSGM 444

Query: 415 LQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLT 474
           +Q++GA+EKVF+ +D  P+   L+  +    L G ++F ++SF YP+RP VP+L  +  T
Sbjct: 445 MQAVGASEKVFEYLDRKPNIP-LTGTLAPLNLEGLIEFQDVSFSYPNRPDVPVLKGLTFT 503

Query: 475 IEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV 509
           +   EVVA+VG SGSGKST   LL  LY+P+ GQV
Sbjct: 504 LHPGEVVALVGPSGSGKSTVAALLQNLYQPTGGQV 538


[Transport and binding proteins, Other]. Length = 711

>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK10522 547 multidrug transporter membrane component/ATP-bindi 100.0
COG4987 573 CydC ABC-type transport system involved in cytochr 100.0
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG4988 559 CydD ABC-type transport system involved in cytochr 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0057 591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
COG5265 497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 100.0
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.97
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.96
COG4178 604 ABC-type uncharacterized transport system, permeas 99.94
KOG0060 659 consensus Long-chain acyl-CoA transporter, ABC sup 99.84
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.64
COG3638 258 ABC-type phosphate/phosphonate transport system, A 99.63
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.62
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.61
COG2884 223 FtsE Predicted ATPase involved in cell division [C 99.6
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 99.6
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.59
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.58
cd03216 163 ABC_Carb_Monos_I This family represents the domain 99.58
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.58
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.58
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 99.58
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.57
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.57
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.57
KOG0064 728 consensus Peroxisomal long-chain acyl-CoA transpor 99.57
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.57
cd03223 166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.57
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 99.57
cd03247 178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.56
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 99.56
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 99.56
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.56
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.56
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.55
cd03246 173 ABCC_Protease_Secretion This family represents the 99.55
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.55
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.55
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 99.55
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.55
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.55
PRK10908 222 cell division protein FtsE; Provisional 99.55
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 99.55
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.55
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.55
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.55
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.55
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 99.55
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.54
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 99.54
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.54
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.54
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
cd03230 173 ABC_DR_subfamily_A This family of ATP-binding prot 99.54
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 99.54
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.54
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.54
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.54
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 99.53
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.53
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.53
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.53
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 99.53
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.53
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 99.53
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.53
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 99.53
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.53
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 99.53
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.53
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 99.52
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 99.52
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.52
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 99.52
cd03228 171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.52
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 99.52
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 99.52
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 99.52
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 99.52
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 99.52
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.52
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.51
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 99.51
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 99.51
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 99.51
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 99.51
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.51
cd03234 226 ABCG_White The White subfamily represents ABC tran 99.51
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 99.51
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 99.51
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.5
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.5
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.5
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 99.5
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 99.5
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 99.5
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 99.5
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 99.5
COG4525 259 TauB ABC-type taurine transport system, ATPase com 99.5
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 99.49
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.49
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 99.49
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.49
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 99.49
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 99.48
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 99.48
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.48
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 99.48
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 99.48
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 99.48
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 99.48
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.47
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.47
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 99.47
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 99.47
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.47
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 99.47
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 99.47
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 99.47
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.47
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 99.47
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 99.47
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.46
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 99.46
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.46
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 99.46
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 99.46
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 99.46
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 99.46
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.46
COG4181 228 Predicted ABC-type transport system involved in ly 99.46
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.46
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.46
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 99.46
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 99.45
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 99.45
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 99.45
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.45
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 99.44
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.44
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.44
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 99.44
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 99.44
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 99.44
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 99.43
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.43
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK09984 262 phosphonate/organophosphate ester transporter subu 99.43
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 99.43
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 99.43
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 99.42
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 99.42
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 99.42
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.42
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 99.42
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 99.41
PRK10938 490 putative molybdenum transport ATP-binding protein 99.41
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 99.41
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 99.41
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.41
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 99.41
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 99.4
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.4
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 99.4
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 99.4
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.4
COG0411 250 LivG ABC-type branched-chain amino acid transport 99.39
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.39
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.39
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.39
COG1123 539 ATPase components of various ABC-type transport sy 99.39
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.38
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.38
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.38
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.38
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 99.38
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.37
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 99.37
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.36
PRK13546 264 teichoic acids export protein ATP-binding subunit; 99.36
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.36
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.36
PRK11147 635 ABC transporter ATPase component; Reviewed 99.36
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.35
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.35
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.35
PLN03073 718 ABC transporter F family; Provisional 99.34
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.33
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.33
PRK11147 635 ABC transporter ATPase component; Reviewed 99.32
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.32
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 99.32
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.31
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.31
COG4619 223 ABC-type uncharacterized transport system, ATPase 99.3
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.29
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.29
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.29
COG0410 237 LivF ABC-type branched-chain amino acid transport 99.29
PRK10938 490 putative molybdenum transport ATP-binding protein 99.28
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.28
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.28
PRK11098409 microcin B17 transporter; Reviewed 99.25
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.24
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 99.24
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.23
COG0488 530 Uup ATPase components of ABC transporters with dup 99.23
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.23
PLN03073 718 ABC transporter F family; Provisional 99.23
TIGR00767 415 rho transcription termination factor Rho. Members 99.22
COG1123 539 ATPase components of various ABC-type transport sy 99.22
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.22
COG0488 530 Uup ATPase components of ABC transporters with dup 99.21
PRK12369326 putative transporter; Reviewed 99.2
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 99.19
PF06472281 ABC_membrane_2: ABC transporter transmembrane regi 99.19
COG4555 245 NatA ABC-type Na+ transport system, ATPase compone 99.18
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.17
COG4152 300 ABC-type uncharacterized transport system, ATPase 99.16
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.16
COG4778 235 PhnL ABC-type phosphonate transport system, ATPase 99.15
PRK13409 590 putative ATPase RIL; Provisional 99.15
PLN03211 659 ABC transporter G-25; Provisional 99.15
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.15
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.14
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.13
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 99.12
COG4133 209 CcmA ABC-type transport system involved in cytochr 99.1
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.09
PRK13409 590 putative ATPase RIL; Provisional 99.08
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.07
COG4136 213 ABC-type uncharacterized transport system, ATPase 99.05
COG4598 256 HisP ABC-type histidine transport system, ATPase c 99.03
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.03
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.02
COG1137 243 YhbG ABC-type (unclassified) transport system, ATP 99.02
COG4172 534 ABC-type uncharacterized transport system, duplica 99.01
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.99
PLN03140 1470 ABC transporter G family member; Provisional 98.95
COG4674 249 Uncharacterized ABC-type transport system, ATPase 98.91
KOG2355 291 consensus Predicted ABC-type transport, ATPase com 98.9
COG2401 593 ABC-type ATPase fused to a predicted acetyltransfe 98.9
COG4161 242 ArtP ABC-type arginine transport system, ATPase co 98.88
PF13748237 ABC_membrane_3: ABC transporter transmembrane regi 98.87
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.87
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.87
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 98.81
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 98.75
PLN03140 1470 ABC transporter G family member; Provisional 98.72
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.68
COG4172 534 ABC-type uncharacterized transport system, duplica 98.68
PRK15494 339 era GTPase Era; Provisional 98.45
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 98.44
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.36
PF05992315 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009 98.36
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.3
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 98.22
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 98.21
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 98.19
PRK08149 428 ATP synthase SpaL; Validated 98.13
PF1355562 AAA_29: P-loop containing region of AAA domain 98.12
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 98.08
KOG0062 582 consensus ATPase component of ABC transporters wit 98.03
PRK07594 433 type III secretion system ATPase SsaN; Validated 98.01
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.98
COG4170 330 SapD ABC-type antimicrobial peptide transport syst 97.98
cd03282 204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.98
PRK09862 506 putative ATP-dependent protease; Provisional 97.93
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 97.92
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 97.91
PRK09099 441 type III secretion system ATPase; Provisional 97.91
cd03287 222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.89
TIGR02788 308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 97.89
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 97.89
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 97.88
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.87
PLN02796 347 D-glycerate 3-kinase 97.87
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 97.86
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 97.86
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 97.85
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.83
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 97.79
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 97.79
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 97.78
PRK01889 356 GTPase RsgA; Reviewed 97.77
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 97.76
PRK05922 434 type III secretion system ATPase; Validated 97.74
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 97.73
PRK06731 270 flhF flagellar biosynthesis regulator FlhF; Valida 97.72
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 97.72
PRK06936 439 type III secretion system ATPase; Provisional 97.7
PRK06820 440 type III secretion system ATPase; Validated 97.68
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.66
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.65
TIGR02858 270 spore_III_AA stage III sporulation protein AA. Mem 97.63
PRK00098 298 GTPase RsgA; Reviewed 97.62
cd03285 222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 97.61
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 97.6
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 97.59
PRK06315 442 type III secretion system ATPase; Provisional 97.58
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.57
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.56
KOG0062 582 consensus ATPase component of ABC transporters wit 97.54
cd03284 216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 97.54
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.51
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.48
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.45
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.44
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.41
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 97.38
PRK09183 259 transposase/IS protein; Provisional 97.37
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 97.37
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 97.3
PRK10416 318 signal recognition particle-docking protein FtsY; 97.3
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.3
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 97.3
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.28
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.28
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.23
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 97.22
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 97.22
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 97.16
PRK13851 344 type IV secretion system protein VirB11; Provision 97.15
cd03286 218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 97.09
PLN02165 334 adenylate isopentenyltransferase 97.08
PLN03046 460 D-glycerate 3-kinase; Provisional 97.04
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.99
PLN02318 656 phosphoribulokinase/uridine kinase 96.97
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.87
PRK12288 347 GTPase RsgA; Reviewed 96.87
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.86
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.84
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 96.76
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 96.75
PRK12289 352 GTPase RsgA; Reviewed 96.7
COG1162 301 Predicted GTPases [General function prediction onl 96.69
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 96.69
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 96.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.67
TIGR03819 340 heli_sec_ATPase helicase/secretion neighborhood AT 96.54
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 96.53
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.46
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.46
PRK13898 800 type IV secretion system ATPase VirB4; Provisional 96.43
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.42
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 96.42
PRK13900 332 type IV secretion system ATPase VirB11; Provisiona 96.42
cd01882 225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 96.37
PF00664275 ABC_membrane: ABC transporter transmembrane region 96.34
TIGR02782 299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.32
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.32
COG3910 233 Predicted ATPase [General function prediction only 96.31
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.31
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 96.3
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 96.3
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 96.28
PTZ00202 550 tuzin; Provisional 96.28
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 96.27
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 96.27
COG1133405 SbmA ABC-type long-chain fatty acid transport syst 96.26
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 96.23
PTZ00035 337 Rad51 protein; Provisional 96.23
PF00437 270 T2SE: Type II/IV secretion system protein; InterPr 96.22
PRK09866 741 hypothetical protein; Provisional 96.19
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 96.18
PRK09087 226 hypothetical protein; Validated 96.16
PRK13894 319 conjugal transfer ATPase TrbB; Provisional 96.13
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 96.11
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 96.03
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 96.02
PLN02348 395 phosphoribulokinase 95.91
PRK10522 547 multidrug transporter membrane component/ATP-bindi 95.86
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 95.83
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.78
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.78
PLN02772 398 guanylate kinase 95.77
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.74
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 95.7
TIGR00064 272 ftsY signal recognition particle-docking protein F 95.66
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 95.65
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 95.64
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 95.64
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 95.62
PRK13833 323 conjugal transfer protein TrbB; Provisional 95.62
PRK05439 311 pantothenate kinase; Provisional 95.56
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 95.48
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.48
PRK12608 380 transcription termination factor Rho; Provisional 95.48
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 95.43
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 95.42
PLN02200 234 adenylate kinase family protein 95.41
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 95.4
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 95.37
PRK10646153 ADP-binding protein; Provisional 95.32
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.32
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 95.29
TIGR02533 486 type_II_gspE general secretory pathway protein E. 95.27
PRK10246 1047 exonuclease subunit SbcC; Provisional 95.23
PF13481 193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.1
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 95.09
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.07
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 94.99
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 94.96
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.96
PRK13764 602 ATPase; Provisional 94.94
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 94.92
PLN02199 303 shikimate kinase 94.89
cd01134 369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 94.86
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.85
PF01580 205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 94.76
COG0630 312 VirB11 Type IV secretory pathway, VirB11 component 94.75
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 94.72
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 94.7
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 94.66
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 94.62
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.62
PRK13853 789 type IV secretion system protein VirB4; Provisiona 94.52
COG0802149 Predicted ATPase or kinase [General function predi 94.51
PRK09376 416 rho transcription termination factor Rho; Provisio 94.49
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 94.49
COG4962 355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.46
PRK14974 336 cell division protein FtsY; Provisional 94.45
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 94.44
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components 94.35
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 94.34
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 94.29
PRK08903 227 DnaA regulatory inactivator Hda; Validated 94.18
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 94.17
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 94.16
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 94.13
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 94.12
KOG0635 207 consensus Adenosine 5'-phosphosulfate kinase [Inor 94.02
PRK08084 235 DNA replication initiation factor; Provisional 94.0
PRK12678 672 transcription termination factor Rho; Provisional 94.0
PRK06526 254 transposase; Provisional 93.96
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 93.95
PF1324576 AAA_19: Part of AAA domain 93.93
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 93.88
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 93.88
PRK13830 818 conjugal transfer protein TrbE; Provisional 93.83
cd01132 274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 93.82
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 93.81
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=2.8e-70  Score=577.21  Aligned_cols=392  Identities=33%  Similarity=0.552  Sum_probs=368.0

Q ss_pred             HHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhchh--hhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          118 IALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQRE--EAMVFHKSSRFLVLLCVTSGIFSGLRSGCF  195 (510)
Q Consensus       118 ~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~~~--~~~~~~~~~~~l~~l~~~~~~~~~i~~~~~  195 (510)
                      ..++|++.+.+|+++++..++.++++.++..+++|.+++..++....+  ....+......+.++.++.+++.++|.+++
T Consensus       133 ~~~~rl~~l~~~~~~~l~~a~~~l~vss~~~~~iP~~~G~~id~~~~~~~~~~~~~~~~~~l~~l~~~~a~~~~~r~~~~  212 (716)
T KOG0058|consen  133 TLLKRLLGLLKPEWKWLVAAFVLLLVSSLINMFIPYYLGKLIDTISEGDDSADALKRACTILLGLFLIGALANAIRGGLL  212 (716)
T ss_pred             hHHHHHHHHhchhHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            477899999999999999999999999999999999999888654331  223455566677788888999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Q 010471          196 SIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTL  275 (510)
Q Consensus       196 ~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~l  275 (510)
                      .+++.++..++|.++|+++++|+++|||++++||++||+++|++.+.+.++..++..+++.++.++.+++|+++||+|++
T Consensus       213 ~~a~~rv~~rlR~~lF~sil~QdiaFFD~nktGeL~SRLtsD~~~vs~svs~nls~~lR~~~~~~g~~~~M~~~S~~Ltl  292 (716)
T KOG0058|consen  213 QYAGERVVARLRTDLFRSLLRQDIAFFDENKTGELISRLTSDTQIVSNSVSQNLSDGLRNLVQGFGGLGFMFSLSWRLTL  292 (716)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhccCCccHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          276 SALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG  355 (510)
Q Consensus       276 i~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (510)
                      ++++.+|++.++.++|+++.+++.++.|+..+++++++.|.+++|||||+|++|++|.+||.+..++..+...|....++
T Consensus       293 v~~i~~P~v~~~~~~yG~~~rklS~~~Q~a~A~a~~vaeE~ls~~rTVRsfa~E~~E~~ry~~~l~~~~~i~~k~a~a~~  372 (716)
T KOG0058|consen  293 VTLIVVPIVALVAKIYGKYLRKLSKQTQDALARANQVAEEVLSAMRTVRSFAAEEQEVKRYNKKLREVLKLSKKEAVAYG  372 (716)
T ss_pred             HHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCC
Q 010471          356 LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQ  435 (510)
Q Consensus       356 ~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e~~  435 (510)
                      .+.+..++..++..+.++++|++++..|++|.|++++|++|..++..++..++..+++++++.+|.+|++|++|++|..+
T Consensus       373 ~f~~~~~~~~~~~~~siL~~Gg~Lv~~g~mt~g~L~sFllY~~~~g~sl~~ls~~ys~lmkgvGAs~rvFel~dr~P~i~  452 (716)
T KOG0058|consen  373 IFFGSTNLLGNLAVLSILFYGGHLVLTGSLTSGALSSFLLYQVQLGSSLSGLSSFYSELMKGVGASERVFELMDRKPRIP  452 (716)
T ss_pred             HhHhHHHHHHhHHHHHHHHhccchhhcCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHHHHhccCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999865


Q ss_pred             CCCCCccCCCccccEEEEeeeEECCCCCCCCccccceEEeeCCCEEEEEcCCCCcHHHHHHHHhcccCCCCceeC
Q 010471          436 FLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC  510 (510)
Q Consensus       436 ~~~~~~~~~~~~~~I~f~nVsF~Y~~~~~~~vL~nisltI~~Ge~vAIVG~SGSGKSTL~kLL~g~y~p~sG~I~  510 (510)
                      .. +...|....|.|+|+||+|+||.||+.+||||+||+|+|||+||+||||||||||+++||+|||+|++|+|+
T Consensus       453 ~~-G~~~p~~~~G~IeF~~VsFaYP~Rp~~~Vlk~lsfti~pGe~vALVGPSGsGKSTiasLL~rfY~PtsG~Il  526 (716)
T KOG0058|consen  453 LT-GTLAPDHLQGVIEFEDVSFAYPTRPDVPVLKNLSFTIRPGEVVALVGPSGSGKSTIASLLLRFYDPTSGRIL  526 (716)
T ss_pred             CC-CccccccccceEEEEEeeeecCCCCCchhhcCceeeeCCCCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEE
Confidence            33 222333578999999999999999999999999999999999999999999999999999999999999985



>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK11098 microcin B17 transporter; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK12369 putative transporter; Reviewed Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06472 ABC_membrane_2: ABC transporter transmembrane region 2; InterPro: IPR010509 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF13748 ABC_membrane_3: ABC transporter transmembrane region Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF05992 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009248 The Rhizobium meliloti (Sinorhizobium meliloti) bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG1133 SbmA ABC-type long-chain fatty acid transport system, fused permease and ATPase components [Lipid metabolism] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13853 type IV secretion system protein VirB4; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
4ayw_A 619 Structure Of The Human Mitochondrial Abc Transporte 6e-39
4ayt_A 595 Structure Of The Human Mitochondrial Abc Transporte 1e-38
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 5e-36
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 5e-36
3b5w_A 582 Crystal Structure Of Eschericia Coli Msba Length = 4e-23
3qf4_B 598 Crystal Structure Of A Heterodimeric Abc Transporte 8e-23
3b5x_A 582 Crystal Structure Of Msba From Vibrio Cholerae Leng 9e-23
3b5y_A 582 Crystal Structure Of Msba From Salmonella Typhimuri 1e-22
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 6e-22
2hyd_A 578 Multidrug Abc Transporter Sav1866 Length = 578 2e-21
3qf4_A 587 Crystal Structure Of A Heterodimeric Abc Transporte 9e-18
1jj7_A 260 Crystal Structure Of The C-Terminal Atpase Domain O 2e-11
2ixe_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-09
2ixg_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-09
2ixf_A 271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-09
1xef_A 241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 1e-08
2ffa_A 247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 1e-08
1mt0_A 241 Atp-Binding Domain Of Haemolysin B From Escherichia 1e-08
2ff7_A 247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 1e-08
2ffb_A 247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 1e-08
2pmk_A 243 Crystal Structures Of An Isolated Abc-Atpase In Com 1e-08
3b5j_A 243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-08
3nh6_A 306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 6e-05
4hlu_A 268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-04
2iwh_A 986 Structure Of Yeast Elongation Factor 3 In Complex W 3e-04
2ghi_A 260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 3e-04
3si7_A 285 The Crystal Structure Of The Nbd1 Domain Of The Mou 4e-04
1q3h_A 286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 4e-04
1xfa_A 283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 4e-04
1xf9_A 283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 4e-04
1r0z_A 286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 4e-04
3dhw_C 343 Crystal Structure Of Methionine Importer Metni Leng 5e-04
3tui_C 366 Inward Facing Conformations Of The Metni Methionine 5e-04
3tuj_C 366 Inward Facing Conformations Of The Metni Methionine 6e-04
2iw3_A 986 Elongation Factor 3 In Complex With Adp Length = 98 6e-04
2ix8_A 976 Model For Eef3 Bound To An 80s Ribosome Length = 97 6e-04
1mv5_A 243 Crystal Structure Of Lmra Atp-Binding Domain Length 7e-04
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure

Iteration: 1

Score = 158 bits (400), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 99/313 (31%), Positives = 177/313 (56%), Gaps = 7/313 (2%) Query: 202 LVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAG 261 +V RLR +L+S++L Q+V FFD G L +RL++D L + +++ LR Q + Sbjct: 124 IVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASV 183 Query: 262 AFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMR 321 + +S L L + +SII +YG+Y ++ + +TQ+ A A +A+E + +R Sbjct: 184 GISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVR 243 Query: 322 TVRVYGTEEKELGRYKIWLEKLAFIRIRESMAY-GLWNMSFITLYRSTQVMAVLL-GGMS 379 TVR +G E E+ +Y ++ + + +E+ A G + + L + V++VL GG+ Sbjct: 244 TVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGAT--GLSGNLIVLSVLYKGGLL 301 Query: 380 IMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSE 439 + ++ +L+ +++Y W+ + + S L++ +GA ++++L++ P F +E Sbjct: 302 MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPF-NE 360 Query: 440 GVKL--QRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNL 497 GV L + G ++F N+ F YP+RP VPI L+I + V A+VG SGSGKST ++L Sbjct: 361 GVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSL 420 Query: 498 LLRLYEPSDGQVC 510 LLRLY+P+ G + Sbjct: 421 LLRLYDPASGTIS 433
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 Back     alignment and structure
>pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 1e-103
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 3e-74
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-72
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-66
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 3e-70
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 3e-65
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 1e-46
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 4e-36
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 6e-30
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 6e-23
2ghi_A 260 Transport protein; multidrug resistance protein, M 5e-22
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 3e-21
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 4e-21
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 8e-12
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 4e-11
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 6e-11
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 1e-10
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-10
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 3e-10
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 6e-10
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 8e-10
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 1e-08
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-09
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 7e-05
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-09
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-07
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 4e-09
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 1e-08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 4e-05
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 5e-08
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 2e-07
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 2e-07
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-07
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 7e-07
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 7e-07
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-07
1b0u_A 262 Histidine permease; ABC transporter, transport pro 9e-07
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 1e-06
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-06
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 3e-06
1g6h_A 257 High-affinity branched-chain amino acid transport 4e-06
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-05
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 1e-05
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 2e-05
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 2e-05
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 3e-05
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 3e-05
1sgw_A 214 Putative ABC transporter; structural genomics, P p 4e-05
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-04
1ji0_A 240 ABC transporter; ATP binding protein, structural g 5e-04
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 100.0
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 100.0
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 100.0
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 99.82
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 99.68
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.66
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.65
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 99.64
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 99.64
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.64
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.63
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 99.63
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.61
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 99.61
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.6
1ji0_A 240 ABC transporter; ATP binding protein, structural g 99.6
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.6
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.6
1sgw_A 214 Putative ABC transporter; structural genomics, P p 99.59
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.59
1g6h_A 257 High-affinity branched-chain amino acid transport 99.59
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 99.59
1b0u_A 262 Histidine permease; ABC transporter, transport pro 99.58
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.57
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.57
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.57
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.56
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.55
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.55
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.55
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 99.54
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.54
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.52
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.52
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.51
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.51
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.5
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.48
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 99.47
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.37
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.36
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.23
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.22
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.18
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.16
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.14
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.11
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 99.06
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.06
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.04
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.97
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.95
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.95
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.95
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.94
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.92
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.89
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.87
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.81
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.76
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 98.73
3ice_A 422 Transcription termination factor RHO; transcriptio 98.72
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.69
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.66
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.65
2og2_A 359 Putative signal recognition particle receptor; nuc 98.64
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 98.64
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.6
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.59
2ewv_A 372 Twitching motility protein PILT; pilus retraction 98.58
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.54
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.52
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.52
1p9r_A 418 General secretion pathway protein E; bacterial typ 98.5
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.5
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 98.5
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 98.48
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.47
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.41
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 98.38
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 98.38
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.35
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.34
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 98.32
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.29
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.26
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.22
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.22
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 98.21
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.16
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.09
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 98.06
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 98.05
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 98.03
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.01
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 98.01
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.98
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.95
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.95
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.94
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.94
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 97.93
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 97.93
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.91
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 97.87
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.85
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.84
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.82
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.76
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.69
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.61
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.59
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.59
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.5
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.49
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 97.46
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.46
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 97.45
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.43
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.35
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.34
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.32
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.3
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.24
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 97.21
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.12
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.06
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.93
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.91
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.9
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.74
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.68
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.66
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 96.65
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 96.63
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.59
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 96.57
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 96.49
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 96.47
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 96.44
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.4
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.38
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.26
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.16
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.15
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.02
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.0
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.97
2ged_A 193 SR-beta, signal recognition particle receptor beta 95.96
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 95.93
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.92
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.88
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.88
3l0o_A 427 Transcription termination factor RHO; helicase, RH 95.77
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.73
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 95.58
3bos_A 242 Putative DNA replication factor; P-loop containing 95.5
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 95.47
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.46
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.44
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.43
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 95.37
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.37
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 95.33
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.26
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 95.22
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 95.16
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.15
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 95.14
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 95.1
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.09
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 95.09
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 95.06
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.05
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 95.02
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 95.01
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 95.0
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.97
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.91
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 94.9
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.89
2hf9_A 226 Probable hydrogenase nickel incorporation protein 94.89
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 94.88
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.86
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.73
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 94.63
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 94.63
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.62
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 94.59
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 94.57
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 94.55
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.43
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 94.26
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 94.26
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 94.23
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 94.21
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 94.2
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.04
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 93.96
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 93.93
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 93.91
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 93.89
1u94_A 356 RECA protein, recombinase A; homologous recombinat 93.88
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 93.81
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 93.77
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 93.7
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 92.69
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 93.54
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.52
3co5_A143 Putative two-component system transcriptional RES 93.49
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.45
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 93.39
2chg_A 226 Replication factor C small subunit; DNA-binding pr 93.38
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 93.29
3pvs_A 447 Replication-associated recombination protein A; ma 93.24
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.2
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 93.19
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 93.16
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 93.15
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.14
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 93.08
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 93.08
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 93.08
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 92.94
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.89
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 92.87
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.86
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.84
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.81
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 92.81
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 92.79
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.79
1tue_A 212 Replication protein E1; helicase, replication, E1E 92.77
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 92.76
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 92.69
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 92.66
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 92.58
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 92.5
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 92.49
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 92.49
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 92.43
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 92.38
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 92.37
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 92.32
1xp8_A 366 RECA protein, recombinase A; recombination, radior 92.29
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 92.29
3io5_A 333 Recombination and repair protein; storage dimer, i 92.28
2qgz_A 308 Helicase loader, putative primosome component; str 92.19
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 92.12
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 92.12
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 92.03
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 91.97
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.92
1j3b_A 529 ATP-dependent phosphoenolpyruvate carboxykinase; a 91.83
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 91.72
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 91.65
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 91.61
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 91.46
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 91.34
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 91.18
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 91.16
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 91.16
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 91.13
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 91.05
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 90.95
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 90.94
2olr_A 540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 90.91
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 90.83
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 90.69
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 90.58
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 90.53
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 90.49
1ii2_A 524 Phosphoenolpyruvate carboxykinase; phosphate bindi 90.47
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.42
2r44_A 331 Uncharacterized protein; putative ATPase, structur 90.4
2xxa_A 433 Signal recognition particle protein; protein trans 89.97
1ytm_A 532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 89.94
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 89.92
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 89.82
2fna_A 357 Conserved hypothetical protein; structural genomic 89.74
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 89.71
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 89.69
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 89.59
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 89.39
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 89.29
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 89.22
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 89.18
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 89.13
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 89.08
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 89.05
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 88.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 88.84
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 88.79
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 88.75
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 88.49
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 88.45
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 88.43
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.35
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 88.3
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 88.27
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 88.24
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 88.2
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 88.16
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 88.13
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 87.98
2chq_A 319 Replication factor C small subunit; DNA-binding pr 87.93
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 87.75
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.61
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 87.44
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 87.27
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 87.24
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 87.22
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 86.53
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.39
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 86.31
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 86.12
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 85.9
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 85.87
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 85.7
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 85.28
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 85.27
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 85.01
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.88
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 84.63
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 84.17
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.94
3end_A 307 Light-independent protochlorophyllide reductase ir 83.94
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 83.76
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 83.63
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 83.36
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 83.24
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 82.77
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 82.3
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 81.64
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 81.64
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 81.58
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 81.32
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 81.1
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 80.99
3e2i_A 219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 80.92
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 80.48
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=1e-51  Score=452.04  Aligned_cols=392  Identities=20%  Similarity=0.344  Sum_probs=342.3

Q ss_pred             hHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhc-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          116 VWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQ-REEAMVFHKSSRFLVLLCVTSGIFSGLRSGC  194 (510)
Q Consensus       116 ~~~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~-~~~~~~~~~~~~~l~~l~~~~~~~~~i~~~~  194 (510)
                      .++.+++++++++++++.++.++++.++.+++.+..|++++..++... ..+...+......+.++.++..++.+++.+.
T Consensus        21 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  100 (598)
T 3qf4_B           21 PTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKI  100 (598)
T ss_dssp             HHHHHHHHGGGTGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCGGGHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            457889999999999999999999999999999999999888876432 1222222222233444556667788888888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q 010471          195 FSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLT  274 (510)
Q Consensus       195 ~~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~  274 (510)
                      ....+.++..++|.++|+|++++|++||+++++|++++|+++|++.+++.+...+..++..++.+++.+++++.++|+++
T Consensus       101 ~~~~~~~~~~~lr~~l~~~ll~~~~~~~~~~~~G~l~~r~~~D~~~i~~~~~~~~~~~~~~~~~~i~~~~~l~~~~~~l~  180 (598)
T 3qf4_B          101 MLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILS  180 (598)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHSCTHHHHHSCHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          275 LSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAY  354 (510)
Q Consensus       275 li~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~  354 (510)
                      +++++.+|++.++...+.++.++..++.++..++.++.+.|+++|+++||+|+.|+.+.++|++..++..+...+.....
T Consensus       181 l~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~~Ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~  260 (598)
T 3qf4_B          181 LVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFS  260 (598)
T ss_dssp             HHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHcCChHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999988888888888888888888899999999999999999999999999999999999999999888877666


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCC
Q 010471          355 GLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSN  434 (510)
Q Consensus       355 ~~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e~  434 (510)
                      +....+..++..+..++++++|++++..|.+++|.+++++.|...+..|+..+...+..+.++..+++|+.++++.+++.
T Consensus       261 ~~~~~~~~~~~~~~~~~~~~~g~~l~~~g~ls~g~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~s~~ri~~~l~~~~~~  340 (598)
T 3qf4_B          261 GVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEK  340 (598)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHHHHHHGGGTSSCHHHHHHHHTTTTSSHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCC
Confidence            66667777777777788899999999999999999999999999999999999999999999999999999999987764


Q ss_pred             CCCCCCccCCCccccEEEEeeeEECCCCCCCCccccceEEeeCCCEEEEEcCCCCcHHHHHHHHhcccCCCCceeC
Q 010471          435 QFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC  510 (510)
Q Consensus       435 ~~~~~~~~~~~~~~~I~f~nVsF~Y~~~~~~~vL~nisltI~~Ge~vAIVG~SGSGKSTL~kLL~g~y~p~sG~I~  510 (510)
                      +. ++.....+..++|+++||+|+|++  ++++|+|+||+|++||++|||||||||||||+++|+|+|+|++|+|+
T Consensus       341 ~~-~~~~~~~~~~~~i~~~~v~~~y~~--~~~~l~~isl~i~~G~~~~ivG~sGsGKSTll~~l~g~~~p~~G~i~  413 (598)
T 3qf4_B          341 DD-PDAVELREVRGEIEFKNVWFSYDK--KKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQIL  413 (598)
T ss_dssp             CC-SSCCCCCSCCCCEEEEEEECCSSS--SSCSCCSEEEECCTTCEEEEECCTTSSTTHHHHHHTTSSCCSEEEEE
T ss_pred             CC-CCCCCCCCCCCeEEEEEEEEECCC--CCccccceEEEEcCCCEEEEECCCCCcHHHHHHHHhcCcCCCCeEEE
Confidence            32 122222334578999999999974  35799999999999999999999999999999999999999999984



>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1jj7a_ 251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-21
d3b60a1 253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 3e-20
d2hyda1 255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-19
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 6e-18
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-17
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-16
d1v43a3 239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 7e-14
d1l2ta_ 230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-13
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-13
d1oxxk2 242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-13
d1g2912 240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-12
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-12
d1sgwa_ 200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 3e-12
d3dhwc1 240 c.37.1.12 (C:1-240) Methionine import ATP-binding 7e-12
d2awna2 232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-11
d1vpla_ 238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-11
d3d31a2 229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-11
d1ji0a_ 240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-10
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 3e-10
d1l7vc_ 231 c.37.1.12 (C:) ABC transporter involved in vitamin 3e-09
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 1e-08
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 3e-07
d1ye8a1 178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-06
d1np6a_ 170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.003
d1rz3a_ 198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 0.004
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 91.1 bits (226), Expect = 2e-21
 Identities = 32/69 (46%), Positives = 44/69 (63%)

Query: 441 VKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLR 500
           +    L G VQF ++SF YP+RP V +L  +  T+   EV A+VG +GSGKST   LL  
Sbjct: 3   LTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQN 62

Query: 501 LYEPSDGQV 509
           LY+P+ GQ+
Sbjct: 63  LYQPTGGQL 71


>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 100.0
d2hyda2323 Putative multidrug export ATP-binding/permease pro 100.0
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.84
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.82
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.81
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.8
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.79
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.68
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.66
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.66
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.66
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.65
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.64
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.63
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 99.63
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.62
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.6
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 97.59
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.49
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.2
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.45
d2hyda2323 Putative multidrug export ATP-binding/permease pro 96.38
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.09
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.9
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.86
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.66
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.6
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 95.55
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.53
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.41
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 95.36
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 95.31
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.23
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 95.11
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 94.87
d1xpua3 289 Transcription termination factor Rho, ATPase domai 94.76
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 94.69
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.69
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 94.59
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 94.55
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.45
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.37
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 94.34
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.32
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 94.24
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.19
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 94.07
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 93.94
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 93.82
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.75
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 93.56
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.51
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 93.5
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.38
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 93.38
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 93.24
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.03
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 93.03
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 93.03
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 92.99
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.71
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.61
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 92.51
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 92.44
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 91.85
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 91.15
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.52
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 90.23
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 90.03
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.85
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 89.84
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.8
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 89.43
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 89.25
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.91
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 87.61
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 85.43
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 85.36
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 84.84
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 84.57
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 83.96
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 83.95
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 83.85
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 82.94
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 82.34
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 81.83
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 81.49
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.48
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: ABC transporter transmembrane region
superfamily: ABC transporter transmembrane region
family: ABC transporter transmembrane region
domain: Multidrug resistance ABC transporter MsbA, N-terminal domain
species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00  E-value=3.5e-35  Score=290.08  Aligned_cols=317  Identities=19%  Similarity=0.272  Sum_probs=285.6

Q ss_pred             HHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhc-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          117 WIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQ-REEAMVFHKSSRFLVLLCVTSGIFSGLRSGCF  195 (510)
Q Consensus       117 ~~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~-~~~~~~~~~~~~~l~~l~~~~~~~~~i~~~~~  195 (510)
                      |+.+||+|++++|||+.++.++++.++.+++....|.+++..++... .++..........+.++.++..++.+++.+..
T Consensus         1 Wk~~krl~~~~~~~k~~l~~~~i~~~~~~~~~~~~~~~~~~~id~~~~~~~~~~l~~~~~~~~~~~~~~~i~~~~~~~~~   80 (319)
T d3b60a2           1 WQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGITSYISSYCI   80 (319)
T ss_dssp             CHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHSSTTSTTHHHHHHSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhhhhhhhhhhhh
Confidence            67899999999999999999999999999999999998888876532 23332222222233444566677888899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Q 010471          196 SIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTL  275 (510)
Q Consensus       196 ~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~l  275 (510)
                      ...+.++..++|.++++|++++|+++|+++++|++++|+++|++.+++.+...+..++..++.+++.+++++.++|++++
T Consensus        81 ~~~~~~~~~~l~~~~~~~ll~~~~~~~~~~~~g~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~l  160 (319)
T d3b60a2          81 SWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSI  160 (319)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCSTHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHH
T ss_pred             hhhhhccccchhhHHHHhhcccchhhccccccccccccccccccccccccccccchhhhhhhhhhhHHHHHHhhhccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471          276 SALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG  355 (510)
Q Consensus       276 i~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (510)
                      ++++..|+..++.....++.++..++.++..++.++.+.|.++|++++|+++.|+.+.+++++..++..+...|.....+
T Consensus       161 i~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (319)
T d3b60a2         161 ILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASS  240 (319)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHHHhhhhHHHHHHHHHHhhhhhHHHHHHHhhcCCceeeehhccchhhhhhhhhhhhhhHHHHHHHHHHH
Confidence            99999999999988888988898888999999999999999999999999999999999999999999999999887777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCC
Q 010471          356 LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPS  433 (510)
Q Consensus       356 ~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e  433 (510)
                      .......++.....++++++|++++.+|++|+|++++++.+...+..|+..+.+.+..+.++.++.+|+.|++|.+||
T Consensus       241 ~~~~~~~~~~~~~~~~~l~~g~~~~~~g~it~g~l~~~~~~~~~~~~pl~~l~~~~~~~~~~~~s~~Ri~elld~~~E  318 (319)
T d3b60a2         241 ISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQE  318 (319)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHSSSTTSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCS
T ss_pred             hcccchhhhhhhhhHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC
Confidence            777788888888888889999999999999999999999999999999999999999999999999999999998876



>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure