Citrus Sinensis ID: 010471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 510 | ||||||
| 225452338 | 658 | PREDICTED: ABC transporter B family memb | 0.819 | 0.635 | 0.677 | 1e-167 | |
| 225470565 | 705 | PREDICTED: ABC transporter B family memb | 0.962 | 0.696 | 0.589 | 1e-166 | |
| 255560910 | 682 | abc transporter, putative [Ricinus commu | 0.892 | 0.667 | 0.615 | 1e-165 | |
| 357485675 | 712 | ABC transporter B family member [Medicag | 0.866 | 0.620 | 0.612 | 1e-161 | |
| 296080955 | 587 | unnamed protein product [Vitis vinifera] | 0.784 | 0.681 | 0.657 | 1e-156 | |
| 449450191 | 699 | PREDICTED: ABC transporter B family memb | 0.990 | 0.722 | 0.555 | 1e-155 | |
| 356501630 | 701 | PREDICTED: ABC transporter B family memb | 0.988 | 0.718 | 0.520 | 1e-155 | |
| 30698733 | 700 | ABC transporter B family member 26 [Arab | 0.919 | 0.67 | 0.554 | 1e-154 | |
| 356497303 | 701 | PREDICTED: ABC transporter B family memb | 0.870 | 0.633 | 0.578 | 1e-153 | |
| 297838869 | 700 | ATTAP1 [Arabidopsis lyrata subsp. lyrata | 0.919 | 0.67 | 0.554 | 1e-153 |
| >gi|225452338|ref|XP_002272855.1| PREDICTED: ABC transporter B family member 26, chloroplastic [Vitis vinifera] gi|296087608|emb|CBI34864.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 595 bits (1535), Expect = e-167, Method: Compositional matrix adjust.
Identities = 286/422 (67%), Positives = 349/422 (82%), Gaps = 4/422 (0%)
Query: 88 IRQVFPGGSWWNLSDGQEAENPTAKPITVWIALSRMWNLIGRDKWIVLVAVASLIVAAVS 147
IR V PGGSWW LS+ +E AK V L R+W L+ ++W++ VAV SL +AA+S
Sbjct: 55 IRSVLPGGSWWKLSEYEE----EAKAREVMPTLRRIWVLVEDERWVIFVAVGSLTLAALS 110
Query: 148 EITMPRILAEAVFSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCFSIANIVLVKRLR 207
EI+MP ++A +VFSAQ E MVF+++S+ L+LLC+ SGI SGLRSGCF+IANI LVKRLR
Sbjct: 111 EISMPNLIAASVFSAQSGETMVFYRNSQLLILLCILSGICSGLRSGCFAIANITLVKRLR 170
Query: 208 ETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLL 267
ETL SA+LFQD+ FF+TEAVG LTSRL ADCQ+LSN+IGNDINMILRN LQGAGA I+LL
Sbjct: 171 ETLCSAILFQDIDFFETEAVGDLTSRLGADCQQLSNIIGNDINMILRNFLQGAGALIHLL 230
Query: 268 TLSWPLTLSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYG 327
TLSWPL LS ++ICS LS I VYGQY+++A++ TQE A AN VAQET +MRTVR YG
Sbjct: 231 TLSWPLALSTIVICSVLSAIFLVYGQYRRKAAMFTQEFTACANEVAQETFSLMRTVRTYG 290
Query: 328 TEEKELGRYKIWLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSP 387
TEE EL RYK WL+KLAF+ IRES+AYG W +SF TLYRSTQV+AVLLGGMSI+ G V+P
Sbjct: 291 TEENELRRYKQWLDKLAFVSIRESVAYGFWGLSFNTLYRSTQVIAVLLGGMSILTGHVTP 350
Query: 388 EQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLM 447
EQLTKY+LYCEWLIY T R+ DN +SLLQS+GA+ KVFQL+DLLPS+QF SEGVKL+RLM
Sbjct: 351 EQLTKYILYCEWLIYGTLRLGDNFASLLQSVGASGKVFQLMDLLPSDQFKSEGVKLKRLM 410
Query: 448 GHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDG 507
GH++F N+SF+YPSR VP+L HV ++++ANEVVAIVG+SGSGKS+ VNLLLRLYEP+ G
Sbjct: 411 GHIEFANVSFYYPSRVMVPVLEHVNISVQANEVVAIVGISGSGKSSLVNLLLRLYEPTTG 470
Query: 508 QV 509
Q+
Sbjct: 471 QI 472
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225470565|ref|XP_002272060.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255560910|ref|XP_002521468.1| abc transporter, putative [Ricinus communis] gi|223539367|gb|EEF40958.1| abc transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357485675|ref|XP_003613125.1| ABC transporter B family member [Medicago truncatula] gi|355514460|gb|AES96083.1| ABC transporter B family member [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|296080955|emb|CBI18648.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449450191|ref|XP_004142847.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356501630|ref|XP_003519627.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30698733|ref|NP_177218.3| ABC transporter B family member 26 [Arabidopsis thaliana] gi|75330788|sp|Q8RY46.1|AB26B_ARATH RecName: Full=ABC transporter B family member 26, chloroplastic; Short=ABC transporter ABCB.26; Short=AtABCB26; AltName: Full=Antigen peptide transporter-like 1; AltName: Full=Transporter associated with antigen processing-like protein 1; Short=AtTAP1; Flags: Precursor gi|19335722|gb|AAL85485.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|110737412|dbj|BAF00650.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|332196967|gb|AEE35088.1| ABC transporter B family member 26 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356497303|ref|XP_003517500.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297838869|ref|XP_002887316.1| ATTAP1 [Arabidopsis lyrata subsp. lyrata] gi|297333157|gb|EFH63575.1| ATTAP1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 510 | ||||||
| TAIR|locus:2026790 | 700 | ABCB26 "ATP-binding cassette B | 0.915 | 0.667 | 0.543 | 7.4e-137 | |
| UNIPROTKB|A8JBH0 | 560 | CHLREDRAFT_121501 "Predicted p | 0.562 | 0.512 | 0.379 | 4.2e-53 | |
| WB|WBGene00001812 | 761 | haf-2 [Caenorhabditis elegans | 0.643 | 0.431 | 0.349 | 8e-53 | |
| UNIPROTKB|O02086 | 761 | haf-2 "Protein HAF-2" [Caenorh | 0.643 | 0.431 | 0.349 | 8e-53 | |
| ZFIN|ZDB-GENE-050517-12 | 789 | abcb9 "ATP-binding cassette, s | 0.703 | 0.455 | 0.331 | 1.5e-49 | |
| UNIPROTKB|F1NN89 | 609 | ABCB9 "Uncharacterized protein | 0.639 | 0.535 | 0.345 | 1.1e-46 | |
| UNIPROTKB|F1Q234 | 766 | ABCB9 "Uncharacterized protein | 0.694 | 0.462 | 0.328 | 1.2e-46 | |
| UNIPROTKB|E2R807 | 930 | ABCB9 "Uncharacterized protein | 0.694 | 0.380 | 0.328 | 3.3e-46 | |
| UNIPROTKB|Q9NP78 | 766 | ABCB9 "ATP-binding cassette su | 0.7 | 0.466 | 0.326 | 3.5e-46 | |
| UNIPROTKB|Q6P2Q0 | 769 | ABCB9 "ATP-binding cassette su | 0.7 | 0.464 | 0.326 | 3.6e-46 |
| TAIR|locus:2026790 ABCB26 "ATP-binding cassette B26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1340 (476.8 bits), Expect = 7.4e-137, P = 7.4e-137
Identities = 256/471 (54%), Positives = 338/471 (71%)
Query: 40 QIISNNKKFKRVSFPITNSAFTDSGVPNNESNDNIIKFFDYFQDLVAFIRQVFPGGSWWN 99
Q + N + ++ N A ++ DN+ + + + F+R + PGGSWW+
Sbjct: 47 QSSTRNYRLPSINCSTVNGAVAETAEYYEGEGDNV-SLAEKIRQCIDFLRTILPGGSWWS 105
Query: 100 LSDGQEAENPTAKPITVWIALSRMWNLIGRDKWXXXXXXXXXXXXXXXEITMPRILAEAV 159
SD + AKP+TVW ALSRMW L+ D+W EIT+P L ++
Sbjct: 106 FSDEVDGRF-IAKPVTVWRALSRMWELVAEDRWVIFAAFSTLIVAALSEITIPHFLTASI 164
Query: 160 FSAQREEAMVFHKSSRFLVLLCVTSGIFSGLRSGCF-SIANIVLVKRLRETLYSALLFQD 218
FSAQ + VFH++ + LV LCVTSGI SG+R GCF IAN++LVKR+RETLYS LLFQD
Sbjct: 165 FSAQSGDIAVFHRNVKLLVTLCVTSGICSGIR-GCFFGIANMILVKRMRETLYSTLLFQD 223
Query: 219 VYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSAL 278
+ FFD++ VG LTSRL +DCQ++S VIGND+NMI RN LQG GA I LL LSWPL L L
Sbjct: 224 ISFFDSQTVGDLTSRLGSDCQQVSRVIGNDLNMIFRNVLQGTGALIYLLILSWPLGLCTL 283
Query: 279 LICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKI 338
+IC L+ ++ VYG YQK+ + L QE A AN VAQET +MRTVRVYGTE++E RY
Sbjct: 284 VICCILAAVMFVYGMYQKKTAKLIQEITASANEVAQETYSLMRTVRVYGTEKQEFKRYNH 343
Query: 339 WLEKLAFIRIRESMAYGLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCE 398
WL++LA I +R+S AYG+WN SF TLY +TQ++AVL+GG+SI+ GQ++ EQLTK++LY E
Sbjct: 344 WLQRLADISLRQSAAYGIWNWSFNTLYHATQIIAVLVGGLSILAGQITAEQLTKFLLYSE 403
Query: 399 WLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFH 458
WLIYATW + DNLSSL+QS+GA+EKVFQ++DL PS+QF+S+G +LQRL GH++FV++SF
Sbjct: 404 WLIYATWWVGDNLSSLMQSVGASEKVFQMMDLKPSDQFISKGTRLQRLTGHIEFVDVSFS 463
Query: 459 YPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV 509
YPSR V ++ +V +++ EVVAIVGLSGSGKST VNLLL+LYEP+ GQ+
Sbjct: 464 YPSRDEVAVVQNVNISVHPGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQI 514
|
|
| UNIPROTKB|A8JBH0 CHLREDRAFT_121501 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001812 haf-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O02086 haf-2 "Protein HAF-2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050517-12 abcb9 "ATP-binding cassette, sub-family B (MDR/TAP), member 9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NN89 ABCB9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q234 ABCB9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R807 ABCB9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NP78 ABCB9 "ATP-binding cassette sub-family B member 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P2Q0 ABCB9 "ATP-binding cassette sub-family B member 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 510 | |||
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 7e-79 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-58 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 1e-50 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 3e-48 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 3e-26 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 2e-25 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 3e-22 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 3e-21 | |
| pfam00664 | 274 | pfam00664, ABC_membrane, ABC transporter transmemb | 3e-19 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 7e-19 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 7e-19 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 1e-17 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 2e-17 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 4e-16 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 1e-15 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 3e-15 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 4e-15 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 1e-14 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 2e-14 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 7e-14 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 7e-14 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 1e-13 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 1e-13 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 2e-13 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 3e-13 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 2e-12 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 2e-12 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 3e-12 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 3e-12 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 1e-11 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 2e-11 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 2e-11 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 2e-11 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 2e-11 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 3e-11 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 4e-11 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 6e-11 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 6e-11 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 8e-11 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 1e-10 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 1e-10 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 1e-10 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 2e-10 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 2e-10 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 3e-10 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 5e-10 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 9e-10 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 9e-10 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 1e-09 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 3e-09 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 3e-09 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 3e-09 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 3e-09 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 3e-09 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 3e-09 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 4e-09 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 4e-09 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 5e-09 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 5e-09 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 5e-09 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 6e-09 | |
| COG4615 | 546 | COG4615, PvdE, ABC-type siderophore export system, | 6e-09 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 1e-08 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 1e-08 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 1e-08 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 2e-08 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-08 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-08 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 2e-08 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 3e-08 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 3e-08 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 5e-08 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 5e-08 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 6e-08 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 7e-08 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 9e-08 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 9e-08 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 1e-07 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 1e-07 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 1e-07 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 1e-07 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 2e-07 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 2e-07 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 2e-07 | |
| PRK10419 | 268 | PRK10419, nikE, nickel transporter ATP-binding pro | 2e-07 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 2e-07 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 2e-07 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 2e-07 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 3e-07 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 3e-07 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 3e-07 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 4e-07 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 4e-07 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 4e-07 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 4e-07 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 5e-07 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 8e-07 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 8e-07 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 1e-06 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 1e-06 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 1e-06 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 1e-06 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 2e-06 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 2e-06 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 2e-06 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 2e-06 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 2e-06 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 2e-06 | |
| PRK10522 | 547 | PRK10522, PRK10522, multidrug transporter membrane | 3e-06 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 3e-06 | |
| TIGR01194 | 555 | TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo | 3e-06 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 4e-06 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 4e-06 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 4e-06 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 4e-06 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 6e-06 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 6e-06 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 6e-06 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 6e-06 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 1e-05 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 1e-05 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 1e-05 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 1e-05 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 1e-05 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 1e-05 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 1e-05 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 2e-05 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 2e-05 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 2e-05 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 2e-05 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 2e-05 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 3e-05 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 3e-05 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 4e-05 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 4e-05 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 4e-05 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 5e-05 | |
| PRK13545 | 549 | PRK13545, tagH, teichoic acids export protein ATP- | 5e-05 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 1e-04 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 1e-04 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 1e-04 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 1e-04 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 2e-04 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 2e-04 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 2e-04 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 2e-04 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 2e-04 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 2e-04 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 3e-04 | |
| PRK13644 | 274 | PRK13644, cbiO, cobalt transporter ATP-binding sub | 3e-04 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 3e-04 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 3e-04 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 3e-04 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 3e-04 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 3e-04 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 4e-04 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 4e-04 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 5e-04 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 5e-04 | |
| PRK15064 | 530 | PRK15064, PRK15064, ABC transporter ATP-binding pr | 5e-04 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 5e-04 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 5e-04 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 6e-04 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 6e-04 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 6e-04 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 7e-04 | |
| cd03291 | 282 | cd03291, ABCC_CFTR1, ATP-binding cassette domain o | 7e-04 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 7e-04 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 8e-04 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 8e-04 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 8e-04 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 9e-04 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 9e-04 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 0.001 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| cd03237 | 246 | cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin | 0.001 | |
| PRK13642 | 277 | PRK13642, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| CHL00131 | 252 | CHL00131, ycf16, sulfate ABC transporter protein; | 0.001 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 0.001 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 0.001 | |
| COG2401 | 593 | COG2401, COG2401, ABC-type ATPase fused to a predi | 0.001 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 0.002 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 0.002 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 0.002 | |
| PRK15112 | 267 | PRK15112, PRK15112, antimicrobial peptide ABC syst | 0.002 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 0.002 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 0.002 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 0.002 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 0.002 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 0.002 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 0.002 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 0.002 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 0.002 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 0.003 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 0.003 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 0.003 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 0.003 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 0.003 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 0.004 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 0.004 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 0.004 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 0.004 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 0.004 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 0.004 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 0.004 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 0.004 | |
| PRK15079 | 331 | PRK15079, PRK15079, oligopeptide ABC transporter A | 0.004 |
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
Score = 260 bits (666), Expect = 7e-79
Identities = 139/395 (35%), Positives = 219/395 (55%), Gaps = 10/395 (2%)
Query: 120 LSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPR---ILAEAVFSAQREEAMVFHKSSRF 176
L R+ L GRD ++ A L ++++ E+ +P + + + + A + F
Sbjct: 149 LFRLLGLSGRDWPWLISAFVFLTLSSLGEMFIPFYTGRVIDTLGGDKGPPA--LASAIFF 206
Query: 177 LVLLCVTSGIFSGLRSGCFSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTA 236
+ LL + S + +GLR G F+ + R+RE L+ +LL QD+ FFD G LTSRL++
Sbjct: 207 MCLLSIASSVSAGLRGGSFNYTMARINLRIREDLFRSLLRQDLGFFDENKTGELTSRLSS 266
Query: 237 DCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTLSALLICSFLSIIVSVYGQYQK 296
D Q +S + ++N++LRN + G +L LS LT+ L+ + + V+G+ +
Sbjct: 267 DTQTMSRSLSLNVNVLLRNLVMLLGLLGFMLWLSPRLTMVTLINLPLVFLAEKVFGKRYQ 326
Query: 297 RASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG- 355
S QE A AN VA+E L MRTVR + EE E R+K LE+ + R+++AY
Sbjct: 327 LLSEELQEAVAKANQVAEEALSGMRTVRSFAAEEGEASRFKEALEETLQLNKRKALAYAG 386
Query: 356 -LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSL 414
LW S + + QV+ + GG ++ G+VS L ++LY E L A + S +
Sbjct: 387 YLWTTSVLGML--IQVLVLYYGGQLVLTGKVSSGNLVSFLLYQEQLGEAVRVLSYVYSGM 444
Query: 415 LQSIGATEKVFQLIDLLPSNQFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLT 474
+Q++GA+EKVF+ +D P+ L+ + L G ++F ++SF YP+RP VP+L + T
Sbjct: 445 MQAVGASEKVFEYLDRKPNIP-LTGTLAPLNLEGLIEFQDVSFSYPNRPDVPVLKGLTFT 503
Query: 475 IEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQV 509
+ EVVA+VG SGSGKST LL LY+P+ GQV
Sbjct: 504 LHPGEVVALVGPSGSGKSTVAALLQNLYQPTGGQV 538
|
[Transport and binding proteins, Other]. Length = 711 |
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 510 | |||
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 100.0 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 100.0 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 100.0 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 100.0 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 100.0 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 100.0 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 100.0 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 100.0 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 100.0 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 100.0 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 100.0 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 100.0 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 100.0 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 100.0 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 100.0 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 100.0 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 100.0 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 100.0 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 100.0 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 100.0 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 100.0 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 100.0 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 100.0 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 100.0 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 100.0 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 100.0 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 100.0 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 100.0 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 100.0 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 100.0 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 100.0 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 100.0 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 100.0 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 100.0 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 100.0 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 100.0 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 100.0 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 100.0 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 100.0 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 100.0 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 100.0 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 100.0 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 100.0 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 100.0 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 100.0 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 100.0 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.97 | |
| PF00664 | 275 | ABC_membrane: ABC transporter transmembrane region | 99.96 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.94 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 99.84 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.64 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.63 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.62 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.61 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.6 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.6 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.59 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.58 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.58 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.58 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.58 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.58 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.57 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.57 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.57 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 99.57 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.57 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.57 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.57 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.56 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.56 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.56 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.56 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.56 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.56 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.55 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.55 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.55 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.55 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.55 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.55 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.55 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.55 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.55 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.55 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.55 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.55 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.55 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.55 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.55 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.55 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.54 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.54 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.54 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.54 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.54 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.54 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.54 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.54 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.54 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.54 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.54 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.53 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.53 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.53 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.53 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.53 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.53 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.53 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.53 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.53 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.53 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.53 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.53 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.53 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.52 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.52 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.52 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.52 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.52 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.52 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.52 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.52 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.52 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.52 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.52 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.52 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.52 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.52 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.51 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.51 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.51 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.51 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.51 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.51 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.51 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.51 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.51 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.51 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.5 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.5 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.5 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.5 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.5 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.5 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.5 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.5 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.5 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.49 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.49 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.49 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.49 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.49 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.48 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.48 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.48 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.48 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.48 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.48 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.48 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.48 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.47 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.47 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.47 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.47 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.47 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.47 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.47 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.47 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.47 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.47 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.47 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.46 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.46 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.46 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.46 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.46 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.46 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 99.46 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.46 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.46 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.46 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.46 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.46 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.45 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.45 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.45 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.45 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.45 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.45 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.44 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.44 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.44 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.44 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.44 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.44 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.44 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.44 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.44 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.43 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.43 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.43 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.43 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.43 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.43 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.43 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.42 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.42 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.42 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.42 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.42 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.41 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.41 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.41 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.41 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.41 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.41 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.4 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.4 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.4 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.4 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.4 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.39 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.39 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.39 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.39 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.39 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.38 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.38 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.38 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.38 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.38 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.37 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.37 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.36 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.36 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.36 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.36 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.36 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.35 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.35 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.35 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.34 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.33 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.33 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.32 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.32 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.32 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.31 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.31 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.3 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.29 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.29 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.29 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.29 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.28 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.28 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.28 | |
| PRK11098 | 409 | microcin B17 transporter; Reviewed | 99.25 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.24 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.24 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 99.23 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.23 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.23 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.23 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 99.22 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.22 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.22 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.21 | |
| PRK12369 | 326 | putative transporter; Reviewed | 99.2 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.19 | |
| PF06472 | 281 | ABC_membrane_2: ABC transporter transmembrane regi | 99.19 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.18 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.17 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.16 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.16 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.15 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.15 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.15 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.15 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.14 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.13 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.12 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.1 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.09 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.08 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.07 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.05 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 99.03 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 99.03 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 99.02 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.02 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 99.01 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 99.0 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 98.99 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.95 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.91 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 98.9 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 98.9 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 98.88 | |
| PF13748 | 237 | ABC_membrane_3: ABC transporter transmembrane regi | 98.87 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.87 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 98.87 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 98.81 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.75 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.72 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.68 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.68 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 98.45 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 98.44 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.36 | |
| PF05992 | 315 | SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009 | 98.36 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 98.3 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 98.22 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 98.21 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 98.19 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 98.13 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 98.12 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 98.08 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 98.03 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 98.01 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 97.98 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 97.98 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 97.98 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 97.93 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 97.92 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 97.91 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 97.91 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.89 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 97.89 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 97.89 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 97.88 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 97.87 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 97.87 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.86 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 97.86 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 97.85 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 97.83 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 97.79 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 97.79 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 97.78 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 97.77 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 97.76 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 97.74 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 97.73 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.72 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.72 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 97.7 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 97.68 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.66 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 97.65 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.63 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 97.62 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 97.61 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 97.6 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.59 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 97.58 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.57 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.56 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 97.54 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 97.54 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 97.51 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 97.48 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 97.45 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.44 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.41 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 97.38 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.37 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 97.37 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 97.3 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.3 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.3 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 97.3 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 97.28 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.28 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.23 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.22 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.22 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 97.16 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 97.15 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 97.09 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 97.08 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 97.04 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.99 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.97 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.87 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 96.87 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.86 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.84 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 96.76 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 96.75 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 96.7 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 96.69 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.69 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 96.68 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.67 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 96.54 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.53 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.46 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 96.46 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 96.43 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.42 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 96.42 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.42 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 96.37 | |
| PF00664 | 275 | ABC_membrane: ABC transporter transmembrane region | 96.34 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.32 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.32 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 96.31 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.31 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 96.3 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.3 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.28 | |
| PTZ00202 | 550 | tuzin; Provisional | 96.28 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.27 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 96.27 | |
| COG1133 | 405 | SbmA ABC-type long-chain fatty acid transport syst | 96.26 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 96.23 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.23 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.22 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 96.19 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 96.18 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.16 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.13 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 96.11 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 96.03 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 96.02 | |
| PLN02348 | 395 | phosphoribulokinase | 95.91 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 95.86 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 95.83 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 95.81 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.78 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.78 | |
| PLN02772 | 398 | guanylate kinase | 95.77 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 95.74 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.7 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.66 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 95.65 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 95.64 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 95.64 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.62 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.62 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.56 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 95.48 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.48 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 95.48 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 95.43 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 95.42 | |
| PLN02200 | 234 | adenylate kinase family protein | 95.41 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 95.4 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 95.37 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 95.32 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.32 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 95.29 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.27 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 95.23 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.1 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.09 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.07 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 94.99 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 94.96 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.96 | |
| PRK13764 | 602 | ATPase; Provisional | 94.94 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.92 | |
| PLN02199 | 303 | shikimate kinase | 94.89 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 94.86 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.85 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 94.76 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 94.75 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 94.72 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 94.7 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 94.66 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 94.62 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 94.62 | |
| PRK13853 | 789 | type IV secretion system protein VirB4; Provisiona | 94.52 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 94.51 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 94.49 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.49 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 94.46 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 94.45 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 94.44 | |
| COG3451 | 796 | VirB4 Type IV secretory pathway, VirB4 components | 94.35 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.34 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 94.29 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.18 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 94.17 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.16 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 94.13 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.12 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 94.02 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.0 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 94.0 | |
| PRK06526 | 254 | transposase; Provisional | 93.96 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 93.95 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 93.93 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 93.88 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 93.88 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 93.83 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 93.82 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.81 |
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-70 Score=577.21 Aligned_cols=392 Identities=33% Similarity=0.552 Sum_probs=368.0
Q ss_pred HHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhchh--hhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 118 IALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQRE--EAMVFHKSSRFLVLLCVTSGIFSGLRSGCF 195 (510)
Q Consensus 118 ~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~~~--~~~~~~~~~~~l~~l~~~~~~~~~i~~~~~ 195 (510)
..++|++.+.+|+++++..++.++++.++..+++|.+++..++....+ ....+......+.++.++.+++.++|.+++
T Consensus 133 ~~~~rl~~l~~~~~~~l~~a~~~l~vss~~~~~iP~~~G~~id~~~~~~~~~~~~~~~~~~l~~l~~~~a~~~~~r~~~~ 212 (716)
T KOG0058|consen 133 TLLKRLLGLLKPEWKWLVAAFVLLLVSSLINMFIPYYLGKLIDTISEGDDSADALKRACTILLGLFLIGALANAIRGGLL 212 (716)
T ss_pred hHHHHHHHHhchhHHHHHHHHHHHHHHHhhcchhhHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 477899999999999999999999999999999999999888654331 223455566677788888999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Q 010471 196 SIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTL 275 (510)
Q Consensus 196 ~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~l 275 (510)
.+++.++..++|.++|+++++|+++|||++++||++||+++|++.+.+.++..++..+++.++.++.+++|+++||+|++
T Consensus 213 ~~a~~rv~~rlR~~lF~sil~QdiaFFD~nktGeL~SRLtsD~~~vs~svs~nls~~lR~~~~~~g~~~~M~~~S~~Ltl 292 (716)
T KOG0058|consen 213 QYAGERVVARLRTDLFRSLLRQDIAFFDENKTGELISRLTSDTQIVSNSVSQNLSDGLRNLVQGFGGLGFMFSLSWRLTL 292 (716)
T ss_pred HHHHHHHHHHHHHHHHHHHHhhhhhhhccCCccHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhhhHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 276 SALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG 355 (510)
Q Consensus 276 i~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~~ 355 (510)
++++.+|++.++.++|+++.+++.++.|+..+++++++.|.+++|||||+|++|++|.+||.+..++..+...|....++
T Consensus 293 v~~i~~P~v~~~~~~yG~~~rklS~~~Q~a~A~a~~vaeE~ls~~rTVRsfa~E~~E~~ry~~~l~~~~~i~~k~a~a~~ 372 (716)
T KOG0058|consen 293 VTLIVVPIVALVAKIYGKYLRKLSKQTQDALARANQVAEEVLSAMRTVRSFAAEEQEVKRYNKKLREVLKLSKKEAVAYG 372 (716)
T ss_pred HHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCC
Q 010471 356 LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSNQ 435 (510)
Q Consensus 356 ~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e~~ 435 (510)
.+.+..++..++..+.++++|++++..|++|.|++++|++|..++..++..++..+++++++.+|.+|++|++|++|..+
T Consensus 373 ~f~~~~~~~~~~~~~siL~~Gg~Lv~~g~mt~g~L~sFllY~~~~g~sl~~ls~~ys~lmkgvGAs~rvFel~dr~P~i~ 452 (716)
T KOG0058|consen 373 IFFGSTNLLGNLAVLSILFYGGHLVLTGSLTSGALSSFLLYQVQLGSSLSGLSSFYSELMKGVGASERVFELMDRKPRIP 452 (716)
T ss_pred HhHhHHHHHHhHHHHHHHHhccchhhcCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHHHHhccCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999865
Q ss_pred CCCCCccCCCccccEEEEeeeEECCCCCCCCccccceEEeeCCCEEEEEcCCCCcHHHHHHHHhcccCCCCceeC
Q 010471 436 FLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC 510 (510)
Q Consensus 436 ~~~~~~~~~~~~~~I~f~nVsF~Y~~~~~~~vL~nisltI~~Ge~vAIVG~SGSGKSTL~kLL~g~y~p~sG~I~ 510 (510)
.. +...|....|.|+|+||+|+||.||+.+||||+||+|+|||+||+||||||||||+++||+|||+|++|+|+
T Consensus 453 ~~-G~~~p~~~~G~IeF~~VsFaYP~Rp~~~Vlk~lsfti~pGe~vALVGPSGsGKSTiasLL~rfY~PtsG~Il 526 (716)
T KOG0058|consen 453 LT-GTLAPDHLQGVIEFEDVSFAYPTRPDVPVLKNLSFTIRPGEVVALVGPSGSGKSTIASLLLRFYDPTSGRIL 526 (716)
T ss_pred CC-CccccccccceEEEEEeeeecCCCCCchhhcCceeeeCCCCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEE
Confidence 33 222333578999999999999999999999999999999999999999999999999999999999999985
|
|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK11098 microcin B17 transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12369 putative transporter; Reviewed | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06472 ABC_membrane_2: ABC transporter transmembrane region 2; InterPro: IPR010509 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13748 ABC_membrane_3: ABC transporter transmembrane region | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05992 SbmA_BacA: SbmA/BacA-like family; InterPro: IPR009248 The Rhizobium meliloti (Sinorhizobium meliloti) bacA gene encodes a function that is essential for bacterial differentiation into bacteroids within plant cells in the symbiosis between R | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >COG1133 SbmA ABC-type long-chain fatty acid transport system, fused permease and ATPase components [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK13853 type IV secretion system protein VirB4; Provisional | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 510 | ||||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 6e-39 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 1e-38 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 5e-36 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 5e-36 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 4e-23 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 8e-23 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 9e-23 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 1e-22 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 6e-22 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 2e-21 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 9e-18 | ||
| 1jj7_A | 260 | Crystal Structure Of The C-Terminal Atpase Domain O | 2e-11 | ||
| 2ixe_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 3e-09 | ||
| 2ixg_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 3e-09 | ||
| 2ixf_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 3e-09 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 1e-08 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 1e-08 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 1e-08 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 1e-08 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 1e-08 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 1e-08 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 3e-08 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 6e-05 | ||
| 4hlu_A | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 2e-04 | ||
| 2iwh_A | 986 | Structure Of Yeast Elongation Factor 3 In Complex W | 3e-04 | ||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 3e-04 | ||
| 3si7_A | 285 | The Crystal Structure Of The Nbd1 Domain Of The Mou | 4e-04 | ||
| 1q3h_A | 286 | Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | 4e-04 | ||
| 1xfa_A | 283 | Structure Of Nbd1 From Murine Cftr- F508r Mutant Le | 4e-04 | ||
| 1xf9_A | 283 | Structure Of Nbd1 From Murine Cftr- F508s Mutant Le | 4e-04 | ||
| 1r0z_A | 286 | Phosphorylated Cystic Fibrosis Transmembrane Conduc | 4e-04 | ||
| 3dhw_C | 343 | Crystal Structure Of Methionine Importer Metni Leng | 5e-04 | ||
| 3tui_C | 366 | Inward Facing Conformations Of The Metni Methionine | 5e-04 | ||
| 3tuj_C | 366 | Inward Facing Conformations Of The Metni Methionine | 6e-04 | ||
| 2iw3_A | 986 | Elongation Factor 3 In Complex With Adp Length = 98 | 6e-04 | ||
| 2ix8_A | 976 | Model For Eef3 Bound To An 80s Ribosome Length = 97 | 6e-04 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 7e-04 |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
|
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 | Back alignment and structure |
| >pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 | Back alignment and structure |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
| >pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 | Back alignment and structure |
| >pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 | Back alignment and structure |
| >pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 | Back alignment and structure |
| >pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 | Back alignment and structure |
| >pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 | Back alignment and structure |
| >pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 | Back alignment and structure |
| >pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 | Back alignment and structure |
| >pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 | Back alignment and structure |
| >pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 | Back alignment and structure |
| >pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 510 | |||
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 1e-103 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-74 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-72 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 5e-66 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 3e-70 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 3e-65 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 1e-46 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 4e-36 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 6e-30 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 6e-23 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 5e-22 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 3e-21 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 4e-21 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 8e-12 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 4e-11 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 6e-11 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 1e-10 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 2e-10 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 3e-10 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 6e-10 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 8e-10 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 1e-08 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 2e-09 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 7e-05 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 2e-09 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 5e-07 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 4e-09 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 1e-08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 4e-05 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 5e-08 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 2e-07 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 2e-07 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 3e-07 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 7e-07 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 7e-07 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 8e-07 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 9e-07 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 1e-06 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 2e-06 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 3e-06 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 4e-06 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 1e-05 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 1e-05 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 2e-05 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 2e-05 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 3e-05 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 3e-05 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 4e-05 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 9e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-04 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 2e-04 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 5e-04 |
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 510 | |||
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 100.0 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 100.0 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 100.0 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 100.0 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 100.0 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 100.0 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 100.0 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 100.0 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 100.0 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 100.0 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.82 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 99.68 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.66 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.65 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.64 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.64 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.64 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.63 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.63 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.61 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.61 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.6 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.6 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.6 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.6 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.59 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.59 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.59 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.59 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.58 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.57 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.57 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.57 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.56 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.55 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.55 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.55 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.54 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.54 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.52 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.52 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.51 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.51 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.5 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.48 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 99.47 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.37 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 99.36 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 99.23 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.22 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.18 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.16 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.14 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.11 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 99.06 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 99.06 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.04 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 98.97 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.95 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.95 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 98.95 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.94 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.92 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.89 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.87 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.81 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.76 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.73 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 98.72 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.69 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 98.66 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 98.65 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.64 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.64 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.6 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.59 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.58 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.54 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.52 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.52 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 98.5 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.5 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.5 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.48 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 98.47 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.41 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.38 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.38 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 98.35 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 98.34 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.32 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 98.29 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 98.26 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 98.22 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 98.22 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 98.21 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.16 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 98.09 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 98.06 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 98.05 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.03 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 98.01 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 98.01 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.98 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.95 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 97.95 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.94 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.94 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.93 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 97.93 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.91 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.87 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.85 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 97.84 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.82 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.76 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.69 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.61 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.59 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 97.59 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 97.5 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 97.49 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.46 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.46 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.45 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 97.43 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.35 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.34 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.32 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.3 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.24 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.21 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.12 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.06 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.93 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.91 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.9 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.74 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.68 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.66 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.65 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 96.63 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.59 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 96.57 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.49 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 96.47 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.44 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.4 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.38 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.26 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.16 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.15 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.02 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.0 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.97 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 95.96 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.93 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.92 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.88 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.88 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 95.77 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.73 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 95.58 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.5 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 95.47 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.46 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.44 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 95.43 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.37 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.37 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 95.33 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.26 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.22 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.16 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.15 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.14 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 95.1 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 95.09 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.09 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 95.06 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 95.05 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 95.02 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.01 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 95.0 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 94.97 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.91 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 94.9 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.89 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 94.89 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.88 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.86 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.73 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.63 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.63 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 94.62 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 94.59 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 94.57 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 94.55 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.43 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 94.26 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 94.26 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 94.23 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 94.21 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 94.2 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.04 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 93.96 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 93.93 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.91 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 93.89 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 93.88 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 93.81 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 93.77 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 93.7 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 92.69 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 93.54 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 93.52 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 93.49 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 93.45 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 93.39 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.38 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 93.29 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 93.24 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 93.2 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 93.19 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 93.16 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 93.15 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 93.14 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 93.08 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 93.08 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 93.08 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 92.94 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 92.89 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 92.87 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 92.86 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 92.84 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 92.81 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.81 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 92.79 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 92.79 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 92.77 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 92.76 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 92.69 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 92.66 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.58 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 92.5 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 92.49 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 92.49 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 92.43 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 92.38 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.37 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 92.32 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 92.29 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 92.29 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 92.28 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.19 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 92.12 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 92.12 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 92.03 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 91.97 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 91.92 | |
| 1j3b_A | 529 | ATP-dependent phosphoenolpyruvate carboxykinase; a | 91.83 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 91.72 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 91.65 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 91.61 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 91.46 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 91.34 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 91.18 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 91.16 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.16 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 91.13 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 91.05 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 90.95 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 90.94 | |
| 2olr_A | 540 | Phosphoenolpyruvate carboxykinase; carbon dioxide, | 90.91 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 90.83 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 90.69 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 90.58 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 90.53 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 90.49 | |
| 1ii2_A | 524 | Phosphoenolpyruvate carboxykinase; phosphate bindi | 90.47 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 90.42 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 90.4 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 89.97 | |
| 1ytm_A | 532 | Phosphoenolpyruvate carboxykinase [ATP], phosphoen | 89.94 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 89.92 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 89.82 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 89.74 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 89.71 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.69 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 89.59 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 89.39 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 89.29 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 89.22 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 89.18 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 89.13 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 89.08 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 89.05 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 88.92 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 88.84 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 88.79 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 88.75 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 88.49 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 88.45 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 88.43 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 88.35 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 88.3 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 88.27 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 88.24 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 88.2 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 88.16 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 88.13 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 87.98 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 87.93 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 87.75 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 87.61 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 87.44 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 87.27 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 87.24 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 87.22 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 86.53 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 86.39 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 86.31 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 86.12 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 85.9 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 85.87 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 85.7 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 85.28 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 85.27 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 85.01 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 84.88 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 84.63 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 84.17 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 83.94 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 83.94 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 83.76 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 83.63 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 83.36 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 83.24 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 82.77 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 82.3 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 81.64 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 81.64 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 81.58 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 81.32 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 81.1 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 80.99 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 80.92 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 80.48 |
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-51 Score=452.04 Aligned_cols=392 Identities=20% Similarity=0.344 Sum_probs=342.3
Q ss_pred hHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhc-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 116 VWIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQ-REEAMVFHKSSRFLVLLCVTSGIFSGLRSGC 194 (510)
Q Consensus 116 ~~~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~-~~~~~~~~~~~~~l~~l~~~~~~~~~i~~~~ 194 (510)
.++.+++++++++++++.++.++++.++.+++.+..|++++..++... ..+...+......+.++.++..++.+++.+.
T Consensus 21 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 100 (598)
T 3qf4_B 21 PTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLIGKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKI 100 (598)
T ss_dssp HHHHHHHHGGGTGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCGGGHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 457889999999999999999999999999999999999888876432 1222222222233444556667788888888
Q ss_pred HHHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q 010471 195 FSIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLT 274 (510)
Q Consensus 195 ~~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~ 274 (510)
....+.++..++|.++|+|++++|++||+++++|++++|+++|++.+++.+...+..++..++.+++.+++++.++|+++
T Consensus 101 ~~~~~~~~~~~lr~~l~~~ll~~~~~~~~~~~~G~l~~r~~~D~~~i~~~~~~~~~~~~~~~~~~i~~~~~l~~~~~~l~ 180 (598)
T 3qf4_B 101 MLTLSQDVVFRLRKELFEKLQRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILS 180 (598)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHSCTHHHHHSCHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHCHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHCCCHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999899999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 275 LSALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAY 354 (510)
Q Consensus 275 li~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~ 354 (510)
+++++.+|++.++...+.++.++..++.++..++.++.+.|+++|+++||+|+.|+.+.++|++..++..+...+.....
T Consensus 181 l~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~~Ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~ 260 (598)
T 3qf4_B 181 LVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEMEKFDRVNESLRKVGTKAQIFS 260 (598)
T ss_dssp HHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHcCChHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999988888888888888888888899999999999999999999999999999999999999999888877666
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCC
Q 010471 355 GLWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPSN 434 (510)
Q Consensus 355 ~~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e~ 434 (510)
+....+..++..+..++++++|++++..|.+++|.+++++.|...+..|+..+...+..+.++..+++|+.++++.+++.
T Consensus 261 ~~~~~~~~~~~~~~~~~~~~~g~~l~~~g~ls~g~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~s~~ri~~~l~~~~~~ 340 (598)
T 3qf4_B 261 GVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEK 340 (598)
T ss_dssp TTHHHHHHHHHHHHHHHHHHHHHHHGGGTSSCHHHHHHHHTTTTSSHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCC
Confidence 66667777777777788899999999999999999999999999999999999999999999999999999999987764
Q ss_pred CCCCCCccCCCccccEEEEeeeEECCCCCCCCccccceEEeeCCCEEEEEcCCCCcHHHHHHHHhcccCCCCceeC
Q 010471 435 QFLSEGVKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLRLYEPSDGQVC 510 (510)
Q Consensus 435 ~~~~~~~~~~~~~~~I~f~nVsF~Y~~~~~~~vL~nisltI~~Ge~vAIVG~SGSGKSTL~kLL~g~y~p~sG~I~ 510 (510)
+. ++.....+..++|+++||+|+|++ ++++|+|+||+|++||++|||||||||||||+++|+|+|+|++|+|+
T Consensus 341 ~~-~~~~~~~~~~~~i~~~~v~~~y~~--~~~~l~~isl~i~~G~~~~ivG~sGsGKSTll~~l~g~~~p~~G~i~ 413 (598)
T 3qf4_B 341 DD-PDAVELREVRGEIEFKNVWFSYDK--KKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQIL 413 (598)
T ss_dssp CC-SSCCCCCSCCCCEEEEEEECCSSS--SSCSCCSEEEECCTTCEEEEECCTTSSTTHHHHHHTTSSCCSEEEEE
T ss_pred CC-CCCCCCCCCCCeEEEEEEEEECCC--CCccccceEEEEcCCCEEEEECCCCCcHHHHHHHHhcCcCCCCeEEE
Confidence 32 122222334578999999999974 35799999999999999999999999999999999999999999984
|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 510 | ||||
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 2e-21 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 3e-20 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 2e-19 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 6e-18 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 2e-17 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 1e-16 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 7e-14 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 2e-13 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 3e-13 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 3e-13 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 2e-12 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 3e-12 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 3e-12 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 7e-12 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 1e-11 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 3e-11 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 8e-11 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 1e-10 | |
| d2hyda2 | 323 | f.37.1.1 (A:1-323) Putative multidrug export ATP-b | 3e-10 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 3e-09 | |
| d3b60a2 | 319 | f.37.1.1 (A:10-328) Multidrug resistance ABC trans | 1e-08 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 3e-07 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 2e-06 | |
| d1np6a_ | 170 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 0.003 | |
| d1rz3a_ | 198 | c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci | 0.004 |
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Peptide transporter Tap1, C-terminal ABC domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 91.1 bits (226), Expect = 2e-21
Identities = 32/69 (46%), Positives = 44/69 (63%)
Query: 441 VKLQRLMGHVQFVNISFHYPSRPTVPILNHVCLTIEANEVVAIVGLSGSGKSTFVNLLLR 500
+ L G VQF ++SF YP+RP V +L + T+ EV A+VG +GSGKST LL
Sbjct: 3 LTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQN 62
Query: 501 LYEPSDGQV 509
LY+P+ GQ+
Sbjct: 63 LYQPTGGQL 71
|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 510 | |||
| d3b60a2 | 319 | Multidrug resistance ABC transporter MsbA, N-termi | 100.0 | |
| d2hyda2 | 323 | Putative multidrug export ATP-binding/permease pro | 100.0 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.84 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.82 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.81 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.8 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.79 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.68 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.66 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.66 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.66 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.65 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.64 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.63 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.63 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.62 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.6 | |
| d3b60a2 | 319 | Multidrug resistance ABC transporter MsbA, N-termi | 97.59 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 97.49 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 97.2 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.45 | |
| d2hyda2 | 323 | Putative multidrug export ATP-binding/permease pro | 96.38 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.09 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.9 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.86 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 95.66 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.6 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.55 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.53 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.41 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.36 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.31 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.23 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.11 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.87 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.76 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.69 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.69 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.59 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.55 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.45 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 94.37 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.34 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.32 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.24 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.19 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 94.07 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.94 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 93.82 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.75 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 93.56 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.51 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 93.5 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.38 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 93.38 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 93.24 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.03 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 93.03 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.03 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 92.99 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.71 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 92.61 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.51 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.44 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 91.85 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.15 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.52 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.23 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 90.03 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 89.85 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 89.84 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 89.8 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 89.43 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 89.25 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.91 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 87.61 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 85.43 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 85.36 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 84.84 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 84.57 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 83.96 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 83.95 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 83.85 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.94 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.34 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 81.83 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.49 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.48 |
| >d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: ABC transporter transmembrane region superfamily: ABC transporter transmembrane region family: ABC transporter transmembrane region domain: Multidrug resistance ABC transporter MsbA, N-terminal domain species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00 E-value=3.5e-35 Score=290.08 Aligned_cols=317 Identities=19% Similarity=0.272 Sum_probs=285.6
Q ss_pred HHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhc-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 117 WIALSRMWNLIGRDKWIVLVAVASLIVAAVSEITMPRILAEAVFSAQ-REEAMVFHKSSRFLVLLCVTSGIFSGLRSGCF 195 (510)
Q Consensus 117 ~~~l~~l~~~~~~~~~~l~~~~l~~i~~~l~~l~~P~~~~~~i~~~~-~~~~~~~~~~~~~l~~l~~~~~~~~~i~~~~~ 195 (510)
|+.+||+|++++|||+.++.++++.++.+++....|.+++..++... .++..........+.++.++..++.+++.+..
T Consensus 1 Wk~~krl~~~~~~~k~~l~~~~i~~~~~~~~~~~~~~~~~~~id~~~~~~~~~~l~~~~~~~~~~~~~~~i~~~~~~~~~ 80 (319)
T d3b60a2 1 WQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTDRSVLLWMPLVVIGLMILRGITSYISSYCI 80 (319)
T ss_dssp CHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHSSTTSTTHHHHHHSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhhhhhhhhhhhh
Confidence 67899999999999999999999999999999999998888876532 23332222222233444566677888899999
Q ss_pred HHHHHHHHHHHHHHHHHHHhcCCcccccccCchhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Q 010471 196 SIANIVLVKRLRETLYSALLFQDVYFFDTEAVGGLTSRLTADCQRLSNVIGNDINMILRNSLQGAGAFINLLTLSWPLTL 275 (510)
Q Consensus 196 ~~~~~~i~~~lr~~l~~~ll~lp~~ff~~~~~G~lisrl~~D~~~i~~~~~~~l~~l~~~~~~~i~~li~l~~~s~~l~l 275 (510)
...+.++..++|.++++|++++|+++|+++++|++++|+++|++.+++.+...+..++..++.+++.+++++.++|++++
T Consensus 81 ~~~~~~~~~~l~~~~~~~ll~~~~~~~~~~~~g~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~l 160 (319)
T d3b60a2 81 SWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSI 160 (319)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTCCSTHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHH
T ss_pred hhhhhccccchhhHHHHhhcccchhhccccccccccccccccccccccccccccchhhhhhhhhhhHHHHHHhhhccchh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010471 276 SALLICSFLSIIVSVYGQYQKRASVLTQECNAHANNVAQETLCMMRTVRVYGTEEKELGRYKIWLEKLAFIRIRESMAYG 355 (510)
Q Consensus 276 i~li~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~l~gi~tvk~f~~e~~~~~~~~~~~~~~~~~~~~~~~~~~ 355 (510)
++++..|+..++.....++.++..++.++..++.++.+.|.++|++++|+++.|+.+.+++++..++..+...|.....+
T Consensus 161 i~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (319)
T d3b60a2 161 ILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVSASS 240 (319)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hhhhHHHHHHHHHHhhhhHHHHHHHHHHhhhhhHHHHHHHhhcCCceeeehhccchhhhhhhhhhhhhhHHHHHHHHHHH
Confidence 99999999999988888988898888999999999999999999999999999999999999999999999999887777
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcCccCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCC
Q 010471 356 LWNMSFITLYRSTQVMAVLLGGMSIMIGQVSPEQLTKYVLYCEWLIYATWRMVDNLSSLLQSIGATEKVFQLIDLLPS 433 (510)
Q Consensus 356 ~~~~~~~~l~~~~~v~~l~~g~~lv~~g~is~G~l~af~~~~~~~~~~~~~l~~~~~~~~~~~~a~~rl~eil~~~~e 433 (510)
.......++.....++++++|++++.+|++|+|++++++.+...+..|+..+.+.+..+.++.++.+|+.|++|.+||
T Consensus 241 ~~~~~~~~~~~~~~~~~l~~g~~~~~~g~it~g~l~~~~~~~~~~~~pl~~l~~~~~~~~~~~~s~~Ri~elld~~~E 318 (319)
T d3b60a2 241 ISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQE 318 (319)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHSSSTTSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCS
T ss_pred hcccchhhhhhhhhHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCC
Confidence 777788888888888889999999999999999999999999999999999999999999999999999999998876
|
| >d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|