Citrus Sinensis ID: 010567

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
cEEEccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEccccccccccccccccccccccEEEcccccccccHHHHHcccHHHHHHHcccccccc
ccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHccccccEEEEccccccccc
MFIVWFLLYVFDRLHMLKSLDVSFnsimkipdeigSATALVkfdcssnqlkelpsslgrclnlsdfkasnncitslpedladcskmskldvegnkltVLSNNLIASWTMLTELIASKnllngmpetIGSLSRLIRLDLhqnrilsipssisgcCSLAefymgnnalsALPAElgklsklgtldlhSNQLKEYCVEACQLRLSVLDlsnnslsglppeigkMTTLRKLLLtgnplrtlrsslvngptpALLKYLRSrlpenedseasttkEDLITMATRLSVTSKELslegmnlsaipseiweageitkldlsrnsiqelppelsscASLQTLILSRnkikdwpdAILTSLsslsclkldnnplrqvpsdgfkdipmlqiLDLSyniaslpenppfsslphLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKnltslteldlsdnnisalppelgllepslqalrldgnplrsIRRTILDRGTKAVLKYLKDKIPEN
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRtlrsslvngptPALLKYLRsrlpenedseasttkedlitMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQAlrldgnplrsirrtildrgtkavlkylkdkipen
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQlrlsvldlsnnslsglPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAIltslsslsclklDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTdilrlqqlrildlSQNSLQSIPEGFKNLTSLTELDLSDNNISAlppelgllepslQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
*FIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYL*************************************MNLSAIPSEIWEAGEITKLDL***********LSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPEN*PFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELD************LGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL*******
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENE**********LITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKY*KDK****
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRL**********TKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
**IVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIVWFLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query507 2.2.26 [Sep-21-2011]
Q6GPJ5605 Leucine-rich repeat-conta N/A no 0.905 0.758 0.328 3e-51
Q5ZLN0603 Leucine-rich repeat-conta yes no 0.909 0.764 0.320 5e-50
Q5M8G4605 Leucine-rich repeat-conta yes no 0.907 0.760 0.327 2e-48
Q5RFE9602 Leucine-rich repeat-conta yes no 0.907 0.764 0.314 4e-47
Q7SXW3601 Leucine-rich repeat-conta yes no 0.913 0.770 0.316 1e-46
Q9H9A6602 Leucine-rich repeat-conta yes no 0.907 0.764 0.314 2e-46
Q4R3P6602 Leucine-rich repeat-conta N/A no 0.907 0.764 0.312 3e-46
Q9CRC8602 Leucine-rich repeat-conta yes no 0.905 0.762 0.306 4e-43
Q22875559 Leucine-rich repeat prote no no 0.928 0.842 0.300 9e-36
B5DX45629 Leucine-rich repeat prote yes no 0.930 0.750 0.298 5e-35
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function desciption
 Score =  203 bits (516), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 166/505 (32%), Positives = 254/505 (50%), Gaps = 46/505 (9%)

Query: 17  LKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSL 76
           L+ L++S N I ++P+E+     L  F    NQL+ELP S+G    L +   SNNC+ S+
Sbjct: 130 LQKLNISHNKIKQLPNELQHLQNLKSFLLQHNQLEELPDSIGHLSILEELDVSNNCLRSV 189

Query: 77  PEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRL 136
              +   + + K ++  NKLT L    I     L +L  + NLL  +P ++  +  L +L
Sbjct: 190 SSSVGQLTGLVKFNLSSNKLTALPTE-IGKMKNLRQLDCTSNLLENVPASVAGMESLEQL 248

Query: 137 DLHQNRILSIPSSISGCCSLAEFYMGNNALSAL-PAELGKLSKLGTLDLHSNQLKEYCVE 195
            L QN++  +P  +     L E ++GNN +  L P  L  LS L  L+L  N+LK    E
Sbjct: 249 YLRQNKLTYLP-ELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPKE 307

Query: 196 ACQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLR 254
              L+ L  LDLSNN +  LP  +G +  L+ L L GNPLR +R  ++N  T  LLKYL+
Sbjct: 308 ISLLKGLERLDLSNNDIGSLPDTLGSLPNLKSLQLDGNPLRGIRRDILNKGTQELLKYLK 367

Query: 255 SRL--PENEDSEASTTKEDLITMAT------RLSVTSKELSLEGMNLSAIPSEIWEAGE- 305
            R+  P+    EA+   +  +T+ +         +T K L       S IP  ++ A   
Sbjct: 368 GRVQTPDMTTQEAANPPDTAMTLPSDSVINAHAIMTLKTLEYCEKQASLIPEAVFNAAAS 427

Query: 306 --ITKLDLSRNSIQELPPELSSCA-SLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNP 362
             IT ++ S+N + E+P  +     S+  + L  NKI        +S+S   C+ L    
Sbjct: 428 SPITTVNFSKNQLTEVPARIVEMKDSVYDVNLGFNKI--------SSISLNLCMLLK--- 476

Query: 363 LRQVPSDGFKDIPMLQILDLSYN-IASLPENPPFSSLPHLQELYLRRMQLREAPTDILRL 421
                         L  LD+  N +ASLP  P   +L  LQ + L   + +  P  +  +
Sbjct: 477 --------------LTHLDMRNNALASLP--PEMEALTRLQSIILSFNRFKHFPDVLYTI 520

Query: 422 QQLRILDLSQNSLQSI-PEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNP 480
             L  + +S N + SI P   K +T L+ LDL +N++  +PP LG  E SL+AL L+GNP
Sbjct: 521 PNLETILISSNQIGSIDPIQLKKMTKLSTLDLQNNDLLQIPPALGNCE-SLRALHLEGNP 579

Query: 481 LRSIRRTILDRGTKAVLKYLKDKIP 505
            R+ R TIL +GT A+L+YL+ +IP
Sbjct: 580 FRNPRATILAKGTVAILEYLRSRIP 604

Xenopus laevis (taxid: 8355)
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query507
359493861584 PREDICTED: leucine-rich repeat-containin 0.982 0.852 0.787 0.0
225461397588 PREDICTED: leucine-rich repeat-containin 0.982 0.846 0.773 0.0
224114980580 predicted protein [Populus trichocarpa] 0.974 0.851 0.783 0.0
356549743583 PREDICTED: leucine-rich repeat-containin 0.893 0.777 0.770 0.0
449431828583 PREDICTED: leucine-rich repeat-containin 0.980 0.852 0.744 0.0
356544024586 PREDICTED: leucine-rich repeat-containin 0.897 0.776 0.770 0.0
255575336571 leucine-rich repeat-containing protein, 0.932 0.828 0.757 0.0
297830120584 leucine-rich repeat family protein [Arab 0.980 0.851 0.710 0.0
30683597584 leucine-rich repeat-containing protein [ 0.980 0.851 0.706 0.0
334185371590 leucine-rich repeat-containing protein [ 0.980 0.842 0.706 0.0
>gi|359493861|ref|XP_003634682.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 2 [Vitis vinifera] gi|302143032|emb|CBI20327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/499 (78%), Positives = 443/499 (88%), Gaps = 1/499 (0%)

Query: 10  VFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKAS 69
               L MLKSLD+S NSI+ IP+ IGSAT+LVK DCS+N+LK+LP+SLGRC NL + KAS
Sbjct: 86  AIGELPMLKSLDLSQNSIVDIPEVIGSATSLVKLDCSNNKLKDLPNSLGRCSNLLELKAS 145

Query: 70  NNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGS 129
           NNCITSLPEDLA C K+ KLDVEGNKLT+LS N+IASW +LTEL AS+NLL G+PE IG 
Sbjct: 146 NNCITSLPEDLAHCLKLIKLDVEGNKLTMLSENMIASWVLLTELNASRNLLTGLPENIGR 205

Query: 130 LSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQL 189
           LSRLIRLD HQNRI SIP+SI GCCSLAEFYMGNN LS+L AE+G LS LGTLDLHSNQL
Sbjct: 206 LSRLIRLDFHQNRISSIPASIKGCCSLAEFYMGNNVLSSLTAEIGALSLLGTLDLHSNQL 265

Query: 190 KEYCVEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPAL 249
           KEY VEAC+LRL VLDLSNNSLSGLPPEIG MTTLRKL+LTGNPLRTLRSSLV+GPTPAL
Sbjct: 266 KEYPVEACKLRLQVLDLSNNSLSGLPPEIGMMTTLRKLVLTGNPLRTLRSSLVSGPTPAL 325

Query: 250 LKYLRSRLPENEDSEASTT-KEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITK 308
           LK+LRSRL  +EDSEA+TT KE+++TMA R+S+TSKELSLEGM LSA+P+++WE+ EI K
Sbjct: 326 LKFLRSRLSTDEDSEAATTAKENVVTMAARISITSKELSLEGMGLSAVPAQVWESSEIVK 385

Query: 309 LDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPS 368
           +DLSRNSIQELPPEL+SC SLQ LILSRNKI++WP  IL SL +LSCLKLDNNPLRQ+P+
Sbjct: 386 VDLSRNSIQELPPELTSCVSLQALILSRNKIQEWPGVILKSLPNLSCLKLDNNPLRQIPA 445

Query: 369 DGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILD 428
           DGF+ +  LQILDLS N ASLP+NP FSSLP LQELYLRRMQL E P+DIL LQQL+ILD
Sbjct: 446 DGFQAVSKLQILDLSGNSASLPDNPAFSSLPQLQELYLRRMQLCEVPSDILSLQQLQILD 505

Query: 429 LSQNSLQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLRSIRRTI 488
           LSQNSLQ IPEGFKNLTSLTEL+LSDN+I+ LPPELGLLEPSLQALRLDGNPLRSIRRTI
Sbjct: 506 LSQNSLQLIPEGFKNLTSLTELNLSDNSIATLPPELGLLEPSLQALRLDGNPLRSIRRTI 565

Query: 489 LDRGTKAVLKYLKDKIPEN 507
           LDRGTKAVLKYLKDKIPE+
Sbjct: 566 LDRGTKAVLKYLKDKIPEH 584

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461397|ref|XP_002284846.1| PREDICTED: leucine-rich repeat-containing protein 40-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114980|ref|XP_002316909.1| predicted protein [Populus trichocarpa] gi|222859974|gb|EEE97521.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549743|ref|XP_003543250.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|449431828|ref|XP_004133702.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] gi|449478165|ref|XP_004155239.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356544024|ref|XP_003540456.1| PREDICTED: leucine-rich repeat-containing protein 40-like [Glycine max] Back     alignment and taxonomy information
>gi|255575336|ref|XP_002528571.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223532015|gb|EEF33826.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297830120|ref|XP_002882942.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297328782|gb|EFH59201.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30683597|ref|NP_188160.2| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|21703129|gb|AAM74505.1| AT3g15410/MJK13_7 [Arabidopsis thaliana] gi|24111377|gb|AAN46812.1| At3g15410/MJK13_7 [Arabidopsis thaliana] gi|332642149|gb|AEE75670.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185371|ref|NP_001189901.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332642150|gb|AEE75671.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query507
ZFIN|ZDB-GENE-030131-6062601 lrrc40 "leucine rich repeat co 0.913 0.770 0.275 2e-38
WB|WBGene00004929559 soc-2 [Caenorhabditis elegans 0.923 0.837 0.274 2.1e-36
UNIPROTKB|Q22875559 soc-2 "Leucine-rich repeat pro 0.923 0.837 0.274 2.1e-36
UNIPROTKB|A6QLV3582 SHOC2 "Leucine-rich repeat pro 0.927 0.807 0.257 4e-33
UNIPROTKB|Q9UQ13582 SHOC2 "Leucine-rich repeat pro 0.927 0.807 0.257 4e-33
UNIPROTKB|F2Z5G0582 SHOC2 "Uncharacterized protein 0.927 0.807 0.257 4e-33
UNIPROTKB|Q5RAV5582 SHOC2 "Leucine-rich repeat pro 0.927 0.807 0.257 4e-33
UNIPROTKB|E1BU15582 SHOC2 "Leucine-rich repeat pro 0.927 0.807 0.251 6.7e-33
RGD|1308146582 Shoc2 "soc-2 (suppressor of cl 0.927 0.807 0.253 1.1e-32
UNIPROTKB|E2R260582 SHOC2 "Uncharacterized protein 0.927 0.807 0.253 3.2e-32
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 412 (150.1 bits), Expect = 2.0e-38, P = 2.0e-38
 Identities = 139/505 (27%), Positives = 223/505 (44%)

Query:    14 LHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCI 73
             L  L+ L +S N + ++P  +   T L       N ++++P  LG+ +NL +   SNN +
Sbjct:   125 LEQLQKLILSHNKLTELPSGVWRLTNLRCLHLQQNLIEQIPRDLGQLVNLDELDLSNNHL 184

Query:    74 TSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRL 133
               +PE LA+   + KLD+  NKL  L    I+    L  L  S+N +  +P  +  +  L
Sbjct:   185 IDIPESLANLQNLVKLDLSCNKLKSLPP-AISQMKNLRMLDCSRNQMESIPPVLAQMESL 243

Query:   134 IRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAE-LGKLSKLGTLDLHSNQLKEY 192
              +L L  N++  +P  +  C +L E + GNN +  L AE L  L+ L  L+L  N++K  
Sbjct:   244 EQLYLRHNKLRYLPE-LPCCKTLKELHCGNNQIEVLEAEHLKHLNALSLLELRDNKVKSL 302

Query:   193 CVE-ACQXXXXXXXXXXXXXXXXPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLK 251
               E                    P  +G +  L+ L L GNPLR +R  L+   T  LLK
Sbjct:   303 PEEITLLQGLERLDLTNNDISSLPCGLGTLPKLKSLSLEGNPLRAIRRDLLTKGTGELLK 362

Query:   252 YLRSRLPENEDSEASTTKEDLITMATRLSV------TSKELSLEGMNLSAIPSEIWEAGE 305
             YLRSR+ E  +       +  +T  ++  +      T K L       + IP ++++A +
Sbjct:   363 YLRSRVQEPPNGGLKEEPKTAMTFPSQAKINVHAIKTLKTLDYSEKQDATIPDDVFDAVD 422

Query:   306 ---ITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAIXXXXXXXXXXXXDNNP 362
                +  ++ S+N +  +P                ++I D  D++              N 
Sbjct:   423 GNPVANVNFSKNQLTAVP----------------HRIVDLKDSLADINLGF-------NK 459

Query:   363 LRQVPSDGFKDIPMLQILDLSYNIA-SLPENPPFSSLPHLQELYLRRMQLREAPTXXXXX 421
             L  +P+D F  +  L  +DL  N+  SLP       L  L+ + L   + +  P      
Sbjct:   460 LTTIPAD-FCHLKQLMHIDLRNNLLISLPME--LEGLIKLRSVILSFNRFKSFPEVLYRI 516

Query:   422 XXXXXXXXSQNSLQSIPE-GFKNLTSLTELDLSDNNISAXXXXXXXXXXXXQALRLDGNP 480
                     S N +  I     K L+ L+ LDLS+N+I              +AL LDGNP
Sbjct:   517 PSLETILISSNQVGGIDAVQMKTLSRLSTLDLSNNDIMQVPPELGNCTSL-RALMLDGNP 575

Query:   481 LRSIRRTILDRGTKAVLKYLKDKIP 505
              R+ R  IL +GT AVL+YL+ +IP
Sbjct:   576 FRNPRAAILIKGTDAVLEYLRSRIP 600
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
WB|WBGene00004929 soc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q22875 soc-2 "Leucine-rich repeat protein soc-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G0 SHOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAV5 SHOC2 "Leucine-rich repeat protein SHOC-2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027645001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (584 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-23
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-14
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-11
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-11
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 7e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  116 bits (292), Expect = 2e-27
 Identities = 133/465 (28%), Positives = 204/465 (43%), Gaps = 52/465 (11%)

Query: 13  RLHMLKSLDVSFNSIM-KIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNN 71
           RL  ++++++S N +   IPD+I + ++ +++   SN         G   NL     SNN
Sbjct: 91  RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNN 150

Query: 72  CIT-SLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTEL----IASKNLLNGMPET 126
            ++  +P D+   S +  LD+ GN   VL   +  S T LT L    +AS  L+  +P  
Sbjct: 151 MLSGEIPNDIGSFSSLKVLDLGGN---VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE 207

Query: 127 IGSLSRLIRLDLHQNRIL-SIPSSISGCCSLAEFYMGNNALSA-LPAELGKLSKLGTLDL 184
           +G +  L  + L  N +   IP  I G  SL    +  N L+  +P+ LG L  L  L L
Sbjct: 208 LGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL 267

Query: 185 HSNQLKEYCVEAC--QLRLSVLDLSNNSLSGLPPE-IGKMTTLRKLLLTGNPLRTLRSSL 241
           + N+L      +     +L  LDLS+NSLSG  PE + ++  L  L L  N         
Sbjct: 268 YQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF------- 320

Query: 242 VNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSA-IPSEI 300
             G  P  L    + LP                   RL V    L L     S  IP  +
Sbjct: 321 -TGKIPVAL----TSLP-------------------RLQV----LQLWSNKFSGEIPKNL 352

Query: 301 WEAGEITKLDLSRNSIQ-ELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLD 359
            +   +T LDLS N++  E+P  L S  +L  LIL  N ++      L +  SL  ++L 
Sbjct: 353 GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQ 412

Query: 360 NNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDIL 419
           +N         F  +P++  LD+S N      N     +P LQ L L R +      D  
Sbjct: 413 DNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF 472

Query: 420 RLQQLRILDLSQNSLQ-SIPEGFKNLTSLTELDLSDNNISALPPE 463
             ++L  LDLS+N    ++P    +L+ L +L LS+N +S   P+
Sbjct: 473 GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPD 517

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 507
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.48
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.99
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.98
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
PLN03150623 hypothetical protein; Provisional 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.61
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.55
PLN03150623 hypothetical protein; Provisional 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
PRK15386 426 type III secretion protein GogB; Provisional 98.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.33
KOG4341483 consensus F-box protein containing LRR [General fu 98.27
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.26
KOG4341483 consensus F-box protein containing LRR [General fu 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.15
PRK15386 426 type III secretion protein GogB; Provisional 98.13
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.02
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.1
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.47
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.44
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.99
smart0037026 LRR Leucine-rich repeats, outliers. 94.99
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.25
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.16
smart0037026 LRR Leucine-rich repeats, outliers. 94.16
KOG4308478 consensus LRR-containing protein [Function unknown 94.04
KOG4308478 consensus LRR-containing protein [Function unknown 93.05
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.75
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.83
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.93
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.38
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=8e-49  Score=343.15  Aligned_cols=472  Identities=42%  Similarity=0.637  Sum_probs=392.0

Q ss_pred             ecHHhhcccCCCCEEEcCCCcccccCccccCCCcccEEeCCCCCCCCCchhhhcccCCCeEEcCCCcCccCCccccCCCC
Q 010567            6 FLLYVFDRLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSK   85 (507)
Q Consensus         6 ~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~   85 (507)
                      .+|++++++..++.++.+++++..+|..+....++..++++++.++++|+.++.+..+..++-.+|+++.+|.++..+.+
T Consensus        82 ~lp~aig~l~~l~~l~vs~n~ls~lp~~i~s~~~l~~l~~s~n~~~el~~~i~~~~~l~dl~~~~N~i~slp~~~~~~~~  161 (565)
T KOG0472|consen   82 QLPAAIGELEALKSLNVSHNKLSELPEQIGSLISLVKLDCSSNELKELPDSIGRLLDLEDLDATNNQISSLPEDMVNLSK  161 (565)
T ss_pred             hCCHHHHHHHHHHHhhcccchHhhccHHHhhhhhhhhhhccccceeecCchHHHHhhhhhhhccccccccCchHHHHHHH
Confidence            57888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEcCCCcccccchhhhcCccccceeecCCcccccccccccCCCcccEEeccCCccccCCCCCcCCCCCcEEEcCCCC
Q 010567           86 MSKLDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNA  165 (507)
Q Consensus        86 L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~  165 (507)
                      |..+++.+|++...++.... ++.|++++...|.++.+|+.++.+.+|..|++++|.+..+| .|..|..|.++.++.|.
T Consensus       162 l~~l~~~~n~l~~l~~~~i~-m~~L~~ld~~~N~L~tlP~~lg~l~~L~~LyL~~Nki~~lP-ef~gcs~L~Elh~g~N~  239 (565)
T KOG0472|consen  162 LSKLDLEGNKLKALPENHIA-MKRLKHLDCNSNLLETLPPELGGLESLELLYLRRNKIRFLP-EFPGCSLLKELHVGENQ  239 (565)
T ss_pred             HHHhhccccchhhCCHHHHH-HHHHHhcccchhhhhcCChhhcchhhhHHHHhhhcccccCC-CCCccHHHHHHHhcccH
Confidence            99999999999999988666 99999999999999999999999999999999999999998 89999999999999999


Q ss_pred             CccCCcccc-CCCCCCEEEcCCCcccccchhhhccc-cCeEECCCCCCCCCCccccCCCCccEEEccCCccccccccccC
Q 010567          166 LSALPAELG-KLSKLGTLDLHSNQLKEYCVEACQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVN  243 (507)
Q Consensus       166 ~~~l~~~l~-~~~~L~~L~l~~~~~~~~~~~~~~~~-L~~l~l~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~  243 (507)
                      +..+|++.. .++++..||+.+|+++.+|...+... |+.+|+++|.++++|..++++ +|+.|-+.||++.++...+..
T Consensus       240 i~~lpae~~~~L~~l~vLDLRdNklke~Pde~clLrsL~rLDlSNN~is~Lp~sLgnl-hL~~L~leGNPlrTiRr~ii~  318 (565)
T KOG0472|consen  240 IEMLPAEHLKHLNSLLVLDLRDNKLKEVPDEICLLRSLERLDLSNNDISSLPYSLGNL-HLKFLALEGNPLRTIRREIIS  318 (565)
T ss_pred             HHhhHHHHhcccccceeeeccccccccCchHHHHhhhhhhhcccCCccccCCcccccc-eeeehhhcCCchHHHHHHHHc
Confidence            999988765 88999999999999999999999888 999999999999999999999 999999999999999999999


Q ss_pred             CCCHHHHHHHHhcCCCCCccccccchhhh------hhhhhccccccceEEecCCCCCCCChhhhcCCC---ccEEEcCCC
Q 010567          244 GPTPALLKYLRSRLPENEDSEASTTKEDL------ITMATRLSVTSKELSLEGMNLSAIPSEIWEAGE---ITKLDLSRN  314 (507)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~---L~~L~l~~~  314 (507)
                      +.+.+.+++++..+............+..      .........+.+.+++++-.++.+|...+....   +...+++.|
T Consensus       319 ~gT~~vLKyLrs~~~~dglS~se~~~e~~~t~~~~~~~~~~~~i~tkiL~~s~~qlt~VPdEVfea~~~~~Vt~VnfskN  398 (565)
T KOG0472|consen  319 KGTQEVLKYLRSKIKDDGLSQSEGGTETAMTLPSESFPDIYAIITTKILDVSDKQLTLVPDEVFEAAKSEIVTSVNFSKN  398 (565)
T ss_pred             ccHHHHHHHHHHhhccCCCCCCcccccccCCCCCCcccchhhhhhhhhhcccccccccCCHHHHHHhhhcceEEEecccc
Confidence            99999999999855444332222111111      111112224456666777777777777665444   667777777


Q ss_pred             ccCcCCccccCCCcCcEEecccCcccCCchHHhhcCCCCCEEEccCCCCCCCCccccCCCCCceEEEccCcccCCCCCCC
Q 010567          315 SIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPP  394 (507)
Q Consensus       315 ~~~~i~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~  394 (507)
                      ++.++|..+..+..+...-+..++..+..+..++.+++|..|++++|.+..+|                         ..
T Consensus       399 qL~elPk~L~~lkelvT~l~lsnn~isfv~~~l~~l~kLt~L~L~NN~Ln~LP-------------------------~e  453 (565)
T KOG0472|consen  399 QLCELPKRLVELKELVTDLVLSNNKISFVPLELSQLQKLTFLDLSNNLLNDLP-------------------------EE  453 (565)
T ss_pred             hHhhhhhhhHHHHHHHHHHHhhcCccccchHHHHhhhcceeeecccchhhhcc-------------------------hh
Confidence            77777766655554433322223333333334455555555555555444444                         33


Q ss_pred             CCCCCcCcEEEcccccCcccccchhccCCCcEEEcCCCccccccc-cccCCCCCCeEeCCCCCCCCCCCcccCCCccCce
Q 010567          395 FSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPE-GFKNLTSLTELDLSDNNISALPPELGLLEPSLQA  473 (507)
Q Consensus       395 ~~~~~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~l~~l~~-~~~~l~~L~~L~l~~~~l~~~~~~~~~~~~~L~~  473 (507)
                      ++.+-.|++++++.|++..+|.++.....++.+..++|++.++++ ++.+|.+|..||+.+|++..+|+.++.+ .+|+.
T Consensus       454 ~~~lv~Lq~LnlS~NrFr~lP~~~y~lq~lEtllas~nqi~~vd~~~l~nm~nL~tLDL~nNdlq~IPp~Lgnm-tnL~h  532 (565)
T KOG0472|consen  454 MGSLVRLQTLNLSFNRFRMLPECLYELQTLETLLASNNQIGSVDPSGLKNMRNLTTLDLQNNDLQQIPPILGNM-TNLRH  532 (565)
T ss_pred             hhhhhhhheecccccccccchHHHhhHHHHHHHHhccccccccChHHhhhhhhcceeccCCCchhhCChhhccc-cceeE
Confidence            455667999999999999999999998999999999999999965 4999999999999999999999998887 99999


Q ss_pred             EeccCCCCCCccHHHHhhhHHHHHHHHHhcCCC
Q 010567          474 LRLDGNPLRSIRRTILDRGTKAVLKYLKDKIPE  506 (507)
Q Consensus       474 L~l~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~  506 (507)
                      |+++||+|+.-+....-..+.+++.|++++||-
T Consensus       533 LeL~gNpfr~Pr~~iLmkgT~aiL~ylrdrIpt  565 (565)
T KOG0472|consen  533 LELDGNPFRQPRHQILMKGTAAILSYLRDRIPT  565 (565)
T ss_pred             EEecCCccCCCHHHHhccChHHHHHHhcccCCC
Confidence            999999999888888999999999999999983

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-09
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 6e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-05
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 2e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 3e-05
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 5e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 6e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 7e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-05
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 8e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-04
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 1e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2z63_A 570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 3e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 5e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 5e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 5e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 5e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 8e-04
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 8e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (0%)
Query: 89  LDVEGNKLTVLSNNLIASWTMLTELIASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPS 148
           LD+   ++  +S N I  +  LT L  + N L  +P  I +LS L  LDL  NR+ S+P+
Sbjct: 229 LDLSNLQIFNISAN-IFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287
Query: 149 SISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKE 191
            +  C  L  FY  +N ++ LP E G L  L  L +  N L++
Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEK 330
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query507
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-64
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-55
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-57
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-60
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-57
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-46
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-54
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-50
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-48
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-48
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-46
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-46
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-35
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-46
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-45
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-26
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-22
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-45
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-19
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-45
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-43
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-42
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-37
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-42
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-34
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-40
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-40
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-39
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-38
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-40
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-37
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-34
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-38
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-39
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-36
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-34
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-39
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-38
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-32
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-31
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-36
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-26
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-19
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-35
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-33
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-33
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-31
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-32
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-29
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-25
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-24
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-22
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-10
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-15
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-21
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-18
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 4e-06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 8e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
 Score =  224 bits (572), Expect = 1e-64
 Identities = 88/515 (17%), Positives = 170/515 (33%), Gaps = 83/515 (16%)

Query: 13  RLHMLKSLDVSFNSIMKIPDEIGSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNC 72
              +L+        +  I  +   +    +    +N++  +  ++ R   L     +N+ 
Sbjct: 400 LSDLLQDAINRNPEMKPIKKDSRISLKDTQIGNLTNRITFISKAIQRLTKLQIIYFANSP 459

Query: 73  ITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTEL-IASKNLLNGMPETIGSLS 131
            T               + +  K         ++   LT++ + +   +  +P+ +  L 
Sbjct: 460 FTYDNI----AVDWEDANSDYAKQYENEELSWSNLKDLTDVELYNCPNMTQLPDFLYDLP 515

Query: 132 RLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKE 191
            L  L++  NR +S                     + L  +     K+    +  N L+E
Sbjct: 516 ELQSLNIACNRGISAAQLK-------------ADWTRLADDEDTGPKIQIFYMGYNNLEE 562

Query: 192 YCVEA--CQLR-LSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPA 248
           +   A   ++  L +LD  +N +  L    G    L  L L  N +  +           
Sbjct: 563 FPASASLQKMVKLGLLDCVHNKVRHLE-AFGTNVKLTDLKLDYNQIEEIPEDFCA----- 616

Query: 249 LLKYLRSRLPENEDSEASTTKEDLITMATRLSVTSKELSLEGMNLSAIPSEIWEAG--EI 306
               +                                L      L  IP+         +
Sbjct: 617 FTDQVE------------------------------GLGFSHNKLKYIPNIFNAKSVYVM 646

Query: 307 TKLDLSRNSIQELPPELSS------CASLQTLILSRNKIKDWPDAILTSLSSLSCLKLDN 360
             +D S N I      +S         +  T+ LS N+I+ +P  +  + S +S + L N
Sbjct: 647 GSVDFSYNKIGSEGRNISCSMDDYKGINASTVTLSYNEIQKFPTELFATGSPISTIILSN 706

Query: 361 NPLRQVPSDGFKDIP-------MLQILDLSYN-IASLPENPPFSSLPHLQELYLRRMQLR 412
           N +  +P +  K          +L  +DL +N + SL ++   ++LP+L  + +      
Sbjct: 707 NLMTSIPENSLKPKDGNYKNTYLLTTIDLRFNKLTSLSDDFRATTLPYLSNMDVSYNCFS 766

Query: 413 EAPTDILRLQQLRILDLSQNS-------LQSIPEGFKNLTSLTELDLSDNNISALPPELG 465
             PT  L   QL+   +           L+  P G     SL +L +  N+I  +  +L 
Sbjct: 767 SFPTQPLNSSQLKAFGIRHQRDAEGNRILRQWPTGITTCPSLIQLQIGSNDIRKVDEKLT 826

Query: 466 LLEPSLQALRLDGNPLRSIRRTILDRGTKAVLKYL 500
              P L  L +  NP  SI  T +    +A +  L
Sbjct: 827 ---PQLYILDIADNPNISIDVTSVCPYIEAGMYVL 858
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query507
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.49
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.49
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 88.36
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-45  Score=375.59  Aligned_cols=455  Identities=20%  Similarity=0.241  Sum_probs=269.6

Q ss_pred             CCCEEEcCCCccccc-CccccCCCcccEEeCCCCCCCCC-chhhhcccCCCeEEcCCCcCccC-CccccCCCCCcEEEcC
Q 010567           16 MLKSLDVSFNSIMKI-PDEIGSATALVKFDCSSNQLKEL-PSSLGRCLNLSDFKASNNCITSL-PEDLADCSKMSKLDVE   92 (507)
Q Consensus        16 ~L~~L~l~~~~i~~~-~~~~~~~~~L~~L~l~~~~l~~~-~~~~~~~~~L~~L~l~~~~~~~l-~~~~~~~~~L~~L~l~   92 (507)
                      ++++|+++++.+..+ +.+|+.+++|++|++++|.+..+ |..+.++++|++|++++|.+..+ |..+..+++|++|+++
T Consensus        34 ~l~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~  113 (606)
T 3t6q_A           34 STECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGPKALKHLFFI  113 (606)
T ss_dssp             TCCEEECTTCCCSEECTTTSTTCTTCSEEECTTCCCCEECTTTTTTCTTCCEEECTTCCCSEECTTTTSSCTTCCEEECT
T ss_pred             cCcEEEccCCccCcCChhHhccCccceEEECCCCccceeChhhccCccccCeeeCCCCcccccChhhhcccccccEeecc
Confidence            466666666666654 44566666666666666666543 44566666666666666666543 4456666666666666


Q ss_pred             CCcccccchhhhcCccccceeecCCccccccc-ccccCCCcccEEeccCCccccC-CCCCcCCCCCc--EEEcCCCCCcc
Q 010567           93 GNKLTVLSNNLIASWTMLTELIASKNLLNGMP-ETIGSLSRLIRLDLHQNRILSI-PSSISGCCSLA--EFYMGNNALSA  168 (507)
Q Consensus        93 ~~~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~-~~~~~~~~L~~L~l~~~~i~~l-~~~~~~~~~L~--~L~l~~~~~~~  168 (507)
                      +|+++.+....+.++++|++|++++|.+..++ ..+..+++|+.|++++|.+..+ +..+..+++|+  .|++++|.+..
T Consensus       114 ~n~i~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n~l~~  193 (606)
T 3t6q_A          114 QTGISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAG  193 (606)
T ss_dssp             TSCCSCGGGSCCTTCTTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTCCCCE
T ss_pred             ccCcccCCcchhccCCcccEEECCCCcccccCcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCCccCc
Confidence            66666554444666666666666666665442 2233356666666666665544 23345555555  55555555543


Q ss_pred             CCccccCC----------------------------------------------------CCCCEEEcCCCcccccchhh
Q 010567          169 LPAELGKL----------------------------------------------------SKLGTLDLHSNQLKEYCVEA  196 (507)
Q Consensus       169 l~~~l~~~----------------------------------------------------~~L~~L~l~~~~~~~~~~~~  196 (507)
                      ++......                                                    .+|+.+++++|.+..++...
T Consensus       194 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~  273 (606)
T 3t6q_A          194 IEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNT  273 (606)
T ss_dssp             ECTTTTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSCCTTT
T ss_pred             cChhHhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCccCHHH
Confidence            32211111                                                    15666777777776665543


Q ss_pred             hc--cccCeEECCCCCCCCCCccccCCCCccEEEccCCccccccccccCCC-CHHHHHHHHhcCCCCCccccccchhhhh
Q 010567          197 CQ--LRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGP-TPALLKYLRSRLPENEDSEASTTKEDLI  273 (507)
Q Consensus       197 ~~--~~L~~l~l~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  273 (507)
                      ..  .+|+++++++|.++.+|..+..+++|+.|++++|.++.+....+... ....+     .+......      ....
T Consensus       274 ~~~l~~L~~L~l~~n~l~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L-----~l~~n~~~------~~~~  342 (606)
T 3t6q_A          274 FHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHL-----SIKGNTKR------LELG  342 (606)
T ss_dssp             TTTCTTCSEEECTTSCCSCCCSSCCSCTTCCEEECTTCCCSBGGGGCGGGCTTCSEE-----ECCSCSSC------CBCC
T ss_pred             hccccCCCEEeccCCccCCCChhhcccccCCEEECccCCcCcCchhhhhccCcCCEE-----ECCCCCcc------cccc
Confidence            22  23788888888777777777777788888888777765433221110 00000     00000000      0000


Q ss_pred             hhhhccccccceEEecCCCCCCC---ChhhhcCCCccEEEcCCCccCcC-CccccCCCcCcEEecccCcccCCch-HHhh
Q 010567          274 TMATRLSVTSKELSLEGMNLSAI---PSEIWEAGEITKLDLSRNSIQEL-PPELSSCASLQTLILSRNKIKDWPD-AILT  348 (507)
Q Consensus       274 ~~~~~~~~~l~~l~l~~~~~~~~---~~~~~~~~~L~~L~l~~~~~~~i-~~~~~~~~~L~~L~l~~~~l~~~~~-~~~~  348 (507)
                      ........+++.++++++.+..+   +..+..+++|++|++++|.+.++ |..+..+++|++|++++|.+.+..+ ..+.
T Consensus       343 ~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~  422 (606)
T 3t6q_A          343 TGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQ  422 (606)
T ss_dssp             SSTTTTCTTCCEEECCSSCCCEEEESTTTTTTCTTCCEEECCSCSCEEECTTTTTTCTTCSEEECTTCCEECCTTCCTTT
T ss_pred             hhhhhccCcCCEEECCCCccccccCcchhcccCCCCCEEECCCCcCCcCCHHHhcCCccCCeEECCCCcCCCcccchhhh
Confidence            00111235667777777766643   44556667777777777776654 4456667777777777777665433 2356


Q ss_pred             cCCCCCEEEccCCCCCCCCccccCCCCCceEEEccCcccCC---CCCCCCCCCCcCcEEEcccccCccc-ccchhccCCC
Q 010567          349 SLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASL---PENPPFSSLPHLQELYLRRMQLREA-PTDILRLQQL  424 (507)
Q Consensus       349 ~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~~~~---~~~~~~~~~~~L~~L~l~~~~i~~l-~~~~~~~~~L  424 (507)
                      .+++|++|++++|.+...++..+..+++|+.|++++|.+.+   ..+..+..+++|+.|++++|.++.+ |..+..+++|
T Consensus       423 ~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L  502 (606)
T 3t6q_A          423 NLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFTSLKMM  502 (606)
T ss_dssp             TCTTCCEEECTTCCCBTTCTTTTTTCTTCCEEECTTCBCGGGEECSSCGGGGCTTCCEEECTTSCCCEECTTTTTTCTTC
T ss_pred             CcccCCEEECCCCccCCcCHHHHhCCCCCCEEECCCCCCCccccccchhhccCCCccEEECCCCccCccChhhhccccCC
Confidence            67777777777777776666667777777777777776654   2234466677777777777777754 4556677777


Q ss_pred             cEEEcCCCccccc-cccccCCCCCCeEeCCCCCCCCCCCcccCCCccCceEeccCCCCC
Q 010567          425 RILDLSQNSLQSI-PEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGNPLR  482 (507)
Q Consensus       425 ~~L~l~~~~l~~l-~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~~~  482 (507)
                      ++|++++|+++.+ |+.+.+++.| +|++++|+++.+++.....+++|+.|++++|++.
T Consensus       503 ~~L~Ls~N~l~~~~~~~l~~l~~L-~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~~~  560 (606)
T 3t6q_A          503 NHVDLSHNRLTSSSIEALSHLKGI-YLNLASNHISIILPSLLPILSQQRTINLRQNPLD  560 (606)
T ss_dssp             CEEECCSSCCCGGGGGGGTTCCSC-EEECCSSCCCCCCGGGHHHHHTSSEEECTTCCEE
T ss_pred             CEEECCCCccCcCChhHhCccccc-EEECcCCcccccCHhhcccCCCCCEEeCCCCCcc
Confidence            7777777777644 5667777777 7777777777666554333477777777777764
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 507
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-15
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 82.4 bits (202), Expect = 1e-17
 Identities = 81/357 (22%), Positives = 138/357 (38%), Gaps = 39/357 (10%)

Query: 126 TIGSLSRLIRLDLHQNRILSIPSSISGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLH 185
           +   L ++  L   +  I SI   +    +L +    NN L+ +   L  L+KL  + ++
Sbjct: 39  SQTDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMN 96

Query: 186 SNQLKEYCVEACQLRLSVLDLSNNSLSG-------------------LPPEIGKMTTLRK 226
           +NQ+ +    A    L+ L L NN ++                    +            
Sbjct: 97  NNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSL 156

Query: 227 LLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLITMATRLSVTS--- 283
             L+     T    L N  T   L    +++ +       T  E LI    ++S  +   
Sbjct: 157 QQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLG 216

Query: 284 -----KELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNK 338
                 ELSL G  L  I + +     +T LDL+ N I  L P LS    L  L L  N+
Sbjct: 217 ILTNLDELSLNGNQLKDIGT-LASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGANQ 274

Query: 339 IKDWPDAILTSLSSLSCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSL 398
           I +     L  L++L+ L+L+ N           ++  L  L L +N  ++ +  P SSL
Sbjct: 275 ISNISP--LAGLTALTNLELNENQ--LEDISPISNLKNLTYLTLYFN--NISDISPVSSL 328

Query: 399 PHLQELYLRRMQLREAPTDILRLQQLRILDLSQNSLQSIPEGFKNLTSLTELDLSDN 455
             LQ L+    ++ +  + +  L  +  L    N +  +     NLT +T+L L+D 
Sbjct: 329 TKLQRLFFANNKVSD-VSSLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query507
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.61
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=4.6e-27  Score=223.66  Aligned_cols=342  Identities=24%  Similarity=0.335  Sum_probs=207.1

Q ss_pred             cCCCcccEEeCCCCCCCCCchhhhcccCCCeEEcCCCcCccCCccccCCCCCcEEEcCCCcccccchhhhcCccccceee
Q 010567           35 GSATALVKFDCSSNQLKELPSSLGRCLNLSDFKASNNCITSLPEDLADCSKMSKLDVEGNKLTVLSNNLIASWTMLTELI  114 (507)
Q Consensus        35 ~~~~~L~~L~l~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~  114 (507)
                      +.+.+|++|++++++++.+ +.+..+++|++|++++|.++.++ .+.++++|++|++++|++.++..  ++++++|+.++
T Consensus        41 ~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADITP--LANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCc-cccCCcccccccccccccccccc--ccccccccccc
Confidence            3456788888888888777 35777888888888888888775 47788888888888888887664  77888888888


Q ss_pred             cCCcccccccccccCCCcccEEeccCCccccCCCCC-cCCCCCcEEEcCCCCCccCCccccCCCCCCEEEcCCCcccccc
Q 010567          115 ASKNLLNGMPETIGSLSRLIRLDLHQNRILSIPSSI-SGCCSLAEFYMGNNALSALPAELGKLSKLGTLDLHSNQLKEYC  193 (507)
Q Consensus       115 l~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~l~~~~-~~~~~L~~L~l~~~~~~~l~~~l~~~~~L~~L~l~~~~~~~~~  193 (507)
                      +.++.+..++.. .....+.......+.+..+.... ................    ..+............        
T Consensus       117 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~--------  183 (384)
T d2omza2         117 LFNNQITDIDPL-KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDL----KPLANLTTLERLDIS--------  183 (384)
T ss_dssp             CCSSCCCCCGGG-TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCC----GGGTTCTTCCEEECC--------
T ss_pred             cccccccccccc-cccccccccccccccccccccccccccccccccccccchh----hhhcccccccccccc--------
Confidence            888777665432 23345555555554443221100 0000011110000000    111111222222222        


Q ss_pred             hhhhccccCeEECCCCCCCCCCccccCCCCccEEEccCCccccccccccCCCCHHHHHHHHhcCCCCCccccccchhhhh
Q 010567          194 VEACQLRLSVLDLSNNSLSGLPPEIGKMTTLRKLLLTGNPLRTLRSSLVNGPTPALLKYLRSRLPENEDSEASTTKEDLI  273 (507)
Q Consensus       194 ~~~~~~~L~~l~l~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  273 (507)
                                    .+.. ........+++++.++++++.++.+                                    
T Consensus       184 --------------~~~~-~~~~~~~~l~~~~~l~l~~n~i~~~------------------------------------  212 (384)
T d2omza2         184 --------------SNKV-SDISVLAKLTNLESLIATNNQISDI------------------------------------  212 (384)
T ss_dssp             --------------SSCC-CCCGGGGGCTTCSEEECCSSCCCCC------------------------------------
T ss_pred             --------------cccc-ccccccccccccceeeccCCccCCC------------------------------------
Confidence                          2211 1223345555666666665544211                                    


Q ss_pred             hhhhccccccceEEecCCCCCCCChhhhcCCCccEEEcCCCccCcCCccccCCCcCcEEecccCcccCCchHHhhcCCCC
Q 010567          274 TMATRLSVTSKELSLEGMNLSAIPSEIWEAGEITKLDLSRNSIQELPPELSSCASLQTLILSRNKIKDWPDAILTSLSSL  353 (507)
Q Consensus       274 ~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~i~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L  353 (507)
                                             + .....++|+++++++|.+.+++ .+..+++|+.+++++|.+++..+  +..+++|
T Consensus       213 -----------------------~-~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~--~~~~~~L  265 (384)
T d2omza2         213 -----------------------T-PLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP--LSGLTKL  265 (384)
T ss_dssp             -----------------------G-GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG--GTTCTTC
T ss_pred             -----------------------C-cccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc--ccccccC
Confidence                                   1 1122345666666666655554 35566666667776666665543  4566777


Q ss_pred             CEEEccCCCCCCCCccccCCCCCceEEEccCcccCCCCCCCCCCCCcCcEEEcccccCcccccchhccCCCcEEEcCCCc
Q 010567          354 SCLKLDNNPLRQVPSDGFKDIPMLQILDLSYNIASLPENPPFSSLPHLQELYLRRMQLREAPTDILRLQQLRILDLSQNS  433 (507)
Q Consensus       354 ~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~l~~~~~~~~~L~~L~l~~~~  433 (507)
                      ++++++++.++++++  +..++.++.+.+.+|.+.+.  ..+..+++++.+++++|+++.++ .+..+++|++|++++|+
T Consensus       266 ~~L~l~~~~l~~~~~--~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~-~l~~l~~L~~L~L~~n~  340 (384)
T d2omza2         266 TELKLGANQISNISP--LAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNK  340 (384)
T ss_dssp             SEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCG-GGGGCTTCCEEECCSSC
T ss_pred             CEeeccCcccCCCCc--cccccccccccccccccccc--cccchhcccCeEECCCCCCCCCc-ccccCCCCCEEECCCCC
Confidence            777777776665543  56667777777777666543  23566677777888877777664 36677888888888888


Q ss_pred             cccccccccCCCCCCeEeCCCCCCCCCCCcccCCCccCceEeccCC
Q 010567          434 LQSIPEGFKNLTSLTELDLSDNNISALPPELGLLEPSLQALRLDGN  479 (507)
Q Consensus       434 l~~l~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n  479 (507)
                      ++.++ .+.++++|++|++++|+++.+++ +..+ ++|+.|+|++|
T Consensus       341 l~~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l-~~L~~L~L~~N  383 (384)
T d2omza2         341 VSDVS-SLANLTNINWLSAGHNQISDLTP-LANL-TRITQLGLNDQ  383 (384)
T ss_dssp             CCCCG-GGGGCTTCCEEECCSSCCCBCGG-GTTC-TTCSEEECCCE
T ss_pred             CCCCh-hHcCCCCCCEEECCCCcCCCChh-hccC-CCCCEeeCCCC
Confidence            77775 47778888888888888877665 4444 78888888776
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure