Citrus Sinensis ID: 010537

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MESTSGTDEHREINEASTSGSDSSHQSQVEESSSSLVQQSRRPNLSSLQIPVRSLDACLSDFTTIEVPSVPSPNSSSSRAGLPPKPNSAKFKSSVRSLLPQRSFKAKNIAHDGEKTVLILPDTPSSDGPLDKPSTSRSFSLNKILFPSSTKVAHSLPATPIATTALDSVQERQLNIQPNNSKLRTQQKMTRSFSVPVNIKVRSLRRTESGGGLIRVISVSTRSAAVERISVNDDPATDIATEEAGEDIPEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQINGTVQHRWRQQEEQQNHQIHQQQQQQLTEDRSAGPANNSRQQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEcccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccHccEEEEEEEEccccccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEcccEEEccccEEEEEccccHcccccccccccccccccEccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccHHHccccccccccccccccc
mestsgtdehreineastsgsdsshqsqveesssslvqqsrrpnlsslqipvrsldaclsdfttievpsvpspnssssraglppkpnsakfkssvrsllpqrsfkakniahdgektvlilpdtpssdgpldkpstsrsfslnkilfpsstkvahslpatpiatTALDSVQErqlniqpnnsklrtqqkmtrsfsvpvnikvrslrrtesgggLIRVISVSTRSAAVErisvnddpatdiateeagedipeeEAVCRICLVElgeggdmfklecSCKGELALAHKECAVKWFTikgnktcdvckqdvqnlpvtllkihnpqtvirrpqTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQINGTVQHRWRQQEEQQNHQIHQQQQQQLtedrsagpannsrqq
mestsgtdehreineastsgsdsshqsqveesssslvqqsrrpnlsslqipvRSLDACLSDFTTIevpsvpspnssssraglppkpnsAKFKSSVRSLLPQRSFKakniahdgektvLILPDTPSSDGPLDKPSTSRSFSLNKILFPSSTKVAHSLPATPIATTALDSvqerqlniqpnnsklrtqqkmtrsfsvpvnikvrslrrtesggglirvisvstrsaaverisvnddpatdiateeagedipeeeAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTllkihnpqtvirrpqtivQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQINGTVQHRWRQQEEQQNHQIHQQQQQqltedrsagpannsrqq
MESTSGTDEHREINEAstsgsdsshqsqveesssslvqqsRRPNLSSLQIPVRSLDACLSDFTTIEvpsvpspnssssRAGLPPKPNSAKFKSSVRSLLPQRSFKAKNIAHDGEKTVLILPDTPSSDGPLDKPSTSRSFSLNKILFPSSTKVAHSLPATPIATTALDSVQERQLNIQPNNSKLRTQQKMTRSFSVPVNIKVRSLRRTESGGGLIRVISVSTRSAAVERISVNDDPATDIateeagedipeeeaVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQINGTVqhrwrqqeeqqnhqihqqqqqqLTEDRSAGPANNSRQQ
*******************************************************DACLS****************************************************************************************************************************************VNIKVR*L*****GGGLIRVISVSTR*****************************EAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQ**************************************************
**************************************************************************************************************************************************************************************************************************************************************CRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMS****************************************************
*******************************************NLSSLQIPVRSLDACLSDFTTIEV****************************RSLLPQRSFKAKNIAHDGEKTVLILPDTPS***********RSFSLNKILFPSSTKVAHSLPATPIATTALDSVQERQLNIQPNNSKLRTQQKMTRSFSVPVNIKVRSLRRTESGGGLIRVISVSTRSAAVERISVNDDPATDIATEEAGEDIPEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQM*************************************************
******************************************PNLSSLQIPVRSLDACLSDFTTIEVPSVP******************************************************************************************************************************************GGGLIRVISVS**************************DIPEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNP*****************RYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQ************************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTSGTDEHREINEASTSGSDSSHQSQVEESSSSLVQQSRRPNLSSLQIPVRSLDACLSDFTTIEVPSVPSPNSSSSRAGLPPKPNSAKFKSSVRSLLPQRSFKAKNIAHDGEKTVLILPDTPSSDGPLDKPSTSRSFSLNKILFPSSTKVAHSLPATPIATTALDSVQERQLNIQPNNSKLRTQQKMTRSFSVPVNIKVRSLRRTESGGGLIRVISVSTRSAAVERISVNDDPATDIATEEAGEDIPEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQINGTVQHRWRQQEEQQNHQIHQQQQQQLTEDRSAGPANNSRQQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query508 2.2.26 [Sep-21-2011]
Q5XI50692 E3 ubiquitin-protein liga yes no 0.124 0.091 0.319 7e-05
Q5XIV2790 Probable E3 ubiquitin-pro no no 0.102 0.065 0.35 0.0001
Q9WV66693 E3 ubiquitin-protein liga no no 0.122 0.089 0.323 0.0001
Q8NA82808 Probable E3 ubiquitin-pro yes no 0.102 0.064 0.35 0.0002
Q9H992704 E3 ubiquitin-protein liga no no 0.122 0.088 0.295 0.0006
Q5R9W2707 E3 ubiquitin-protein liga no no 0.122 0.087 0.295 0.0006
P90495333 E3 ubiquitin-protein liga no no 0.098 0.150 0.421 0.0007
>sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattus norvegicus GN=March7 PE=2 SV=1 Back     alignment and function desciption
 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 254 VCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNK--------TCDVCKQD 305
           +CRIC +      ++    C C G L   H+EC  KW   K N         TC++CK+ 
Sbjct: 552 LCRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCKEK 611

Query: 306 VQNLPVTLLKIH 317
           +Q L +    IH
Sbjct: 612 LQ-LNLEDFDIH 622
E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 OS=Rattus norvegicus GN=March10 PE=2 SV=1 Back     alignment and function description
>sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus musculus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q8NA82|MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCH10 OS=Homo sapiens GN=MARCH10 PE=2 SV=3 Back     alignment and function description
>sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo sapiens GN=MARCH7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo abelii GN=MARCH7 PE=2 SV=1 Back     alignment and function description
>sp|P90495|MIR1_HHV8P E3 ubiquitin-protein ligase MIR1 OS=Human herpesvirus 8 type P (isolate GK18) GN=K3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query508
359485329522 PREDICTED: uncharacterized protein LOC10 0.907 0.883 0.713 0.0
302143497521 unnamed protein product [Vitis vinifera] 0.905 0.882 0.698 0.0
255563173522 protein binding protein, putative [Ricin 0.940 0.915 0.660 0.0
224139610492 predicted protein [Populus trichocarpa] 0.901 0.930 0.686 1e-180
224089847515 predicted protein [Populus trichocarpa] 0.846 0.834 0.637 1e-165
356553435503 PREDICTED: uncharacterized protein LOC10 0.885 0.894 0.626 1e-157
356499511548 PREDICTED: uncharacterized protein LOC10 0.899 0.833 0.609 1e-157
356547547437 PREDICTED: uncharacterized protein LOC10 0.814 0.947 0.641 1e-151
218198747490 hypothetical protein OsI_24153 [Oryza sa 0.917 0.951 0.563 1e-143
222636083 791 hypothetical protein OsJ_22354 [Oryza sa 0.925 0.594 0.560 1e-142
>gi|359485329|ref|XP_003633259.1| PREDICTED: uncharacterized protein LOC100243829 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/465 (71%), Positives = 389/465 (83%), Gaps = 4/465 (0%)

Query: 5   SGTDEHREINEASTSGSDSSHQSQVEES-SSSLVQQSRRPNLSSLQIPVRSLDACLSDFT 63
           SG +   E++  S +       +Q E+   +SLVQQSRRPNLSSLQIPVRSL+   S F 
Sbjct: 4   SGVELQPEVDATSDAPEHCQESNQKEKGEGTSLVQQSRRPNLSSLQIPVRSLENTSSAFA 63

Query: 64  TIEVPSVPSPNSSSSRAGLPPKPNSAKFKSSVRSLLPQRSFKAKNIAHDGEKTVLILPDT 123
            IE+ S PSP  +S++AGLPP+P SAKFKSS+R+LLPQRS +AKN++ DGEKTVLI+PDT
Sbjct: 64  RIEISSAPSP--TSTKAGLPPRPPSAKFKSSMRNLLPQRSLRAKNLSEDGEKTVLIIPDT 121

Query: 124 PSSDGPLDKPSTSRSFSLNKILFPSSTKVAHSLPATPIATTALDSVQERQLNIQPNNSKL 183
           PSSDGPLDKP+TSRSFSLNK+LFP S K  +SLPATPIA++  +S+QE+ L+ + + SK+
Sbjct: 122 PSSDGPLDKPTTSRSFSLNKVLFP-SVKATYSLPATPIASSGSESLQEKNLDGESDFSKV 180

Query: 184 RTQQKMTRSFSVPVNIKVRSLRRTESGGGLIRVISVSTRSAAVERISVNDDPATDIATEE 243
             Q  MTRS SVPVN+K RSLRR +S GGLIRVIS + R  AV+  S +D P T+I + +
Sbjct: 181 EVQHHMTRSLSVPVNVKARSLRRMDSTGGLIRVISATPRPVAVDGASQDDAPVTEIVSGD 240

Query: 244 AGEDIPEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCK 303
            GEDIPEEEAVCRIC +ELGEGGD  KLECSCKGELALAH++CAVKWF+IKGNKTCDVCK
Sbjct: 241 DGEDIPEEEAVCRICFIELGEGGDTLKLECSCKGELALAHQDCAVKWFSIKGNKTCDVCK 300

Query: 304 QDVQNLPVTLLKIHNPQTVIRRPQTIVQQREVARYRVWQDMPVLIMVSMLAYFCFLEQLL 363
           QDVQNLPVTLLKI NPQTV+RRP T+ QQRE  RYRVWQD+PVL+MVSMLAYFCFLEQLL
Sbjct: 301 QDVQNLPVTLLKIQNPQTVVRRPATLPQQREETRYRVWQDVPVLVMVSMLAYFCFLEQLL 360

Query: 364 VSDLGARALAISLPFSCVLGLLSSMIASTMVSRSYIWAYASFQFAVVILFAHIFYSVLNV 423
           V++LG RALAISLPFSCVLGLLSSMIASTMVS+SYIWAYASFQFA+VILFAHIFY++LNV
Sbjct: 361 VTNLGPRALAISLPFSCVLGLLSSMIASTMVSKSYIWAYASFQFAIVILFAHIFYTILNV 420

Query: 424 NPILAVLLSSFTGFGIAISTNSLIVEYLRWRMSRQMQSLHQQING 468
           NPIL+VLLSSFTGFGIAISTNSL+VEYLRWR SRQ++S  Q   G
Sbjct: 421 NPILSVLLSSFTGFGIAISTNSLLVEYLRWRASRQVRSSDQNNRG 465

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143497|emb|CBI22058.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563173|ref|XP_002522590.1| protein binding protein, putative [Ricinus communis] gi|223538181|gb|EEF39791.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224139610|ref|XP_002323191.1| predicted protein [Populus trichocarpa] gi|222867821|gb|EEF04952.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224089847|ref|XP_002308834.1| predicted protein [Populus trichocarpa] gi|222854810|gb|EEE92357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553435|ref|XP_003545062.1| PREDICTED: uncharacterized protein LOC100798208 [Glycine max] Back     alignment and taxonomy information
>gi|356499511|ref|XP_003518583.1| PREDICTED: uncharacterized protein LOC100789461 [Glycine max] Back     alignment and taxonomy information
>gi|356547547|ref|XP_003542173.1| PREDICTED: uncharacterized protein LOC100791140, partial [Glycine max] Back     alignment and taxonomy information
>gi|218198747|gb|EEC81174.1| hypothetical protein OsI_24153 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|222636083|gb|EEE66215.1| hypothetical protein OsJ_22354 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query508
TAIR|locus:2175158494 AT5G60580 [Arabidopsis thalian 0.811 0.834 0.453 1.2e-83
TAIR|locus:2075064491 AT3G09760 [Arabidopsis thalian 0.700 0.725 0.438 5.1e-74
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.712 0.849 0.349 2.2e-50
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.639 0.790 0.333 2.7e-45
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.108 0.265 0.482 5.4e-11
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.147 0.364 0.417 8.8e-11
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.094 0.235 0.557 6.5e-10
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.171 0.376 0.333 9.9e-07
TAIR|locus:2043664240 AT2G45530 [Arabidopsis thalian 0.273 0.579 0.268 4.6e-06
WB|WBGene00077696206 F58E6.12 [Caenorhabditis elega 0.100 0.247 0.4 6.7e-06
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 838 (300.0 bits), Expect = 1.2e-83, P = 1.2e-83
 Identities = 201/443 (45%), Positives = 264/443 (59%)

Query:    41 RRPNLSSLQIPVRSLDACLSDFTTIEXXXXXXXXXXXXRAGL----P-PKPNSAKF---- 91
             RR NLS LQIP R+      D   I+               L    P P P S+      
Sbjct:    43 RRKNLS-LQIPSRAAGLSPEDSVVIKMPPTPSPTPRRVNFALTSSSPGPTPTSSSVLPRG 101

Query:    92 KSSVRSLLPQRSFKAKNIAHDGEKTVLILPDTPSSDGPLDKPSTSRSFSLNKILFPSSTK 151
             KSS+++LLP+   K K    D EK        P+S    +K S SRS SL+K LF    K
Sbjct:   102 KSSLKNLLPKAGCKPKTSNTDIEKGQGNACSPPASQ---EKASISRSLSLSK-LFTPRIK 157

Query:   152 VAHSLPATPIATTALDSVQERQLNIQPNNSKLRTQQKMTRSFSVPVNIKVRSLRRTESGG 211
                SLP TP+  +  +S      ++ P     +    + RS SVP+N K  SL+  +S  
Sbjct:   158 RTSSLPVTPVILSNSESAHGGT-SVAPQTPNRKGSVHIARSRSVPLNDKELSLKGMDS-- 214

Query:   212 GLIRVISVSTRSAAVERISVNDDPATDIXXXXXXXXXXXXXXVCRICLVELGEGGDMFKL 271
                RVI  + R    +  S   +                   VCRICLVEL EGG+  K+
Sbjct:   215 -FFRVIPSTPRVKEGDVFSNASEAGNTETGDADGEDIPEDEAVCRICLVELCEGGETLKM 273

Query:   272 ECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQTVIRRPQTIVQ 331
             ECSCKGELALAHK+CA+KWFTIKGNKTC+VCKQ+V+NLPVTLL+I +    +R     V 
Sbjct:   274 ECSCKGELALAHKDCALKWFTIKGNKTCEVCKQEVKNLPVTLLRIQS----LRNSG--VP 327

Query:   332 QREVARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISLPFSCVLGLLSSMIAS 391
             Q +V+ YRVWQ++PVL+++SMLAYFCFLEQLLV ++G  A+AISLPFSC+LGLL+SM AS
Sbjct:   328 QLDVSGYRVWQEVPVLVIISMLAYFCFLEQLLVENMGTGAIAISLPFSCILGLLASMTAS 387

Query:   392 TMV-------SRSYIWAYASFQFAVVILFAHIFYSVLNVNPILAVLLSSFTGFGIAISTN 444
             TMV        R ++W YAS QFA+V+LFAHIFYSV+ + P+L+VLLS+F GFG+ I  +
Sbjct:   388 TMVLEYSYAVMRRFVWIYASVQFALVVLFAHIFYSVVKLQPVLSVLLSTFAGFGVCICGS 447

Query:   445 SLIVEYLRWRMSRQMQSLHQQIN 467
             S++VE++RWR   + + L QQ+N
Sbjct:   448 SVMVEFVRWRRRWRARRLEQQLN 470
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043664 AT2G45530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00077696 F58E6.12 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018834001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (520 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 6e-18
pfam1290647 pfam12906, RINGv, RING-variant domain 2e-15
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 2e-07
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 3e-05
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 7e-04
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.002
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 76.9 bits (190), Expect = 6e-18
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 254 VCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCK 303
           +CRIC  E  EG  +    C CKG L   H+EC  +W    GNKTC++CK
Sbjct: 1   ICRICHDEGDEGDPL-VSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 508
KOG1609323 consensus Protein involved in mRNA turnover and st 99.71
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.48
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.34
PHA02862156 5L protein; Provisional 99.32
PHA02825162 LAP/PHD finger-like protein; Provisional 99.28
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.02
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.96
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 98.92
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.55
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.53
PHA02929238 N1R/p28-like protein; Provisional 98.34
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.21
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.2
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.03
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.9
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.89
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.88
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.86
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.74
COG52191525 Uncharacterized conserved protein, contains RING Z 97.63
PHA02926242 zinc finger-like protein; Provisional 97.63
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.57
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.57
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.48
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.47
PF0967993 TraQ: Type-F conjugative transfer system pilin cha 97.23
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.16
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.16
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.14
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.08
PF1463444 zf-RING_5: zinc-RING finger domain 97.04
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.74
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.66
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.61
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.55
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.48
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 96.3
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.2
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 95.98
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 95.87
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 95.5
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.22
KOG4445368 consensus Uncharacterized conserved protein, conta 94.74
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 94.72
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 94.41
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.11
KOG1941518 consensus Acetylcholine receptor-associated protei 93.66
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 92.96
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.74
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 92.7
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 92.18
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 91.43
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 90.99
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 90.78
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 90.7
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 90.45
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 90.41
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 90.21
PF07895205 DUF1673: Protein of unknown function (DUF1673); In 89.19
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 89.09
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 88.64
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.34
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 88.2
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 85.72
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 83.96
KOG1002791 consensus Nucleotide excision repair protein RAD16 81.51
KOG3039303 consensus Uncharacterized conserved protein [Funct 81.37
PF10272358 Tmpp129: Putative transmembrane protein precursor; 80.67
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 80.38
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information 
Probab=99.71  E-value=3.1e-18  Score=169.23  Aligned_cols=206  Identities=27%  Similarity=0.393  Sum_probs=142.4

Q ss_pred             cCCCCCCCCCCcceeccccccCCC-ceEEecCCCCCccceechhhHHHHHhhhCCcccccccccccccccccccccCCcc
Q 010537          243 EAGEDIPEEEAVCRICLVELGEGG-DMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQNLPVTLLKIHNPQT  321 (508)
Q Consensus       243 ~~~e~~~eee~~CrICl~e~ee~e-~~l~LPC~CKGsLh~fH~~Cl~kWL~~kg~~tCpICr~~~~nvp~~l~ri~~~q~  321 (508)
                      +...+.+.++..||||+++.++.. ..++.||.|+|+++++|+.|+++|+..|++.+||+|++.+.+......+....  
T Consensus        69 ~~~~~~~~~~~~cRIc~~~~~~~~~~~l~~pC~C~g~l~~vH~~cl~~W~~~~~~~~CeiC~~~~~~~~~~~~~~~~~--  146 (323)
T KOG1609|consen   69 ESLEESPSSGPICRICHEEDEESNGLLLISPCSCKGSLAYVHRSCLEKWFSIKGNITCEICKSFFINVGTKLKPLIVI--  146 (323)
T ss_pred             CccccCCCCCCcEEEEecccccccccccccCccccCcHHHHHHHHHHhhhccccCeeeecccccceecceeecceeeh--
Confidence            333444555788999998765432 27899999999999999999999999999999999999998876543332211  


Q ss_pred             ccCCcchh-hhhccc-cccceeeccchhhhHHHHHHHHHHHHHhhhcccchhhhhhh-hhHHHHHHHHHHHHhhhhhhhH
Q 010537          322 VIRRPQTI-VQQREV-ARYRVWQDMPVLIMVSMLAYFCFLEQLLVSDLGARALAISL-PFSCVLGLLSSMIASTMVSRSY  398 (508)
Q Consensus       322 ~~rr~~~~-aqq~~~-~~~r~W~d~p~LViismLayFcFLeqLLv~~lg~~Alaisl-PFs~vlgll~S~~as~mv~r~y  398 (508)
                      ........ ...... .....|....+.+.+..++++++.+..+...++....++.. +..+.+|++.......+....|
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  226 (323)
T KOG1609|consen  147 SKVRSGALSERTLSGMILLKVALLVAIIVSVLPLLLGLLFELVLGVPSLVVESPLANPLALVALGLLGFKIWIFIILSGY  226 (323)
T ss_pred             hhhhhHhhhheeeehhhhhhhhhhheeeEEeehhhhhhhHHHhccccccccCCCccCchhheeecceechHHHHHHHHHH
Confidence            00000000 000000 11123333444455666777777777666666665455555 5556689998888888888899


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhcc---hhHHHHHHHH-HhHHHHHHhhhHHHHHH
Q 010537          399 IWAYASFQFAVVILFAHIFYSVLNV---NPILAVLLSS-FTGFGIAISTNSLIVEY  450 (508)
Q Consensus       399 ~W~ya~~qF~lvvlf~h~fy~~~~~---~~v~~illa~-f~gfg~~m~~n~~~~e~  450 (508)
                      +|++....+.++.+++.+|+.+.++   ..+...++.+ +.|++++.+...++..+
T Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  282 (323)
T KOG1609|consen  227 IFILKSLKVKLVLIRAVIFLLLIKVVLAAVVILQLLLQRLVGYLLANSLTPLYIVS  282 (323)
T ss_pred             HHHHHHHHHHHhHhhhhccchhhhhhhhhHHHHHHHHhcceeEEEecccceeeecc
Confidence            9999999999999999999988877   3444433333 88999988877777775

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF09679 TraQ: Type-F conjugative transfer system pilin chaperone (TraQ); InterPro: IPR014112 This entry represents TraQ, a protein that makes a specific interaction with pilin (TraA) to aid its transfer through the inner membrane during the process of F-type conjugative pilus assembly [, ] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF07895 DUF1673: Protein of unknown function (DUF1673); InterPro: IPR012874 This family contains hypothetical proteins of unknown function found in Methanosarcina acetivorans and Methanosarcina mazei Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
1vyx_A60 Solution Structure Of The Kshv K3 N-Terminal Domain 1e-04
>pdb|1VYX|A Chain A, Solution Structure Of The Kshv K3 N-Terminal Domain Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
Query: 254 VCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVC 302
           VC IC  ELG   + F+  C C GEL   H+ C   W TI  N  C +C
Sbjct: 8   VCWICNEELGN--ERFR-ACGCTGELENVHRSCLSTWLTISRNTACQIC 53

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query508
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-20
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-04
3nw0_A238 Non-structural maintenance of chromosomes element 2e-04
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 83.6 bits (207), Expect = 2e-20
 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 3/56 (5%)

Query: 249 PEEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQ 304
            E+  VC IC     E G+     C C GEL   H+ C   W TI  N  C +C  
Sbjct: 3   DEDVPVCWICN---EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGV 55
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query508
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.62
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.58
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.08
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.0
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.99
2ect_A78 Ring finger protein 126; metal binding protein, st 98.98
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.89
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.84
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.81
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.76
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.75
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.7
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.67
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.62
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.6
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.59
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.57
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.56
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.54
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.54
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.5
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.49
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.47
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.4
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.37
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.37
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.36
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.34
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.33
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.32
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.27
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.19
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.18
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.17
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.16
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.14
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.09
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.01
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.92
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.87
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.87
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.85
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.8
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.68
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.66
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.63
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.59
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.53
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.46
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.44
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.4
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.36
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.21
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.13
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.13
2ea5_A68 Cell growth regulator with ring finger domain prot 97.01
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.96
3nw0_A238 Non-structural maintenance of chromosomes element 96.93
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.92
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 96.87
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.28
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 96.21
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 96.02
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 95.7
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.67
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 91.99
1weu_A91 Inhibitor of growth family, member 4; structural g 82.26
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 81.73
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=3.1e-16  Score=129.62  Aligned_cols=57  Identities=26%  Similarity=0.767  Sum_probs=50.5

Q ss_pred             CCCCcceeccccccCCCceEEecCCCCCccceechhhHHHHHhhhCCccccccccccc
Q 010537          250 EEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQ  307 (508)
Q Consensus       250 eee~~CrICl~e~ee~e~~l~LPC~CKGsLh~fH~~Cl~kWL~~kg~~tCpICr~~~~  307 (508)
                      +++..|+||++++++++ .+++||+|+|++|+||.+||++||..+++.+||+||+.|.
T Consensus        13 ~~~~~C~IC~~~~~~~~-~l~~pC~C~Gs~h~fH~~Cl~~Wl~~~~~~~CplCr~~~~   69 (80)
T 2d8s_A           13 SSQDICRICHCEGDDES-PLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFI   69 (80)
T ss_dssp             TTSCCCSSSCCCCCSSS-CEECSSSCCSSSCCEETTHHHHHHHHHCCSBCSSSCCBCC
T ss_pred             CCCCCCeEcCccccCCC-eeEeccccCCcCCeeCHHHHHHHHhhCCCCCCCCCCCeee
Confidence            45678999999987554 5679999999999999999999999987789999999995
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 508
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-07
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 5e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
d1pzwa_80 g.39.1.10 (A:) Transcription factor grauzone Cg331 0.002
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.002
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 53.3 bits (127), Expect = 4e-10
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 3/58 (5%)

Query: 250 EEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQ 307
           E+  VC IC     E G+     C C GEL   H+ C   W TI  N  C +C     
Sbjct: 4   EDVPVCWICN---EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN 58
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query508
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.41
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.18
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.85
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.79
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.78
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.75
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.64
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.15
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.98
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.97
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.97
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.57
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.52
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.52
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.28
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.24
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 87.26
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 87.1
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 84.55
d1wema_76 Death associated transcription factor 1, Datf1 (DI 84.26
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.41  E-value=3.8e-14  Score=108.47  Aligned_cols=55  Identities=38%  Similarity=0.817  Sum_probs=48.5

Q ss_pred             CCCCcceeccccccCCCceEEecCCCCCccceechhhHHHHHhhhCCccccccccccc
Q 010537          250 EEEAVCRICLVELGEGGDMFKLECSCKGELALAHKECAVKWFTIKGNKTCDVCKQDVQ  307 (508)
Q Consensus       250 eee~~CrICl~e~ee~e~~l~LPC~CKGsLh~fH~~Cl~kWL~~kg~~tCpICr~~~~  307 (508)
                      ++..+|+||+++++   +..+.||.|+|..|+||..||.+|+..+++.+||+||..|.
T Consensus         4 ed~~~C~IC~~~~~---~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~   58 (60)
T d1vyxa_           4 EDVPVCWICNEELG---NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN   58 (60)
T ss_dssp             CSCCEETTTTEECS---CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCC
T ss_pred             CCCCCCccCCccCC---CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeee
Confidence            45678999998764   34678999999999999999999999999999999999984
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure