Citrus Sinensis ID: 010531
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 508 | ||||||
| 255560715 | 543 | dihydrolipoamide acetyltransferase compo | 0.887 | 0.830 | 0.722 | 0.0 | |
| 118487464 | 539 | unknown [Populus trichocarpa] | 0.875 | 0.825 | 0.727 | 0.0 | |
| 225442225 | 555 | PREDICTED: dihydrolipoyllysine-residue a | 0.889 | 0.814 | 0.705 | 0.0 | |
| 224070718 | 512 | predicted protein [Populus trichocarpa] | 0.822 | 0.816 | 0.708 | 1e-179 | |
| 18404837 | 539 | dihydrolipoyllysine-residue acetyltransf | 0.881 | 0.831 | 0.693 | 1e-173 | |
| 14161722 | 539 | mono-lipoyl E2 [Arabidopsis thaliana] | 0.881 | 0.831 | 0.691 | 1e-172 | |
| 22531144 | 539 | dihydrolipoamide S-acetyltransferase, pu | 0.881 | 0.831 | 0.691 | 1e-172 | |
| 18400212 | 539 | dihydrolipoyllysine-residue acetyltransf | 0.877 | 0.827 | 0.692 | 1e-171 | |
| 20260138 | 539 | dihydrolipoamide acetyltransferase [Arab | 0.877 | 0.827 | 0.692 | 1e-171 | |
| 297853204 | 550 | predicted protein [Arabidopsis lyrata su | 0.879 | 0.812 | 0.673 | 1e-169 |
| >gi|255560715|ref|XP_002521371.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] gi|223539449|gb|EEF41039.1| dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 668 bits (1723), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 333/461 (72%), Positives = 382/461 (82%), Gaps = 10/461 (2%)
Query: 1 MAYASHIINHSKKLKNVSNLLWHENAVLVRWFSND---AVSSRDDLLKIHRHVYVPVESE 57
MAYASHIINHSKKL+NVSNLL E+A LVRWFSND +V +DD K+H +VP E E
Sbjct: 1 MAYASHIINHSKKLRNVSNLLRQEHAGLVRWFSNDTRLSVGKKDDTAKVHHQGFVPAERE 60
Query: 58 RVINSSAISSVSSVGVFKKKFCSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPP 117
R+ N+ +++SS G F+K ++ +P+ GS L + F+ S+V +RGFSSDSGLPP
Sbjct: 61 RLFNTGVNNNISSFGAFRKNVPRTIKQVRNPMDGSLLLKDFSSSQVQSRRGFSSDSGLPP 120
Query: 118 HQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVK 177
HQEIGMPSLSPTM EGNIARWLKKEGDK+SPGEVLCEVETDKATVEMECMEEG+LAKI+K
Sbjct: 121 HQEIGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGFLAKIIK 180
Query: 178 GDGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIS 237
GDGSKEIKVGEVIAITVE+EEDI KFKDYSPSVSD AA + P K+E E+ +S
Sbjct: 181 GDGSKEIKVGEVIAITVEDEEDIGKFKDYSPSVSDGAAAASPPPP----SKKEVAEETVS 236
Query: 238 TSEPKASKPSAASPEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRG 297
+ EPK SKPSAAS DR+FASP+A+ LAE+HNV+LSSIKGTGP+G IVKADIEDYLASRG
Sbjct: 237 SPEPKTSKPSAASSGDRIFASPLAKKLAEDHNVTLSSIKGTGPDGHIVKADIEDYLASRG 296
Query: 298 KEVPAKAPKGKDVAAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGL 357
KEV A PK A ++DYVDIPH+QIRK+TASRLL SKQTIPHYYLTVD VD LM L
Sbjct: 297 KEVSATTPK---ATAASIDYVDIPHTQIRKVTASRLLLSKQTIPHYYLTVDTRVDKLMDL 353
Query: 358 RNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTE 417
R +LNS+QEAS GKRISVNDLVIKAAALAL++VP+CNSSW D YIRQ+ NVNINVAVQT+
Sbjct: 354 RGKLNSLQEASGGKRISVNDLVIKAAALALKRVPQCNSSWTDNYIRQYNNVNINVAVQTD 413
Query: 418 NGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYE 458
NGLYVPV+RDADKKGLS IAEEV+ LAQKAKDNSLKP+DYE
Sbjct: 414 NGLYVPVVRDADKKGLSKIAEEVKHLAQKAKDNSLKPEDYE 454
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118487464|gb|ABK95559.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225442225|ref|XP_002277871.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial [Vitis vinifera] gi|297743048|emb|CBI35915.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224070718|ref|XP_002303212.1| predicted protein [Populus trichocarpa] gi|222840644|gb|EEE78191.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18404837|ref|NP_564654.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|79319911|ref|NP_001031186.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|75285553|sp|Q5M729.1|OPD23_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial; AltName: Full=Dihydrolipoamide S-acetyltransferase component 3 of pyruvate dehydrogenase complex; AltName: Full=Pyruvate dehydrogenase complex component E2 3; Short=PDC-E2 3; Short=PDCE2 3; Flags: Precursor gi|56550713|gb|AAV97810.1| At1g54220 [Arabidopsis thaliana] gi|332194946|gb|AEE33067.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|332194947|gb|AEE33068.1| dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14161722|gb|AAK53067.1| mono-lipoyl E2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22531144|gb|AAM97076.1| dihydrolipoamide S-acetyltransferase, putative [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18400212|ref|NP_566470.1| dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex [Arabidopsis thaliana] gi|118573090|sp|Q8RWN9.2|OPD22_ARATH RecName: Full=Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial; AltName: Full=Dihydrolipoamide S-acetyltransferase component 2 of pyruvate dehydrogenase complex; AltName: Full=Pyruvate dehydrogenase complex component E2 2; Short=PDC-E2 2; Short=PDCE2 2; Flags: Precursor gi|13605807|gb|AAK32889.1|AF367302_1 AT3g13930/MDC16_5 [Arabidopsis thaliana] gi|20147147|gb|AAM10290.1| AT3g13930/MDC16_5 [Arabidopsis thaliana] gi|23306388|gb|AAN17421.1| putative acetyltransferase [Arabidopsis thaliana] gi|23397124|gb|AAN31846.1| putative acetyltransferase [Arabidopsis thaliana] gi|24899791|gb|AAN65110.1| putative acetyltransferase [Arabidopsis thaliana] gi|332641921|gb|AEE75442.1| dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|20260138|gb|AAM12967.1| dihydrolipoamide acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297853204|ref|XP_002894483.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297340325|gb|EFH70742.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 508 | ||||||
| TAIR|locus:2020173 | 539 | AT1G54220 [Arabidopsis thalian | 0.405 | 0.382 | 0.796 | 6.9e-145 | |
| TAIR|locus:2088247 | 539 | AT3G13930 [Arabidopsis thalian | 0.877 | 0.827 | 0.652 | 1.4e-144 | |
| UNIPROTKB|F1SMB2 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.399 | 0.313 | 0.471 | 8.5e-75 | |
| MGI|MGI:2385311 | 642 | Dlat "dihydrolipoamide S-acety | 0.399 | 0.316 | 0.480 | 2.3e-74 | |
| RGD|619859 | 632 | Dlat "dihydrolipoamide S-acety | 0.399 | 0.321 | 0.473 | 4.7e-74 | |
| UNIPROTKB|F1N690 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.399 | 0.313 | 0.456 | 2.5e-73 | |
| UNIPROTKB|E2RQS9 | 647 | DLAT "Uncharacterized protein" | 0.399 | 0.313 | 0.442 | 4.3e-73 | |
| UNIPROTKB|H0YDD4 | 479 | DLAT "Dihydrolipoyllysine-resi | 0.399 | 0.423 | 0.451 | 6.7e-73 | |
| UNIPROTKB|E9PEJ4 | 542 | DLAT "Dihydrolipoyllysine-resi | 0.399 | 0.374 | 0.451 | 2.3e-72 | |
| UNIPROTKB|P10515 | 647 | DLAT "Dihydrolipoyllysine-resi | 0.399 | 0.313 | 0.451 | 2.4e-72 |
| TAIR|locus:2020173 AT1G54220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 845 (302.5 bits), Expect = 6.9e-145, Sum P(2) = 6.9e-145
Identities = 164/206 (79%), Positives = 182/206 (88%)
Query: 253 DRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVAA 312
DR+FASP+AR LAE++NV LS I+GTGP G IVKADI++YLAS GK AK K D A
Sbjct: 245 DRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLASSGKGATAKPSKSTDSKA 304
Query: 313 PALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKR 372
PALDYVDIPHSQIRK+TASRL FSKQTIPHYYLTVD CVD LM LR+QLNS +EAS GKR
Sbjct: 305 PALDYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVDTCVDKLMALRSQLNSFKEASGGKR 364
Query: 373 ISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKG 432
ISVNDLV+KAAALALRKVP+CNSSW D+YIRQFKNVNINVAVQTENGLYVPV++DAD+KG
Sbjct: 365 ISVNDLVVKAAALALRKVPQCNSSWTDDYIRQFKNVNINVAVQTENGLYVPVVKDADRKG 424
Query: 433 LSTIAEEVRQLAQKAKDNSLKPQDYE 458
LSTI EEVR LAQKAK+NSLKP+DYE
Sbjct: 425 LSTIGEEVRLLAQKAKENSLKPEDYE 450
|
|
| TAIR|locus:2088247 AT3G13930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SMB2 DLAT "Dihydrolipoyllysine-residue acetyltransferase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385311 Dlat "dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619859 Dlat "dihydrolipoamide S-acetyltransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N690 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQS9 DLAT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDD4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PEJ4 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10515 DLAT "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_III000191 | SubName- Full=Putative uncharacterized protein; (512 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| LPD1 | • | • | • | • | • | • | 0.987 | ||||
| LPD3 | • | • | • | • | • | 0.977 | |||||
| LPD4 | • | • | • | • | • | 0.977 | |||||
| gw1.III.1461.1 | • | • | • | • | • | 0.971 | |||||
| estExt_fgenesh4_pm.C_LG_I0194 | • | • | • | • | • | 0.970 | |||||
| gw1.X.5451.1 | • | • | • | • | 0.963 | ||||||
| grail3.0009040502 | • | • | • | • | 0.963 | ||||||
| fgenesh4_pg.C_LG_II001653 | • | • | • | • | 0.962 | ||||||
| grail3.0080008401 | • | • | • | • | 0.955 | ||||||
| estExt_Genewise1_v1.C_LG_IV4361 | • | • | • | • | 0.955 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 508 | |||
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 0.0 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 1e-131 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 1e-117 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 2e-97 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 2e-64 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 1e-57 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 5e-51 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 6e-48 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 2e-47 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 2e-41 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-39 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 5e-37 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 2e-36 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 2e-33 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 8e-29 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 2e-25 | |
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 1e-24 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 7e-23 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 5e-17 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 2e-15 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 2e-14 | |
| pfam02817 | 39 | pfam02817, E3_binding, e3 binding domain | 4e-13 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 5e-13 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-12 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 5e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-06 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 4e-06 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 5e-04 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 0.002 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 0.004 |
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
Score = 755 bits (1952), Expect = 0.0
Identities = 335/461 (72%), Positives = 373/461 (80%), Gaps = 15/461 (3%)
Query: 2 AYASHIINHSKKLKNVSNLLWHENAVLVRWFSNDAVSS---RDDLLKIHRHVYVPVESER 58
AYAS IINHSKKL+NVSNLL E+A LVR+FSN SS DD+ K + + S+
Sbjct: 1 AYASRIINHSKKLRNVSNLLRREHAALVRYFSNSTRSSLGKGDDIAKRRGYPPLERRSQP 60
Query: 59 VINSSAISSVSSVGVFKKKFCSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPH 118
VSS+G+F ARK GSP+ GS L + + S++ RGFSS S LPPH
Sbjct: 61 --------KVSSLGLFGSNISRTARKNGSPMTGSGLFKSLSSSQMQSARGFSSSSDLPPH 112
Query: 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 178
QEIGMPSLSPTM EGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG
Sbjct: 113 QEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKG 172
Query: 179 DGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIST 238
DG+KEIKVGEVIAITVEEEEDI KFKDY PS S A AAP +PSPPPP + EEVEKP S+
Sbjct: 173 DGAKEIKVGEVIAITVEEEEDIGKFKDYKPSSSAAPAAPKAKPSPPPPKE-EEVEKPASS 231
Query: 239 SEPKASKPSAAS-PEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRG 297
EPKASKPSA DR+FASP+AR LAE++NV LSSIKGTGP+G IVKADIEDYLAS G
Sbjct: 232 PEPKASKPSAPPSSGDRIFASPLARKLAEDNNVPLSSIKGTGPDGRIVKADIEDYLASGG 291
Query: 298 KEVPAKAPKGKDVAAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGL 357
K A AP D APALDY DIP++QIRK+TASRLL SKQTIPHYYLTVD VD LM L
Sbjct: 292 KG--ATAPPSTDSKAPALDYTDIPNTQIRKVTASRLLQSKQTIPHYYLTVDTRVDKLMAL 349
Query: 358 RNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTE 417
R+QLNS+QEAS GK+ISVNDLVIKAAALALRKVP+CNSSW D+YIRQ+ NVNINVAVQTE
Sbjct: 350 RSQLNSLQEASGGKKISVNDLVIKAAALALRKVPQCNSSWTDDYIRQYHNVNINVAVQTE 409
Query: 418 NGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYE 458
NGLYVPV++DADKKGLSTIAEEV+QLAQKA++NSLKP+DYE
Sbjct: 410 NGLYVPVVKDADKKGLSTIAEEVKQLAQKARENSLKPEDYE 450
|
Length = 539 |
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 508 | |||
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 100.0 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 100.0 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 100.0 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 100.0 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 100.0 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.76 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.74 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.65 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.62 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.5 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.49 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.46 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.45 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.38 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.36 | |
| PF02817 | 39 | E3_binding: e3 binding domain; InterPro: IPR004167 | 99.35 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.31 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.27 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.25 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.22 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.21 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.21 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.16 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.16 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.13 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.09 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.04 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 98.96 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 98.9 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 98.87 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 98.83 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.7 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.57 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.39 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.27 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.26 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 97.89 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 97.87 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.77 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 97.67 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 97.63 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 97.62 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 97.62 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.6 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 97.59 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 97.54 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.53 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 97.44 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 97.39 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.27 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.24 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.23 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.21 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.17 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 97.12 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 96.97 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.93 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 96.89 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 96.87 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 96.8 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 96.78 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 96.75 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 96.73 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 96.47 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.46 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 96.41 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 96.24 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.55 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 95.41 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 95.34 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 95.26 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 95.03 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 94.96 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 94.92 | |
| COG4845 | 219 | Chloramphenicol O-acetyltransferase [Defense mecha | 94.52 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 94.32 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 94.3 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 94.15 | |
| PRK06748 | 83 | hypothetical protein; Validated | 94.13 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 93.61 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 93.59 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 93.46 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 93.15 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 92.41 | |
| PRK07051 | 80 | hypothetical protein; Validated | 92.38 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 92.22 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 91.71 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 91.1 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 91.08 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 90.99 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 90.83 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 90.14 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 89.95 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 89.58 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 89.4 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 88.9 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 88.72 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 88.61 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 88.55 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 87.72 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 87.66 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 87.38 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 87.15 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 86.9 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 86.8 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 86.8 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 86.69 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 86.63 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 86.35 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 86.26 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 86.22 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 86.07 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 85.86 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 85.8 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 85.8 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 85.55 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 85.46 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 85.46 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 85.04 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 84.28 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 83.78 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 82.79 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 82.74 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 81.62 | |
| PF02749 | 88 | QRPTase_N: Quinolinate phosphoribosyl transferase, | 81.02 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 80.59 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 80.48 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 80.31 |
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-100 Score=822.34 Aligned_cols=483 Identities=70% Similarity=0.998 Sum_probs=391.2
Q ss_pred cchhhhhhhhhhhhhhhhhccccccceEEeecCCCcC---CcccceeeecceeccccceeccccCCccceeeeeeeccce
Q 010531 2 AYASHIINHSKKLKNVSNLLWHENAVLVRWFSNDAVS---SRDDLLKIHRHVYVPVESERVINSSAISSVSSVGVFKKKF 78 (508)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (508)
+||+||||||||||+++|+|+|||+.+||||||++|+ |++++.+.+++. ...+.+++ ..+++++|++++
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~------~~~~~~~~~~~~ 72 (539)
T PLN02744 1 AYASRIINHSKKLRNVSNLLRREHAALVRYFSNSTRSSLGKGDDIAKRRGYP--PLERRSQP------KVSSLGLFGSNI 72 (539)
T ss_pred CchHHHhhhchhhcchHHHhcccccceEEEecCCCccCcccccchhhcccCC--cccccccc------ccccccccccch
Confidence 5899999999999999999999999999999999999 999999877764 33333333 456788999999
Q ss_pred eeeccccCCccccccccccccccccccccccccCCCCCCceEEecCCCCCCCCeEEEEEEEccCCCeeCCCCeEEEEEec
Q 010531 79 CSVARKAGSPIAGSFLNRGFACSKVHLKRGFSSDSGLPPHQEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETD 158 (508)
Q Consensus 79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~f~~~~~~~~~~~i~mP~lg~~~~eg~I~~W~v~~Gd~V~~gd~L~eVetd 158 (508)
||+.++.++|+....++..++|+++.+.|+|++.+++|.|++|.||+||++|+||+|.+|+|++||.|++||+||+||||
T Consensus 73 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ei~mP~lg~~m~eg~I~~W~vkeGD~V~~g~~l~eVETD 152 (539)
T PLN02744 73 SRTARKNGSPMTGSGLFKSLSSSQMQSARGFSSSSDLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETD 152 (539)
T ss_pred hhhhhhcCCccccchhhhccccccccccccccccccCCCCceEeCCCCCCCcceeEEEEEEecCCCEecCCCeeEEEeec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeeEEecCCCeEEEEEEecCCCeeeecCCEEEEEeccCCccccccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCC
Q 010531 159 KATVEMECMEEGYLAKIVKGDGSKEIKVGEVIAITVEEEEDIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPIST 238 (508)
Q Consensus 159 Ka~~ei~ap~~G~v~~i~~~eG~~~v~vG~~la~i~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~ 238 (508)
|+++||+||.+|+|.+|++++|++.|+||++|+++.+++++..+++++.++..+.+..+.+ .++++.+.....+.+...
T Consensus 153 Ka~~evea~~~G~l~ki~~~eG~~~v~vG~~ia~i~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~ 231 (539)
T PLN02744 153 KATVEMECMEEGYLAKIVKGDGAKEIKVGEVIAITVEEEEDIGKFKDYKPSSSAAPAAPKA-KPSPPPPKEEEVEKPASS 231 (539)
T ss_pred cceeEecCCCCcEEEEEEecCCCcccCCCCEEEEEccCccccccccccccccccccccccc-cCCCCCcccccccCCCCC
Confidence 9999999999999999999999536999999998876554433222211110000000000 000000000000001111
Q ss_pred CCCCCCCC-CCCCCCCccccChhHHHHHHHcCCCCCcccccCCCCccchhhHHHHHHhcCCCCCCCCCCCCCCCCCCCcc
Q 010531 239 SEPKASKP-SAASPEDRLFASPVARNLAEEHNVSLSSIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVAAPALDY 317 (508)
Q Consensus 239 ~~~~~~~~-~~~~~~~~v~aSP~aRrLA~e~gIDLs~V~GTGp~GRItk~DV~~~~~~~~~~~~a~~~a~~~~~~~~~~~ 317 (508)
+.+....+ .....+.++++||+||+||+|+||||+.|+||||+|||+++||++|++......+++++ .....+...+
T Consensus 232 ~~~~~~~~~~~~~~~~~i~ASP~aRrLAre~GVDLs~V~GTGp~GRI~k~DV~a~~~~~~~~~~~~~~--~~~~~~~~~~ 309 (539)
T PLN02744 232 PEPKASKPSAPPSSGDRIFASPLARKLAEDNNVPLSSIKGTGPDGRIVKADIEDYLASGGKGATAPPS--TDSKAPALDY 309 (539)
T ss_pred cccccccccccccccccccCCchhHHHHHHcCCCHHHCCCCCCCCcccHHHHHHHhhccccccCCCCC--cccCCCCCcc
Confidence 11100000 01112346889999999999999999999999999999999999998542211111100 0001111124
Q ss_pred cccCCchhhHHHHHhhhhccCCcceEEEeeeecHHHHHHHHHHHhhHHHHhcCCceeHHHHHHHHHHHHHhhCCCCCcee
Q 010531 318 VDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSW 397 (508)
Q Consensus 318 ~~ipls~iRkaiA~~m~~S~~~iP~~~l~~~vdvt~L~~lR~~l~~~~~~~~g~klSi~~~liKAva~AL~~~P~lNas~ 397 (508)
+++|+++|||+||++|++|++++||||++.++|+++|+++|+++|+..+..+|.|+||++||+||+++||++||.+|++|
T Consensus 310 ~~vpls~~Rk~IA~~m~~S~~~iPh~t~~~evdvt~L~~lR~~l~~~~~~~~g~kls~~~~liKA~a~AL~~~P~lNa~~ 389 (539)
T PLN02744 310 TDIPNTQIRKVTASRLLQSKQTIPHYYLTVDTRVDKLMALRSQLNSLQEASGGKKISVNDLVIKAAALALRKVPQCNSSW 389 (539)
T ss_pred ccccchhHHHHHHHHHHHHHhhCCeEEEEEEEEcHHHHHHHHHHHHHhhhcccCccCHHHHHHHHHHHHHHhCcHhheee
Confidence 57899999999999999999999999999999999999999999976555558999999999999999999999999999
Q ss_pred eCCeeEEcCCccEEEEeecCCceEeeeecccccCCHHHHHHHHHHHHHHHHcCCCCCCccCCCeEEecCCCCCCcccccc
Q 010531 398 ADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYELPIWEDPSASSNSVPLSIL 477 (508)
Q Consensus 398 ~~~~I~~~~~vnIgVAVdt~~GLvvPVIrdAd~ksL~eIa~ei~~L~~kAr~gkL~~~dl~GGTFTISN~GslGg~fGi~ 477 (508)
+++.|+++++|||||||++++||+|||||||++|+|.||++++++|+++||+|+|+++||+|||||||| +||.||+.
T Consensus 390 ~~~~i~~~~~vnIgvAV~t~~GL~vPVIr~ad~~sl~eIa~ei~~L~~kAr~~kL~~~dl~GGTfTISN---lGg~~G~~ 466 (539)
T PLN02744 390 TDDYIRQYHNVNINVAVQTENGLYVPVVKDADKKGLSTIAEEVKQLAQKARENSLKPEDYEGGTFTVSN---LGGPFGIK 466 (539)
T ss_pred ccCcEEEeCCcceEEEEECCCCeEECcCCCcccCCHHHHHHHHHHHHHHHHcCCCChhhcCCceEEEeC---CCcccccc
Confidence 999999999999999999999999999999999999999999999999999999999999999999999 98339999
Q ss_pred ccceee---ehhhhcccce--eeEEe
Q 010531 478 LNLAFL---QLDLLRKGLS--LAWVQ 498 (508)
Q Consensus 478 ~~~Pil---~~~~~~~g~~--~~w~~ 498 (508)
+|+||+ +.++++.|.- .+|+.
T Consensus 467 ~ftpIInpPqvaILgvG~i~~~pvv~ 492 (539)
T PLN02744 467 QFCAIINPPQSAILAVGSAEKRVIPG 492 (539)
T ss_pred eeeccccCCcEEEEEcccceeEeEEe
Confidence 999998 7778877774 13663
|
|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 508 | ||||
| 3b8k_A | 239 | Structure Of The Truncated Human Dihydrolipoyl Acet | 2e-33 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 2e-27 | ||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 1e-24 | ||
| 1y8n_B | 128 | Crystal Structure Of The Pdk3-L2 Complex Length = 1 | 1e-23 | ||
| 1fyc_A | 106 | Inner Lipoyl Domain From Human Pyruvate Dehydrogena | 2e-23 | ||
| 2dne_A | 108 | Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain | 2e-23 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 1e-21 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 3e-21 | ||
| 3crk_C | 87 | Crystal Structure Of The Pdhk2-L2 Complex. Length = | 9e-20 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 2e-16 | ||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 2e-13 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 1e-08 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 1e-08 | ||
| 3rqc_A | 224 | Crystal Structure Of The Catalytic Core Of The 2-Ox | 1e-08 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 2e-08 | ||
| 3l60_A | 250 | Crystal Structure Of Branched-Chain Alpha-Keto Acid | 4e-08 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 5e-08 | ||
| 2ihw_A | 262 | Crystal Structure Of A Cubic Core Of The Dihydrolip | 4e-07 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 2e-06 | ||
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 2e-05 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 4e-05 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 1e-04 | ||
| 3rnm_E | 58 | The Crystal Structure Of The Subunit Binding Of Hum | 4e-04 | ||
| 1w4i_A | 62 | Peripheral-Subunit Binding Domains From Mesophilic, | 8e-04 |
| >pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 | Back alignment and structure |
|
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 | Back alignment and structure |
| >pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 | Back alignment and structure |
| >pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
| >pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|3RNM|E Chain E, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 58 | Back alignment and structure |
| >pdb|1W4I|A Chain A, Peripheral-Subunit Binding Domains From Mesophilic, Thermophilic, And Hyperthermophilic Bacteria Fold By Ultrafast, Apparently Two-State Transitions Length = 62 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 508 | |||
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 3e-89 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 4e-87 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 2e-73 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 2e-55 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 9e-52 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 6e-50 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 2e-47 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 7e-44 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 5e-36 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 7e-36 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 5e-33 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 2e-29 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 4e-21 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 7e-21 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 1e-19 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 2e-17 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 3e-17 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 3e-16 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 7e-16 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 3e-15 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 6e-15 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 9e-15 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-13 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 6e-13 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 6e-13 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 1e-11 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 8e-10 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 2e-09 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 1e-08 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 3e-07 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 2e-04 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-04 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 508 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 100.0 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 100.0 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 100.0 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 100.0 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 100.0 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 100.0 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 100.0 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.97 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 99.96 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 99.96 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 99.95 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 99.94 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.81 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.79 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.77 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.75 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.72 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.68 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.62 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.62 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.62 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.58 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.55 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.38 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.31 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.3 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.28 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.23 | |
| 2eq9_C | 41 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.22 | |
| 3rnm_E | 58 | Lipoamide acyltransferase component of branched-C | 99.22 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.18 | |
| 2eq8_C | 40 | Pyruvate dehydrogenase complex, dihydrolipoamide a | 99.16 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.15 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.15 | |
| 2eq7_C | 40 | 2-oxoglutarate dehydrogenase E2 component; protein | 99.15 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.13 | |
| 1w85_I | 49 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.11 | |
| 1bal_A | 51 | Dihydrolipoamide succinyltransferase; glycolysis; | 99.09 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.03 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.03 | |
| 1w4i_A | 62 | Pyruvate dehydrogenase E2; transferase, peripheral | 99.02 | |
| 2f60_K | 64 | Pyruvate dehydrogenase protein X component; protei | 99.02 | |
| 2coo_A | 70 | Lipoamide acyltransferase component of branched- c | 99.02 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 98.95 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 98.94 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.7 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.64 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.61 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.53 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.14 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.13 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.08 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 97.69 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 97.68 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 97.64 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 97.6 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.49 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.35 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.29 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.29 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 96.97 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 96.68 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 96.37 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 96.1 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 96.05 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 95.56 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 94.74 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 94.67 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 94.47 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 94.17 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 94.05 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 92.99 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 92.3 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 91.94 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 91.47 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 91.11 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 91.11 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 90.72 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 90.59 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 90.57 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 90.43 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 90.19 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 90.11 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 89.56 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 87.38 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 87.14 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 87.01 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 86.16 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 85.63 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 85.42 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 85.24 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 84.67 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 84.1 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 80.8 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 80.56 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 80.27 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=7.6e-75 Score=615.14 Aligned_cols=360 Identities=29% Similarity=0.428 Sum_probs=40.0
Q ss_pred eEEecCCCCCCCCeEEEEEEEccCCCeeCCCCeEEEEEecceeeEEecCCCeEEEEEEecCCCeeeecCCEEEEEeccCC
Q 010531 119 QEIGMPSLSPTMQEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVKGDGSKEIKVGEVIAITVEEEE 198 (508)
Q Consensus 119 ~~i~mP~lg~~~~eg~I~~W~v~~Gd~V~~gd~L~eVetdKa~~ei~ap~~G~v~~i~~~eG~~~v~vG~~la~i~~~~~ 198 (508)
++|+||+||++|+||+|++|+|++||.|++||+||+|||||++++|+||++|+|.++++++|+ .|++|++|+++.++++
T Consensus 3 ~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~-~V~~G~~l~~i~~~~~ 81 (428)
T 3dva_I 3 FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGT-VATVGQTLITLDAPGY 81 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred eeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCC-EeCCCCEEEEEecCCc
Confidence 689999999999999999999999999999999999999999999999999999999999997 9999999999876554
Q ss_pred ccccccCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCccccChhHHHHHHHcCCCCCccccc
Q 010531 199 DIPKFKDYSPSVSDAGAAPAKEPSPPPPPKQEEVEKPISTSEPKASKPSAASPEDRLFASPVARNLAEEHNVSLSSIKGT 278 (508)
Q Consensus 199 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~aSP~aRrLA~e~gIDLs~V~GT 278 (508)
+....... +. .. ++.+ +.+.+. +.+...+...+.... .......+.++++||+|||||+|+||||++|+||
T Consensus 82 ~~~~~~~~-~~--~~--~~~~--~~~~~~-~~~~~~~~~~~~~~~-~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gt 152 (428)
T 3dva_I 82 ENMTFKGQ-EQ--EE--AKKE--EKTETV-SKEEKVDAVAPNAPA-AEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGT 152 (428)
T ss_dssp -------------------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCC
T ss_pred cccccccc-cc--cc--cccC--CCcccC-CccccccCCCccccc-cccccccccccccCHHHHHHHHHcCCCHHHCCCC
Confidence 33211100 00 00 0000 000000 000000000000000 0011112347899999999999999999999999
Q ss_pred CCCCccchhhHHHHHHhcCCCCCCCC--CCC--CCC---CCCCCcccccCCchhhHHHHHhhhhccCCcceEEEeeeecH
Q 010531 279 GPNGLIVKADIEDYLASRGKEVPAKA--PKG--KDV---AAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICV 351 (508)
Q Consensus 279 Gp~GRItk~DV~~~~~~~~~~~~a~~--~a~--~~~---~~~~~~~~~ipls~iRkaiA~~m~~S~~~iP~~~l~~~vdv 351 (508)
||+|||+++||++|++......+... ++. ... ......++++|+++|||+||++|.+||+++||||++.++|+
T Consensus 153 G~~GrI~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDv 232 (428)
T 3dva_I 153 GKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADV 232 (428)
T ss_dssp STTSCCCTTTTTTTSCC---------------------------------------------------------------
T ss_pred CCCCceeHHHHHHHhhccccccccccccccccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeH
Confidence 99999999999999754321111000 000 000 00111356899999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhHHHHhcCCceeHHHHHHHHHHHHHhhCCCCCceeeC--CeeEEcCCccEEEEeecCCceEeeeecccc
Q 010531 352 DNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWAD--EYIRQFKNVNINVAVQTENGLYVPVIRDAD 429 (508)
Q Consensus 352 t~L~~lR~~l~~~~~~~~g~klSi~~~liKAva~AL~~~P~lNas~~~--~~I~~~~~vnIgVAVdt~~GLvvPVIrdAd 429 (508)
|+|+++|+++|+..+ .+|.|+||++|++||+++||++||++|++|++ +.|++|+++|||+||++++||+||||+|++
T Consensus 233 t~l~~~rk~~~~~~~-~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a~ 311 (428)
T 3dva_I 233 TKLVAHRKKFKAIAA-EKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHAD 311 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHHHHhhhhHh-hcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccCC
Confidence 999999999986543 35899999999999999999999999999988 799999999999999999999999999999
Q ss_pred cCCHHHHHHHHHHHHHHHHcCCCCCCccCCCeEEecCCCCCCccccccccceee---ehhhhcccce
Q 010531 430 KKGLSTIAEEVRQLAQKAKDNSLKPQDYELPIWEDPSASSNSVPLSILLNLAFL---QLDLLRKGLS 493 (508)
Q Consensus 430 ~ksL~eIa~ei~~L~~kAr~gkL~~~dl~GGTFTISN~GslGg~fGi~~~~Pil---~~~~~~~g~~ 493 (508)
+++|.+|++++++|++++|+|+|.++||+|||||||| +|+ ||+..|+||+ +.++++.|+-
T Consensus 312 ~~sl~eia~~~~~l~~~ar~gkL~~~e~~ggtftISn---lG~-~G~~~ftpIin~pq~aIl~vG~i 374 (428)
T 3dva_I 312 RKPIFALAQEINELAEKARDGKLTPGEMKGASCTITN---IGS-AGGQWFTPVINHPEVAILGIGRI 374 (428)
T ss_dssp -------------------------------------------------------------------
T ss_pred CCCHHHHHHHHHHHHHHHHcCCCCccccCCCEEEEEc---CCC-CCccceEeecCCCCceEEEcccc
Confidence 9999999999999999999999999999999999999 999 9999999998 5566666654
|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* | Back alignment and structure |
|---|
| >1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A | Back alignment and structure |
|---|
| >2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K | Back alignment and structure |
|---|
| >2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 508 | ||||
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 3e-37 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 1e-32 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 3e-28 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 1e-27 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 4e-23 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 9e-22 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 1e-21 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-20 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 4e-19 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 3e-17 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 8e-16 | |
| d1w85i_ | 42 | a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl | 4e-14 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 9e-14 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-13 | |
| d2cyua1 | 39 | a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa | 4e-12 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 7e-10 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Score = 135 bits (340), Expect = 3e-37
Identities = 40/139 (28%), Positives = 71/139 (51%)
Query: 320 IPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLV 379
+P +++RK A RLL +K + ++ + +M LR Q E G R+
Sbjct: 7 VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFY 66
Query: 380 IKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEE 439
+KA AL++ P N+S + + ++++AV T GL PV+RD D G++ I ++
Sbjct: 67 VKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKK 126
Query: 440 VRQLAQKAKDNSLKPQDYE 458
+++LA K +D L +D
Sbjct: 127 IKELAVKGRDGKLTVEDLT 145
|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 508 | |||
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 100.0 | |
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 100.0 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 100.0 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.92 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.91 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.87 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.86 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.85 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.83 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.83 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.79 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.78 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.75 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.54 | |
| d1w85i_ | 42 | E3/E1 binding domain of dihydrolipoyl acetyltransf | 99.53 | |
| d2cyua1 | 39 | E3-binding domain of dihydrolipoamide succinyltran | 99.44 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.3 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 96.86 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.72 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 95.38 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 94.41 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.14 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 94.12 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 93.78 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 91.97 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 91.74 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 91.44 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 90.85 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 90.45 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 86.01 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 84.27 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 83.97 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 80.47 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.4e-44 Score=350.86 Aligned_cols=179 Identities=25% Similarity=0.356 Sum_probs=168.4
Q ss_pred ccccCCchhhHHHHHhhhhccCCcceEEEeeeecHHHHHHHHHHHhhHHHHhcCCceeHHHHHHHHHHHHHhhCCCCCce
Q 010531 317 YVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSS 396 (508)
Q Consensus 317 ~~~ipls~iRkaiA~~m~~S~~~iP~~~l~~~vdvt~L~~lR~~l~~~~~~~~g~klSi~~~liKAva~AL~~~P~lNas 396 (508)
.+++|+++|||+||++|.+||+++||||+..++|+++|+++|+++++..++..|.++|+++|++||++.||++||.+|++
T Consensus 4 ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na~ 83 (233)
T d1scza_ 4 EKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNAS 83 (233)
T ss_dssp CCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTCE
T ss_pred CcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhheE
Confidence 45789999999999999999999999999999999999999999988776667999999999999999999999999999
Q ss_pred eeCCeeEEcCCccEEEEeecCCceEeeeecccccCCHHHHHHHHHHHHHHHHcCCCCCCccCCCeEEecCCCCCCccccc
Q 010531 397 WADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYELPIWEDPSASSNSVPLSI 476 (508)
Q Consensus 397 ~~~~~I~~~~~vnIgVAVdt~~GLvvPVIrdAd~ksL~eIa~ei~~L~~kAr~gkL~~~dl~GGTFTISN~GslGg~fGi 476 (508)
|+++.+++++++|||+||++++||+|||||||+++++.||++++++|+++||+|+|+++||+|||||||| +|+ ||+
T Consensus 84 ~~~~~i~~~~~vnIgiAv~~~~GL~vPvI~~a~~~sl~eia~~~~~l~~~ar~~~L~~~d~~ggTfTISN---lG~-~g~ 159 (233)
T d1scza_ 84 IDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITN---GGV-FGS 159 (233)
T ss_dssp EETTEEECCSSCCEEECEEETTEEECCEETTGGGCCHHHHHHHHHHHHHHTTTTCCCHHHHSCCSEEEEE---GGG-GTC
T ss_pred EcCCeEEEeccceEEEEEEcCCCeEEeEeeccccCCHHHHHHHHHHHHHHhhcCCCCHHHhCCCcEEEEc---Ccc-ccc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999 999 999
Q ss_pred cccceee---ehhhhcccce---eeEEeec
Q 010531 477 LLNLAFL---QLDLLRKGLS---LAWVQIS 500 (508)
Q Consensus 477 ~~~~Pil---~~~~~~~g~~---~~w~~~~ 500 (508)
..|+||+ +.++++.|.- | |++++
T Consensus 160 ~~~tpii~ppq~aIl~vG~i~~~p-v~~~g 188 (233)
T d1scza_ 160 LMSTPIINPPQSAILGMHAIKDRP-MAVNG 188 (233)
T ss_dssp CCCCCCCCTTCSEEEEEEEEEEEE-EEETT
T ss_pred eeeeeecCCCCceEEecccceeec-cccCC
Confidence 9999998 7777777754 5 55443
|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|