Citrus Sinensis ID: 010587

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500------
MDSASRSNRQLRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPFLISRL
cccccccHHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccccccccccEEEcccccEEEcccccccHHHHHHHHccccEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEEEEccccEEEEEccccEEEccEEEEEccHHHHHcccccccccccHHHHHHHHHccccEEEEEEEEccccccccccccEEEccccccEEEEEEccccccccEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccHHHHHHHccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
ccccccccHHHHHHHHHHHHcccccccccEEEEEccEHHHHHHHHHHHHcccEEEEEccccccEccccEEcccccEEEccccEccccccccHHHHHHHHHcccEEEEcccccEEEEEccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccHHHHHHHHHccccEEEccEEEEEEEcccEEEEEEccccEEEEcEEEEcccHHHHHHcccEEEccccHHHHHHHHHcEEEcEEEEEEEcccccccccccEEEEccccccEEEEccccccccccEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccEEEcEccccHHHHHHHHccEccEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccccccccccHHEccc
MDSASRSNRQLRRALCysnnagkgqarspsvIVIGAGMAGVAAARALHDASFKVVLLEsrdrvggrvhtdysfgfpvdlgaswlhgvcqenplapvisrlglplyrtsgdnsvlydhDLERVLKTVVVSLIQANLCYALfdmdgnqvpqELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVfdrrpelrlEGLAHKVLQWYLCRMEGWFAADAetislkswdkeellpgghglmvrgyLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVlkartikfeprlpdwkeAAIDDLGVGIENKIIMHFdkvfwpnveFLGVVSDTSYGCSYFLNLHKATGHCVlvympagqlaRDIEKMSDEAAANFAFTQLkkilpdasspIQYLVShwgtdanslgsysydtvgkshdlyerlripvdnlffageatsmsypgsvhgafstglMAAEDCRMRVLERygeldlfqpvmgeetpisVPFLISRL
mdsasrsnrqLRRALCysnnagkgqarsPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKEtdkvreehdedmsiqRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVlkartikfeprlpdwkEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGEldlfqpvmgeetpisvpflisrl
MDSASRSNRQLRRALCYSNNAGKGQARSPSvivigagmagvaaaraLHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPFLISRL
*****************************SVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESIL***************IQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPFL****
*******************************IVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELD************SVPFLISRL
**********LRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDK********MSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPFLISRL
******SNRQLRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVP**I***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSASRSNRQLRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPFLISRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query506 2.2.26 [Sep-21-2011]
Q9SKX5490 Probable polyamine oxidas yes no 0.968 1.0 0.780 0.0
Q9LYT1488 Polyamine oxidase 3 OS=Ar no no 0.964 1.0 0.766 0.0
Q8H191497 Probable polyamine oxidas no no 0.916 0.933 0.620 1e-177
Q9CAE3 789 Lysine-specific histone d no no 0.808 0.518 0.335 2e-49
Q8VXV7 844 Lysine-specific histone d no no 0.855 0.513 0.334 4e-47
Q9LID0 746 Lysine-specific histone d no no 0.814 0.552 0.348 7e-47
Q6YYZ1 763 Lysine-specific histone d no no 0.780 0.517 0.328 1e-46
Q6ZQ88853 Lysine-specific histone d yes no 0.857 0.508 0.301 1e-44
O60341852 Lysine-specific histone d yes no 0.865 0.514 0.298 1e-44
Q6Z690 849 Lysine-specific histone d no no 0.800 0.477 0.299 2e-40
>sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 Back     alignment and function desciption
 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/506 (78%), Positives = 439/506 (86%), Gaps = 16/506 (3%)

Query: 1   MDSASRSNRQLRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLESR 60
           M+S   S+RQ+RRA C+S    + + RSPSVIVIG G  G++AAR L DASF+V++LESR
Sbjct: 1   MESRKNSDRQMRRANCFSAGE-RMKTRSPSVIVIGGGFGGISAARTLQDASFQVMVLESR 59

Query: 61  DRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLE 120
           DR+GGRVHTDYSFGFPVDLGASWLHGVC+ENPLAPVI RLGLPLYRTSGDNSVLYDHDLE
Sbjct: 60  DRIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAPVIGRLGLPLYRTSGDNSVLYDHDLE 119

Query: 121 RVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQ 180
                           YALFDMDGNQVPQELVT++G  FE IL+E +KVR+E D D+SI 
Sbjct: 120 ---------------SYALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISIS 164

Query: 181 RAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMV 240
           +A SIVF R+PELRLEGLAH VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLMV
Sbjct: 165 QAFSIVFSRKPELRLEGLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMV 224

Query: 241 RGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKART 300
           RGY PVINTLAKGLDIR+GHRVTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ T
Sbjct: 225 RGYRPVINTLAKGLDIRVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGT 284

Query: 301 IKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKA 360
           IKFEP+LP+WK+ AI+DLGVGIENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHKA
Sbjct: 285 IKFEPKLPEWKQEAINDLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKA 344

Query: 361 TGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLG 420
           TGH VLVYMPAGQLA+DIEKMSDEAAANFA  QL++ILPDA  P+QYLVS WG+D NS+G
Sbjct: 345 TGHPVLVYMPAGQLAKDIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMG 404

Query: 421 SYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLER 480
           SYSYD VGK HDLYERLR+PVDNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLER
Sbjct: 405 SYSYDIVGKPHDLYERLRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLER 464

Query: 481 YGELDLFQPVMGEETPISVPFLISRL 506
           YGELDLFQPVMGEE P SVP LISRL
Sbjct: 465 YGELDLFQPVMGEEGPASVPLLISRL 490
Flavoenzyme that catalyzes the oxidation of the secondary amino group of polyamines.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: -
>sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 Back     alignment and function description
>sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 Back     alignment and function description
>sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 Back     alignment and function description
>sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 Back     alignment and function description
>sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
255561152491 amine oxidase, putative [Ricinus communi 0.968 0.997 0.826 0.0
356567482490 PREDICTED: probable polyamine oxidase 2- 0.968 1.0 0.804 0.0
225446763490 PREDICTED: probable polyamine oxidase 2 0.968 1.0 0.812 0.0
224066525513 predicted protein [Populus trichocarpa] 0.968 0.955 0.801 0.0
224082614482 predicted protein [Populus trichocarpa] 0.942 0.989 0.840 0.0
15224204490 putative polyamine oxidase 2 [Arabidopsi 0.968 1.0 0.780 0.0
297824269490 ATPAO2 [Arabidopsis lyrata subsp. lyrata 0.968 1.0 0.780 0.0
356526932490 PREDICTED: probable polyamine oxidase 2- 0.968 1.0 0.774 0.0
449463595489 PREDICTED: probable polyamine oxidase 2- 0.966 1.0 0.772 0.0
18650598490 At2g43020/MFL8.12 [Arabidopsis thaliana] 0.968 1.0 0.778 0.0
>gi|255561152|ref|XP_002521588.1| amine oxidase, putative [Ricinus communis] gi|223539266|gb|EEF40859.1| amine oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/507 (82%), Positives = 452/507 (89%), Gaps = 17/507 (3%)

Query: 1   MDSASRSNR-QLRRALCYSNNAGKGQARSPSVIVIGAGMAGVAAARALHDASFKVVLLES 59
           M+S  RSNR QLRR LC+S+ A + +A S SVIVIG GMAG+AAARAL+DASF+VVLLES
Sbjct: 1   MESGLRSNRSQLRRGLCFSD-AERREASSRSVIVIGGGMAGIAAARALYDASFQVVLLES 59

Query: 60  RDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDL 119
           RDR+GGRVHT+YSFGFPVDLGASWLHGV  ENPLAP+I RLGLPLYRTSGDNSVLYDHDL
Sbjct: 60  RDRLGGRVHTNYSFGFPVDLGASWLHGVGPENPLAPLIGRLGLPLYRTSGDNSVLYDHDL 119

Query: 120 ERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSI 179
           E                YALFDMDGNQVPQELV++VGE FE ILKET+KVR+E+ EDMSI
Sbjct: 120 E---------------SYALFDMDGNQVPQELVSEVGETFEIILKETEKVRQEYSEDMSI 164

Query: 180 QRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLM 239
             A SIVF+RRPELRLEGLAHKVLQWYLCRMEGWFAADA+TISLK WD+EELLPGGHGLM
Sbjct: 165 SNAFSIVFERRPELRLEGLAHKVLQWYLCRMEGWFAADADTISLKCWDQEELLPGGHGLM 224

Query: 240 VRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKAR 299
           VRGYLPVINTLAKGLDIRLGHRVTKI R + GVKVT E G+TF+ADA V+AVPLGVLK+R
Sbjct: 225 VRGYLPVINTLAKGLDIRLGHRVTKIVRRHNGVKVTTEDGRTFMADAAVIAVPLGVLKSR 284

Query: 300 TIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHK 359
           TI FEPRLPDWKE AI DLGVGIENKI++HFDKVFWPNVEFLGVVS+TSYGCSYFLNLHK
Sbjct: 285 TITFEPRLPDWKEEAIKDLGVGIENKIVLHFDKVFWPNVEFLGVVSETSYGCSYFLNLHK 344

Query: 360 ATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSL 419
           ATGH VLVYMPAGQLA+DIEKMSDEAAANFAF QLKKILP+AS PIQYLVS WG+D NSL
Sbjct: 345 ATGHSVLVYMPAGQLAKDIEKMSDEAAANFAFMQLKKILPEASDPIQYLVSRWGSDVNSL 404

Query: 420 GSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLE 479
           GSYSYDTVGK HDLYERLR+PVDNLFFAGEATS SYPGSVHGAFSTGLMAAEDCRMRVLE
Sbjct: 405 GSYSYDTVGKPHDLYERLRVPVDNLFFAGEATSASYPGSVHGAFSTGLMAAEDCRMRVLE 464

Query: 480 RYGELDLFQPVMGEETPISVPFLISRL 506
           RYGELDLFQPVMGEE  +SVP LISR+
Sbjct: 465 RYGELDLFQPVMGEEAAVSVPLLISRM 491

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356567482|ref|XP_003551948.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|225446763|ref|XP_002282970.1| PREDICTED: probable polyamine oxidase 2 [Vitis vinifera] gi|302143503|emb|CBI22064.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224066525|ref|XP_002302123.1| predicted protein [Populus trichocarpa] gi|222843849|gb|EEE81396.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224082614|ref|XP_002306765.1| predicted protein [Populus trichocarpa] gi|222856214|gb|EEE93761.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15224204|ref|NP_181830.1| putative polyamine oxidase 2 [Arabidopsis thaliana] gi|75206576|sp|Q9SKX5.1|PAO2_ARATH RecName: Full=Probable polyamine oxidase 2; Short=AtPAO2; AltName: Full=Amine oxidase 1 gi|29468124|gb|AAO85404.1|AF364952_1 putative amine oxidase 1 [Arabidopsis thaliana] gi|4531444|gb|AAD22129.1| putative amine oxidase [Arabidopsis thaliana] gi|115311507|gb|ABI93934.1| At2g43020 [Arabidopsis thaliana] gi|330255105|gb|AEC10199.1| putative polyamine oxidase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297824269|ref|XP_002880017.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] gi|297325856|gb|EFH56276.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356526932|ref|XP_003532069.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449463595|ref|XP_004149519.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] gi|449505802|ref|XP_004162572.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18650598|gb|AAL75899.1| At2g43020/MFL8.12 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query506
TAIR|locus:2053723490 PAO2 "AT2G43020" [Arabidopsis 0.966 0.997 0.763 2e-207
TAIR|locus:2077670488 PAO3 "polyamine oxidase 3" [Ar 0.964 1.0 0.743 1.6e-198
TAIR|locus:2018571497 PAO4 "polyamine oxidase 4" [Ar 0.879 0.895 0.618 1.2e-152
TAIR|locus:2130454 1628 LDL3 "LSD1-like 3" [Arabidopsi 0.604 0.187 0.353 2.9e-50
TAIR|locus:2091501 746 LDL2 "LSD1-like2" [Arabidopsis 0.681 0.462 0.341 5.2e-47
UNIPROTKB|E2RNL9876 KDM1A "Uncharacterized protein 0.598 0.345 0.334 1.9e-44
UNIPROTKB|F6S0T5876 KDM1A "Lysine-specific histone 0.598 0.345 0.334 3.2e-44
UNIPROTKB|F1LVQ3735 Kdm1 "Protein Kdm1" [Rattus no 0.598 0.412 0.334 6.3e-44
RGD|1562975755 Kdm1a "lysine (K)-specific dem 0.598 0.401 0.334 7.5e-44
UNIPROTKB|F1STX7853 KDM1A "Uncharacterized protein 0.644 0.382 0.326 1.2e-43
TAIR|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2006 (711.2 bits), Expect = 2.0e-207, P = 2.0e-207
 Identities = 387/507 (76%), Positives = 429/507 (84%)

Query:     1 MDSASRSNRQLRRALCYSNNAGKG-QARSPSXXXXXXXXXXXXXXXXLHDASFKVVLLES 59
             M+S   S+RQ+RRA C+S  AG+  + RSPS                L DASF+V++LES
Sbjct:     1 MESRKNSDRQMRRANCFS--AGERMKTRSPSVIVIGGGFGGISAARTLQDASFQVMVLES 58

Query:    60 RDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDL 119
             RDR+GGRVHTDYSFGFPVDLGASWLHGVC+ENPLAPVI RLGLPLYRTSGDNSVLYDHDL
Sbjct:    59 RDRIGGRVHTDYSFGFPVDLGASWLHGVCKENPLAPVIGRLGLPLYRTSGDNSVLYDHDL 118

Query:   120 ERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSI 179
             E                YALFDMDGNQVPQELVT++G  FE IL+E +KVR+E D D+SI
Sbjct:   119 ES---------------YALFDMDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISI 163

Query:   180 QRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLM 239
              +A SIVF R+PELRLEGLAH VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLM
Sbjct:   164 SQAFSIVFSRKPELRLEGLAHNVLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLM 223

Query:   240 VRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKAR 299
             VRGY PVINTLAKGLDIR+GHRVTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ 
Sbjct:   224 VRGYRPVINTLAKGLDIRVGHRVTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSG 283

Query:   300 TIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHK 359
             TIKFEP+LP+WK+ AI+DLGVGIENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHK
Sbjct:   284 TIKFEPKLPEWKQEAINDLGVGIENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHK 343

Query:   360 ATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSL 419
             ATGH VLVYMPAGQLA+DIEKMSDEAAANFA  QL++ILPDA  P+QYLVS WG+D NS+
Sbjct:   344 ATGHPVLVYMPAGQLAKDIEKMSDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSM 403

Query:   420 GSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLE 479
             GSYSYD VGK HDLYERLR+PVDNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLE
Sbjct:   404 GSYSYDIVGKPHDLYERLRVPVDNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLE 463

Query:   480 RYGELDLFQPVMGEETPISVPFLISRL 506
             RYGELDLFQPVMGEE P SVP LISRL
Sbjct:   464 RYGELDLFQPVMGEEGPASVPLLISRL 490
GO:0008131 "primary amine oxidase activity" evidence=ISS
GO:0006598 "polyamine catabolic process" evidence=IDA
GO:0046592 "polyamine oxidase activity" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
GO:0009409 "response to cold" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
TAIR|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNL9 KDM1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6S0T5 KDM1A "Lysine-specific histone demethylase 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LVQ3 Kdm1 "Protein Kdm1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1562975 Kdm1a "lysine (K)-specific demethylase 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1STX7 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LYT1PAO3_ARATH1, ., 5, ., 3, ., 1, 70.76670.96441.0nono
Q9SKX5PAO2_ARATH1, ., 5, ., 3, ., -0.78060.96831.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3.2LOW CONFIDENCE prediction!
3rd Layer1.5.3.17LOW CONFIDENCE prediction!
3rd Layer1.5.30.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.II.1985.1
polyamine oxidase (EC-1.5.3.11) (513 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 0.0
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 2e-92
PLN02976 1713 PLN02976, PLN02976, amine oxidase 8e-75
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 1e-63
PLN02676487 PLN02676, PLN02676, polyamine oxidase 1e-59
PLN03000 881 PLN03000, PLN03000, amine oxidase 7e-56
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 1e-54
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 2e-42
PLN02568539 PLN02568, PLN02568, polyamine oxidase 2e-30
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 2e-23
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 6e-14
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 7e-13
PLN02568539 PLN02568, PLN02568, polyamine oxidase 6e-12
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 1e-08
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 9e-08
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 8e-07
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 2e-06
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 2e-06
PLN02612567 PLN02612, PLN02612, phytoene desaturase 6e-06
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 6e-06
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 9e-06
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-05
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 3e-05
PLN02612567 PLN02612, PLN02612, phytoene desaturase 4e-05
PRK12834549 PRK12834, PRK12834, putative FAD-binding dehydroge 5e-05
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 7e-05
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 7e-05
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 1e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-04
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 1e-04
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 2e-04
TIGR01372 985 TIGR01372, soxA, sarcosine oxidase, alpha subunit 2e-04
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-04
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 3e-04
COG3573552 COG3573, COG3573, Predicted oxidoreductase [Genera 3e-04
TIGR00562462 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase 3e-04
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 3e-04
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 4e-04
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 5e-04
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 5e-04
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 5e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 5e-04
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 6e-04
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 0.001
TIGR02732474 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot 0.001
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.001
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 0.001
COG2907447 COG2907, COG2907, Predicted NAD/FAD-binding protei 0.001
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 0.001
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 0.002
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl 0.003
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.003
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 0.003
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydroge 0.004
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 0.004
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 0.004
PRK01747662 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- 0.004
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information 
 Score =  916 bits (2369), Expect = 0.0
 Identities = 365/450 (81%), Positives = 397/450 (88%), Gaps = 15/450 (3%)

Query: 29  PSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVC 88
           PSVIVIG G+AG+AAARALHDASFKV LLESRDR+GGRVHTDYSFGFPVD+GASWLHGVC
Sbjct: 1   PSVIVIGGGIAGIAAARALHDASFKVTLLESRDRIGGRVHTDYSFGFPVDMGASWLHGVC 60

Query: 89  QENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVP 148
            ENPLAP+I RLGLPLYRTSGDNSVLYDHDLE                YALFDMDGNQVP
Sbjct: 61  NENPLAPLIGRLGLPLYRTSGDNSVLYDHDLE---------------SYALFDMDGNQVP 105

Query: 149 QELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLC 208
           QELVTKVGE FE IL+ET+KVR+EH+EDMS+ +AISIV +R PELRLEGLAH+VLQWYLC
Sbjct: 106 QELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLERHPELRLEGLAHEVLQWYLC 165

Query: 209 RMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRH 268
           RMEGWFAADA+TISLKSWD+EELL GGHGLMVRGY PVINTLAKGLDIRL HRVTKI R 
Sbjct: 166 RMEGWFAADADTISLKSWDQEELLEGGHGLMVRGYDPVINTLAKGLDIRLNHRVTKIVRR 225

Query: 269 YIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIM 328
           Y GVKVTVE G TFVADA ++AVPLGVLKA  IKFEP LP+WKE AI DLGVGIENKI +
Sbjct: 226 YNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKFEPELPEWKEEAISDLGVGIENKIAL 285

Query: 329 HFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAAN 388
           HFD VFWPNVEFLGVV+ TSYGCSYFLNLHKATGH VLVYMPAG+LARDIEK+SDEAAAN
Sbjct: 286 HFDSVFWPNVEFLGVVAPTSYGCSYFLNLHKATGHPVLVYMPAGRLARDIEKLSDEAAAN 345

Query: 389 FAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAG 448
           FA +QLKK+LPDA+ P+QYLVS WG+D NSLG YSYD VGK HDLYERLR PVDNLFFAG
Sbjct: 346 FAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVGKPHDLYERLRAPVDNLFFAG 405

Query: 449 EATSMSYPGSVHGAFSTGLMAAEDCRMRVL 478
           EATS  +PGSVHGA+STG+MAAE+CRMR+L
Sbjct: 406 EATSSDFPGSVHGAYSTGVMAAEECRMRLL 435

Length = 435
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|235059 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 506
PLN02268435 probable polyamine oxidase 100.0
PLN03000 881 amine oxidase 100.0
PLN02529 738 lysine-specific histone demethylase 1 100.0
PLN02328808 lysine-specific histone demethylase 1 homolog 100.0
PLN02676487 polyamine oxidase 100.0
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 100.0
PLN02568539 polyamine oxidase 100.0
PLN02976 1713 amine oxidase 100.0
COG1231450 Monoamine oxidase [Amino acid transport and metabo 100.0
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 100.0
PRK12416463 protoporphyrinogen oxidase; Provisional 100.0
PRK11883451 protoporphyrinogen oxidase; Reviewed 100.0
PLN02576496 protoporphyrinogen oxidase 100.0
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 100.0
PRK07233434 hypothetical protein; Provisional 100.0
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 100.0
PLN02612567 phytoene desaturase 100.0
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 100.0
PRK07208479 hypothetical protein; Provisional 100.0
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 100.0
PLN02487569 zeta-carotene desaturase 100.0
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 100.0
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 100.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 100.0
TIGR02730493 carot_isom carotene isomerase. Members of this fam 100.0
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 100.0
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.96
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.95
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.94
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 99.9
COG3349485 Uncharacterized conserved protein [Function unknow 99.89
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.79
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.73
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.69
COG2081408 Predicted flavoproteins [General function predicti 99.68
PRK13977576 myosin-cross-reactive antigen; Provisional 99.66
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.56
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.51
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.51
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.5
PRK09126392 hypothetical protein; Provisional 99.5
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.5
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.49
PRK10157428 putative oxidoreductase FixC; Provisional 99.48
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.48
PRK10015429 oxidoreductase; Provisional 99.47
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.46
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.46
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.45
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.45
PRK08013400 oxidoreductase; Provisional 99.45
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.45
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.45
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.45
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.44
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.44
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.44
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.43
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 99.43
PRK06847375 hypothetical protein; Provisional 99.43
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.42
PRK07588391 hypothetical protein; Provisional 99.4
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.39
PRK11445351 putative oxidoreductase; Provisional 99.38
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.37
PRK06834 488 hypothetical protein; Provisional 99.36
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.35
PRK05868372 hypothetical protein; Validated 99.35
PRK06185407 hypothetical protein; Provisional 99.34
PRK06184 502 hypothetical protein; Provisional 99.34
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.34
COG0579429 Predicted dehydrogenase [General function predicti 99.32
PRK07190 487 hypothetical protein; Provisional 99.32
PRK08244 493 hypothetical protein; Provisional 99.31
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.31
PRK07045388 putative monooxygenase; Reviewed 99.31
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.31
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.31
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.3
PRK07236386 hypothetical protein; Provisional 99.3
PRK06753373 hypothetical protein; Provisional 99.29
PRK11728393 hydroxyglutarate oxidase; Provisional 99.29
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.29
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.28
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.28
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.27
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.27
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.25
PRK08163396 salicylate hydroxylase; Provisional 99.25
PRK06996398 hypothetical protein; Provisional 99.24
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.24
PRK06126545 hypothetical protein; Provisional 99.23
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.23
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.21
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.2
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.19
PLN02463447 lycopene beta cyclase 99.17
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.16
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.15
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.14
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.14
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.14
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.14
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.14
PRK07538413 hypothetical protein; Provisional 99.13
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.13
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.12
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.12
PRK06475400 salicylate hydroxylase; Provisional 99.12
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.11
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.11
PLN02661357 Putative thiazole synthesis 99.11
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 99.09
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.09
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.08
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.07
PRK08274466 tricarballylate dehydrogenase; Validated 99.07
PLN02464627 glycerol-3-phosphate dehydrogenase 99.07
PLN02697529 lycopene epsilon cyclase 99.06
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.05
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.04
PRK08294 634 phenol 2-monooxygenase; Provisional 99.04
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 99.03
PRK05257494 malate:quinone oxidoreductase; Validated 99.03
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.02
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.02
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.01
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.98
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.98
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.98
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.97
PRK09897 534 hypothetical protein; Provisional 98.97
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.96
PRK06175433 L-aspartate oxidase; Provisional 98.95
PRK07121492 hypothetical protein; Validated 98.95
PLN02985514 squalene monooxygenase 98.95
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.95
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.94
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.94
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.92
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.92
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.91
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.91
PRK07804541 L-aspartate oxidase; Provisional 98.9
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 98.9
PTZ00367567 squalene epoxidase; Provisional 98.89
PRK12842574 putative succinate dehydrogenase; Reviewed 98.89
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.89
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.88
PRK12839572 hypothetical protein; Provisional 98.88
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.88
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.87
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.87
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.87
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.86
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.86
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.86
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.86
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.86
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.85
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.84
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.83
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.82
PRK08071510 L-aspartate oxidase; Provisional 98.82
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.81
PRK08401466 L-aspartate oxidase; Provisional 98.81
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.79
PRK07395553 L-aspartate oxidase; Provisional 98.79
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.79
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.79
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.78
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.78
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.77
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.76
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.76
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.76
PLN02815594 L-aspartate oxidase 98.76
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.75
PLN02507499 glutathione reductase 98.75
PRK08275554 putative oxidoreductase; Provisional 98.75
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.74
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.74
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.73
PRK07512513 L-aspartate oxidase; Provisional 98.73
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.71
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.71
PRK10262321 thioredoxin reductase; Provisional 98.71
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.7
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.69
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.68
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.66
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.66
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.66
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.65
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.65
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.61
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.59
PRK09077536 L-aspartate oxidase; Provisional 98.58
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.56
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.54
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.51
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 98.5
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.49
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.47
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.46
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.46
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.45
PLN02852491 ferredoxin-NADP+ reductase 98.45
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.44
PRK12831464 putative oxidoreductase; Provisional 98.42
PRK06116450 glutathione reductase; Validated 98.42
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.42
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.41
COG3573552 Predicted oxidoreductase [General function predict 98.41
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.38
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.38
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.35
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.34
KOG2853509 consensus Possible oxidoreductase [General functio 98.32
PRK06370463 mercuric reductase; Validated 98.32
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.31
PTZ00188506 adrenodoxin reductase; Provisional 98.31
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.31
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.31
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.31
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.29
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.28
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.28
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.28
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 98.27
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.26
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 98.26
PRK14694468 putative mercuric reductase; Provisional 98.25
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.24
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.23
TIGR02053463 MerA mercuric reductase. This model represents the 98.23
PTZ00058561 glutathione reductase; Provisional 98.22
PRK14727479 putative mercuric reductase; Provisional 98.21
KOG03992142 consensus Glutamate synthase [Amino acid transport 98.21
PRK13748561 putative mercuric reductase; Provisional 98.21
PTZ00052499 thioredoxin reductase; Provisional 98.21
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.2
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.2
PRK07846451 mycothione reductase; Reviewed 98.18
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.18
PRK12814652 putative NADPH-dependent glutamate synthase small 98.14
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.13
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.13
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.13
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.13
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 98.12
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 98.12
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.12
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.11
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.11
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.1
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.1
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.09
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.07
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.07
PTZ00153659 lipoamide dehydrogenase; Provisional 98.05
PLN02546558 glutathione reductase 98.03
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.02
PRK07846451 mycothione reductase; Reviewed 98.02
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.02
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.02
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.0
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.98
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.98
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 97.97
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.95
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.94
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.94
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.93
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.92
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.91
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.91
PRK06116450 glutathione reductase; Validated 97.9
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.89
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.87
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.86
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.86
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 97.85
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.84
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.84
PRK13984604 putative oxidoreductase; Provisional 97.83
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.82
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.8
PRK02106560 choline dehydrogenase; Validated 97.77
TIGR02053463 MerA mercuric reductase. This model represents the 97.76
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.75
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.75
PRK06370463 mercuric reductase; Validated 97.74
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.73
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.72
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.71
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.71
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.7
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 97.69
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.67
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.67
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.67
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.65
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.63
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.62
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.62
PRK14727479 putative mercuric reductase; Provisional 97.58
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.56
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.56
PTZ00052499 thioredoxin reductase; Provisional 97.55
PRK13512438 coenzyme A disulfide reductase; Provisional 97.55
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.54
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.51
PTZ00058561 glutathione reductase; Provisional 97.48
PRK14694468 putative mercuric reductase; Provisional 97.47
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.47
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.46
PRK13748561 putative mercuric reductase; Provisional 97.46
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.46
KOG2852380 consensus Possible oxidoreductase [General functio 97.41
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 97.35
PLN02785587 Protein HOTHEAD 97.34
PLN02546558 glutathione reductase 97.3
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 97.29
PTZ00153659 lipoamide dehydrogenase; Provisional 97.27
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.24
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 97.21
COG4716587 Myosin-crossreactive antigen [Function unknown] 97.21
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 97.2
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.16
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.14
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.1
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.92
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.88
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.83
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.69
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.64
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.61
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.39
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 96.35
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.34
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.32
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.24
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.19
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.07
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.04
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 95.96
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.91
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.87
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 95.82
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 95.8
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.68
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 95.62
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.52
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.46
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 95.42
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.33
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.29
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.14
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.11
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.0
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.98
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.94
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 94.92
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.89
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.84
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.75
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.62
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.58
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 94.56
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.55
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.54
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.53
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.52
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.41
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 94.37
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.3
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 94.24
PRK10262321 thioredoxin reductase; Provisional 94.08
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.04
PLN02507499 glutathione reductase 94.04
PRK04148134 hypothetical protein; Provisional 94.02
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.9
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 93.87
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 93.87
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.86
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 93.86
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 93.83
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.69
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.65
KOG2755334 consensus Oxidoreductase [General function predict 93.64
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.62
PRK12831464 putative oxidoreductase; Provisional 93.56
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 93.56
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.55
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.5
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 93.44
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.42
PRK12770352 putative glutamate synthase subunit beta; Provisio 93.37
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.36
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.31
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.24
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 93.23
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 93.2
PRK06719157 precorrin-2 dehydrogenase; Validated 93.14
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 93.14
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.09
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.08
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.93
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.77
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 92.67
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.61
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 92.58
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 92.57
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 92.49
PLN02353473 probable UDP-glucose 6-dehydrogenase 92.37
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.36
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.31
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 92.08
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.07
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 92.06
PRK06223307 malate dehydrogenase; Reviewed 92.02
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.0
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 91.95
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 91.92
PTZ00082321 L-lactate dehydrogenase; Provisional 91.82
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 91.79
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 91.78
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 91.72
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.66
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 91.66
PRK07417279 arogenate dehydrogenase; Reviewed 91.65
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 91.53
PRK11730715 fadB multifunctional fatty acid oxidation complex 91.51
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 91.48
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 91.45
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 91.35
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 91.35
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 91.34
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 91.26
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.21
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 91.19
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.19
PRK12549284 shikimate 5-dehydrogenase; Reviewed 91.0
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.92
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 90.84
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.77
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.73
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 90.68
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 90.66
PLN02602350 lactate dehydrogenase 90.65
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 90.58
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.52
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 90.43
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.38
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.38
PLN02256304 arogenate dehydrogenase 90.27
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 90.25
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 90.19
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 90.1
PTZ00117319 malate dehydrogenase; Provisional 89.9
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 89.86
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 89.86
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.79
PRK05562223 precorrin-2 dehydrogenase; Provisional 89.75
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 89.64
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 89.63
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 89.62
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 89.59
PRK11154708 fadJ multifunctional fatty acid oxidation complex 89.59
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 89.55
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.5
PRK12779944 putative bifunctional glutamate synthase subunit b 89.43
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 89.28
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.24
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.13
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 89.06
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 88.99
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 88.99
PRK12548289 shikimate 5-dehydrogenase; Provisional 88.86
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 88.79
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 88.74
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 88.72
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.67
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 88.65
PRK12814652 putative NADPH-dependent glutamate synthase small 88.57
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 88.5
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 88.49
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 88.3
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 88.27
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 88.23
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.18
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 88.03
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 88.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 87.98
PRK08328231 hypothetical protein; Provisional 87.95
>PLN02268 probable polyamine oxidase Back     alignment and domain information 
Probab=100.00  E-value=2.7e-57  Score=456.89  Aligned_cols=434  Identities=84%  Similarity=1.364  Sum_probs=364.4

Q ss_pred             CeEEEECCCHHHHHHHHHHHHCCCcEEEEeeCCCCCeeEEeecCCCcEeecCCceeeCCCCCCchHHHHHhcCCCeeecC
Q 010587           29 PSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTS  108 (506)
Q Consensus        29 ~dv~IIGaGiaGL~aA~~L~~~G~~V~vlE~~~~~GG~~~s~~~~g~~~d~G~~~~~~~~~~~~~~~l~~~lgl~~~~~~  108 (506)
                      ++|+|||||+|||+||+.|.+.|++|+|||+++|+|||+.|....|+.+|+|++|+++...++++.++++++|++..+..
T Consensus         1 ~~VvVIGaGisGL~aA~~L~~~g~~v~vlEa~~r~GGri~t~~~~g~~~d~G~~~i~~~~~~~~~~~l~~~lgl~~~~~~   80 (435)
T PLN02268          1 PSVIVIGGGIAGIAAARALHDASFKVTLLESRDRIGGRVHTDYSFGFPVDMGASWLHGVCNENPLAPLIGRLGLPLYRTS   80 (435)
T ss_pred             CCEEEECCCHHHHHHHHHHHhCCCeEEEEeCCCCCCceeeecCcCCcccCCCCeeEeccCCCchHHHHHHHhCCceEecc
Confidence            47999999999999999999999999999999999999999888899999999999864445678999999999987765


Q ss_pred             CCCcccccchhhhHHHHHHHHhhhccccceeecCCCCccCHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHc
Q 010587          109 GDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFD  188 (506)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~  188 (506)
                      ....+.+..+..               .+..+......+|......+...+.++.....+......++.|+.+++..++.
T Consensus        81 ~~~~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~  145 (435)
T PLN02268         81 GDNSVLYDHDLE---------------SYALFDMDGNQVPQELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLE  145 (435)
T ss_pred             CCcccccccccc---------------ccceecCCCCCCCHHHHHHHHHHHHHHHHHHHHHHhccCCCcCHHHHHHHHhh
Confidence            444443332211               23334455556777766666666766666666554445678899999887776


Q ss_pred             cCchhhhhhhHHHHHHHHHHhhhhcccCCcccccccccccccccCCCccccccchHHHHHHHhccCCeeeCCeeEEEEEc
Q 010587          189 RRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRH  268 (506)
Q Consensus       189 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~G~~~l~~~l~~g~~i~~~~~V~~I~~~  268 (506)
                      ..+.+...++.+++++++..++.++++.+++++|+..+.....+.+....+.+|+++++++|.++++|++|++|++|+..
T Consensus       146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~~~~~~~~~~g~~~~~~~G~~~l~~~l~~~~~i~~~~~V~~i~~~  225 (435)
T PLN02268        146 RHPELRLEGLAHEVLQWYLCRMEGWFAADADTISLKSWDQEELLEGGHGLMVRGYDPVINTLAKGLDIRLNHRVTKIVRR  225 (435)
T ss_pred             hCcccccchHHHHHHHHHHHHHHHHhCCChHhCchhhcCCccccCCCceeecCCHHHHHHHHhccCceeCCCeeEEEEEc
Confidence            55555566788888888888877888889999988766544444555667889999999999999999999999999999


Q ss_pred             CCcEEEEEcCCcEEEcCEEEEecChhhhhcCcccccCCCChHHHHHHHhcCCccccEEEEEeCCCCCCCCCcceeecCCC
Q 010587          269 YIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTS  348 (506)
Q Consensus       269 ~~~v~V~~~~G~~i~ad~VI~a~~~~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~g~~~~~~  348 (506)
                      +++|.|++.+|+++.||+||+|+|+..+....+.|.|+||+...+++.++.++...|+.+.|+++||++..+.|.+.+..
T Consensus       226 ~~~v~v~~~~g~~~~ad~VIva~P~~~l~~~~i~f~p~lp~~~~~ai~~~~~g~~~Kv~l~f~~~fw~~~~~~g~~~~~~  305 (435)
T PLN02268        226 YNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKFEPELPEWKEEAISDLGVGIENKIALHFDSVFWPNVEFLGVVAPTS  305 (435)
T ss_pred             CCcEEEEECCCcEEEcCEEEEecCHHHHhcCcceecCCCCHHHHHHHHhCCccceeEEEEEeCCCCCCCCceeeccCCCC
Confidence            89999999999889999999999999987666788899999999999999999999999999999999877777766554


Q ss_pred             CcceeeeccccCCCceEEEEEeccchhHHhhcCCHHHHHHHHHHHHHHHCCCCCCCcEEEecccCCCCCCCcccccCCCC
Q 010587          349 YGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVG  428 (506)
Q Consensus       349 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~e~~~~~~~~L~~~~p~~~~~~~~~~~~w~~~~~~~g~~~~~~~~  428 (506)
                      ..+.++.+.....+..+++.++.+..+..+.+++++++++.++++|.+++|...+|+.+..++|..+|++.|+|++..++
T Consensus       306 ~~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~~e~~~~v~~~L~~~~~~~~~p~~~~~~~W~~dp~~~G~~~~~~~g  385 (435)
T PLN02268        306 YGCSYFLNLHKATGHPVLVYMPAGRLARDIEKLSDEAAANFAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVG  385 (435)
T ss_pred             CCceEEEecccCCCCCEEEEEeccHHHHHHHhCCHHHHHHHHHHHHHHHcCCCCCccEEEecccCCCCCCCccCCCCCCC
Confidence            45555555544567778888888888888999999999999999999999987788999999999999999999988899


Q ss_pred             CChHHHHHhcCCCCceEeeccccCCcCcchhhHHHHHHHHHHHHHHHHH
Q 010587          429 KSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRV  477 (506)
Q Consensus       429 ~~~~~~~~~~~p~~~l~~aG~~~~~~~~g~~egA~~sG~~aA~~i~~~l  477 (506)
                      +....++.+++|+++|||||++++..+.|+||||+.||.+||++|++.|
T Consensus       386 ~~~~~~~~l~~p~~~l~FAGe~ts~~~~g~~eGA~~sG~raA~~v~~~l  434 (435)
T PLN02268        386 KPHDLYERLRAPVDNLFFAGEATSSDFPGSVHGAYSTGVMAAEECRMRL  434 (435)
T ss_pred             CCHHHHHHHhCCCCCeEEeeccCCCcccccHHHHHHHHHHHHHHHHHhh
Confidence            8888889999999999999999998888999999999999999999775

>PLN03000 amine oxidase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
2hko_A664 Crystal Structure Of Lsd1 Length = 664 8e-40
2iw5_A666 Structural Basis For Corest-dependent Demethylation 1e-39
2ejr_A662 Lsd1-Tranylcypromine Complex Length = 662 1e-39
2dw4_A660 Crystal Structure Of Human Lsd1 At 2.3 A Resolution 1e-39
2h94_A664 Crystal Structure And Mechanism Of Human Lysine-Spe 1e-39
2v1d_A730 Structural Basis Of Lsd1-Corest Selectivity In Hist 1e-39
4gu1_A784 Crystal Structure Of Lsd2 Length = 784 2e-39
4fwe_A796 Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup 2e-39
2xaf_A852 Crystal Structure Of Lsd1-Corest In Complex With Pa 2e-39
4gur_A776 Crystal Structure Of Lsd2-npac With H3 In Space Gro 2e-39
2x0l_A734 Crystal Structure Of A Neuro-Specific Splicing Vari 1e-36
1b37_A472 A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys 7e-31
3kpf_A478 X-Ray Structure Of The Mutant Lys300met Of Polyamin 3e-30
4gdp_A516 Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 1e-16
1z6l_A516 Crystal Structure Of Fms1 In Complex With Its Subst 1e-16
1yy5_A513 Crystal Structure Of Fms1, A Polyamine Oxidase From 2e-16
4ech_A516 Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 3e-16
1rsg_A516 Crystal Structure Of The Polyamine Oxidase Fms1 Fro 8e-16
2c72_A520 Functional Role Of The Aromatic Cage In Human Monoa 7e-15
1gos_A520 Human Monoamine Oxidase B Length = 520 7e-15
2xfu_A519 Human Monoamine Oxidase B With Tranylcypromine Leng 9e-15
2c75_A520 Functional Role Of The Aromatic Cage In Human Monoa 1e-14
2c73_A520 Functional Role Of The Aromatic Cage In Human Monoa 1e-14
2c76_A520 Functional Role Of The Aromatic Cage In Human Monoa 1e-14
2bk4_A520 Human Monoamine Oxidase B: I199f Mutant In Complex 3e-14
2xfo_A520 Tranylcypromine-Inhibited Human Monoamine Oxidase B 4e-14
3zyx_A519 Crystal Structure Of Human Monoamine Oxidase B In C 4e-13
2z5y_A513 Crystal Structure Of Human Monoamine Oxidase A (G11 5e-12
2bxr_A527 Human Monoamine Oxidase A In Complex With Clorgylin 7e-12
2z5x_A513 Crystal Structure Of Human Monoamine Oxidase A With 7e-12
1o5w_A534 The Structure Basis Of Specific Recognitions For Su 5e-10
4e0v_A497 Structure Of L-Amino Acid Oxidase From The B. Jarar 7e-10
3kve_A486 Structure Of Native L-Amino Acid Oxidase From Viper 1e-09
2vvm_A495 The Structure Of Mao-N-D5, A Variant Of Monoamine O 9e-08
3k7m_X431 Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase F 1e-07
3k7t_A425 Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine 1e-07
1reo_A486 L-Amino Acid Oxidase From Agkistrodon Halys Pallas 1e-07
2vvl_A495 The Structure Of Mao-N-D3, A Variant Of Monoamine O 2e-07
2vvl_G495 The Structure Of Mao-N-D3, A Variant Of Monoamine O 2e-07
2yg7_A453 Structure-Based Redesign Of Cofactor Binding In Put 1e-05
2yg3_A453 Structure-Based Redesign Of Cofactor Binding In Put 5e-05
2yg5_A453 Structure-Based Redesign Of Cofactor Binding In Put 8e-05
2yg6_A453 Structure-Based Redesign Of Cofactor Binding In Put 8e-05
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 4e-04
>pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 Back     alignment and structure 
Iteration: 1

 Score =  161 bits (407), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 155/532 (29%), Positives = 232/532 (43%), Gaps = 114/532 (21%)
Query: 47  LHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLHGVCQENPLAPVISRLGL---- 102
           L      V LLE+RDRVGGRV T     +  DLGA  + G+   NP+A V  ++ +    
Sbjct: 126 LQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG-NPMAVVSKQVNMELAK 184
Query: 103 -----PLYRTSGD--------------NSVL-----YDHDLE-RVLKTVVVSLIQANLCY 137
                PLY  +G               N +L       H L+  VL    VSL QA    
Sbjct: 185 IKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQA--LE 242
Query: 138 ALFDMDGNQVPQELV------TKVGEAFESILKE----TDKVREEHDE-----DMSIQRA 182
            +  +    V  E +       K  E  + +L +     +K++E H +     ++   R 
Sbjct: 243 VVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRD 302
Query: 183 ISIVF---------------------------DRRPELR--------LEGLAHKVLQWYL 207
           I+  F                           ++  EL         L     ++L W+ 
Sbjct: 303 ITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHF 362
Query: 208 CRMEGWFAADAETISLKSWDKEE--LLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKI 265
             +E   A    T+SLK WD+++     G H  +  GY  V   LA+GLDI+L   V ++
Sbjct: 363 ANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQV 422
Query: 266 TRHYIGVKV----TVEGGKTFV--ADAVVVAVPLGVLKAR--TIKFEPRLPDWKEAAIDD 317
                G +V    T    +TF+   DAV+  +PLGVLK +   ++F P LP+WK +A+  
Sbjct: 423 QYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQR 482
Query: 318 LGVGIENKIIMHFDKVFW-PNVEFLGVVSDTSYG---CSYFLNLHKATGHCVLVYMPAGQ 373
           +G G  NK+++ FD+VFW P+V   G V  T+        F NL+KA    +L+ + AG+
Sbjct: 483 MGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAP---ILLALVAGE 539
Query: 374 LARDIEKMSDEAAANFAFTQLKKILPDAS--SPIQYLVSHWGTDANSLGSYSYDTVGKSH 431
            A  +E +SD+         LK I   ++   P + +VS W  D  + GSYSY   G S 
Sbjct: 540 AAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSG 599
Query: 432 DLYERLRIPVD-------------NLFFAGEATSMSYPGSVHGAFSTGLMAA 470
           + Y+ +  P+               LFFAGE T  +YP +VHGA  +GL  A
Sbjct: 600 NDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREA 651
>pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 Back     alignment and structure
>pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 Back     alignment and structure
>pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 Back     alignment and structure
>pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 Back     alignment and structure
>pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 Back     alignment and structure
>pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 Back     alignment and structure
>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 Back     alignment and structure
>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 Back     alignment and structure
>pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 Back     alignment and structure
>pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 Back     alignment and structure
>pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 Back     alignment and structure
>pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 Back     alignment and structure
>pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 Back     alignment and structure
>pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 Back     alignment and structure
>pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 Back     alignment and structure
>pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 Back     alignment and structure
>pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 Back     alignment and structure
>pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 Back     alignment and structure
>pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 Back     alignment and structure
>pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 Back     alignment and structure
>pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 Back     alignment and structure
>pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 Back     alignment and structure
>pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 Back     alignment and structure
>pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 Back     alignment and structure
>pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 Back     alignment and structure
>pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 Back     alignment and structure
>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 Back     alignment and structure
>pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 Back     alignment and structure
>pdb|2VVM|A Chain A, The Structure Of Mao-N-D5, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 Back     alignment and structure
>pdb|3K7M|X Chain X, Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase From Arthrobacter Nicotinovorans Length = 431 Back     alignment and structure
>pdb|3K7T|A Chain A, Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine Oxidase, Crystal Form P3121 Length = 425 Back     alignment and structure
>pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 Back     alignment and structure
>pdb|2VVL|A Chain A, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 Back     alignment and structure
>pdb|2VVL|G Chain G, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger Length = 495 Back     alignment and structure
>pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 Back     alignment and structure
>pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 Back     alignment and structure
>pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 Back     alignment and structure
>pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query506
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 1e-130
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 1e-127
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 1e-125
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 1e-115
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 1e-107
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 1e-102
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 1e-100
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 7e-89
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 2e-88
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 2e-30
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 2e-84
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 6e-29
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 1e-27
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 3e-27
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 1e-26
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-26
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 1e-25
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 2e-25
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 2e-21
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 5e-20
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 3e-19
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 2e-17
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 3e-17
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 6e-15
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 2e-13
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 4e-13
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 7e-04
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 5e-11
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 3e-07
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 3e-07
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 6e-07
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 6e-07
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 7e-07
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 1e-06
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 3e-04
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-06
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-06
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 8e-04
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 3e-06
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 3e-06
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 5e-06
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 5e-06
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 7e-06
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 8e-06
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 9e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 9e-06
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 9e-06
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 9e-06
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 1e-05
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 1e-05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 2e-05
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 2e-05
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 2e-05
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 2e-05
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-05
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 3e-05
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 4e-05
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 4e-05
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 4e-05
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 6e-05
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 6e-05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 6e-05
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 6e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 7e-05
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 7e-05
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 7e-05
1ojt_A482 Surface protein; redox-active center, glycolysis, 8e-05
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 1e-04
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 1e-04
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 1e-04
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 2e-04
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 2e-04
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 2e-04
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 2e-04
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 2e-04
3atr_A453 Conserved archaeal protein; saturating double bond 4e-04
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 4e-04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 4e-04
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 5e-04
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 6e-04
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 7e-04
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 7e-04
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 8e-04
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
 Score =  385 bits (989), Expect = e-130
 Identities = 131/484 (27%), Positives = 207/484 (42%), Gaps = 53/484 (10%)

Query: 27  RSPSVIVIGAGMAGVAAARALHDASFK-VVLLESRDRVGGRVHTDYSFGFPVDLGASWLH 85
             P VIV+GAGM+G++AA+ L +A    +++LE+ D +GGR+H     G  V+LGA+W+ 
Sbjct: 3   VGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVE 62

Query: 86  GV--CQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMD 143
           GV   + NP+ P+++         S  + +  +   E                  ++D D
Sbjct: 63  GVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKED---------------GGVYDED 107

Query: 144 GNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVL 203
             Q   EL   V E  E    +          D     A+  + + +P          V+
Sbjct: 108 YVQKRIELADSVEEMGE----KLSATLHASGRDDMSILAMQRLNEHQPNGPAT-PVDMVV 162

Query: 204 QWYLCRMEGWFAADAETISLKSWDKEELLP--GGHGLMV---RGYLPVINTLAKGL---- 254
            +Y  + +  FA      SL++          G     V   RGY  V+  LA       
Sbjct: 163 DYY--KFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTD 220

Query: 255 ---------DIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEP 305
                     ++L   V +I     GV V  E    + AD V+V+  LGVL++  I+F+P
Sbjct: 221 DKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKP 280

Query: 306 RLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVE----FLGVVSDTSYGCSYFLNLHKAT 361
           +LP WK  AI    + +  KI + F + FWP  +    FL   S   Y   +     +  
Sbjct: 281 KLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYP 340

Query: 362 GHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILP--DASSPIQYLVSHWGTDANSL 419
              VL+     + +R IE+ SDE         L+K+ P  D       LV  W +D    
Sbjct: 341 DANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYK 400

Query: 420 GSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLE 479
           G++S   VG +   Y++LR PV  ++F GE TS  Y G VHGA+ +G+ +AE     ++ 
Sbjct: 401 GTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAE----ILIN 456

Query: 480 RYGE 483
              +
Sbjct: 457 CAQK 460
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Length = 443 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 100.0
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 100.0
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 100.0
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 100.0
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 100.0
4gut_A776 Lysine-specific histone demethylase 1B; histone de 100.0
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 100.0
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 100.0
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 100.0
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 100.0
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 100.0
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 100.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 100.0
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 100.0
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 100.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 100.0
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 100.0
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 100.0
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 100.0
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 100.0
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 100.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 100.0
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 100.0
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.97
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.96
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.94
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.93
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.92
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.91
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.86
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.83
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.8
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.8
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.78
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.63
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.49
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.47
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.46
1vg0_A650 RAB proteins geranylgeranyltransferase component A 99.46
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.46
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.43
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.42
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.41
3dme_A369 Conserved exported protein; structural genomics, P 99.41
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.4
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.39
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.39
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.38
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.38
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.38
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.37
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.36
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.35
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.34
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.32
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.31
3atr_A453 Conserved archaeal protein; saturating double bond 99.27
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.21
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.2
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.2
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.19
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.19
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.19
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.19
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.18
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.18
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.18
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.17
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.16
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.16
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.16
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.15
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.14
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.14
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.13
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.12
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.11
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.1
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.1
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.09
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.08
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.08
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.07
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.07
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.05
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.04
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.03
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.01
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.0
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.98
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.98
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.97
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.97
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.96
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.95
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.92
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.91
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.9
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.9
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.89
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.88
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.88
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.87
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.87
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.87
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.86
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.86
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.86
2bry_A497 NEDD9 interacting protein with calponin homology a 98.86
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.86
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.86
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.85
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.84
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.83
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.82
2cul_A232 Glucose-inhibited division protein A-related PROT 98.8
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.8
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.79
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.78
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.78
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.76
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.75
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.74
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.74
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.72
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.72
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.72
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.71
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.71
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.71
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.7
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.7
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.69
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.69
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.68
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.66
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.66
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.65
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.63
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.61
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.61
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.57
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.57
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.55
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.53
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.5
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.5
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.49
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.48
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.47
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.47
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.42
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.41
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.38
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.38
4dna_A463 Probable glutathione reductase; structural genomic 98.37
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.37
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.36
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.33
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.33
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.31
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.31
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.28
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.28
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.27
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.27
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.27
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.27
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.26
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.26
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.23
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.22
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.22
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.22
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.22
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.2
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.2
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.2
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.19
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.19
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.18
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.17
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.16
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.16
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.15
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.15
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.13
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.13
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.1
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.09
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.08
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.07
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.06
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.05
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.04
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.02
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.02
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.99
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.98
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.98
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.98
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.97
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.97
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.97
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.96
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.96
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.95
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.95
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.94
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.94
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.93
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.93
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.92
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.92
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.92
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.9
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.9
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.9
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.9
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.89
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.88
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.88
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.87
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.86
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.84
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.84
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.83
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.82
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.81
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.81
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.8
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.8
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.78
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.77
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.77
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.76
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.73
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.73
4dna_A463 Probable glutathione reductase; structural genomic 97.72
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.72
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 97.67
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.67
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.65
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.64
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.62
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.58
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.56
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.54
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.52
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.51
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.5
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.5
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.5
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.47
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.45
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.44
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.41
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 97.37
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.36
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.35
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.34
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.32
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.32
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.29
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.28
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.23
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.2
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.2
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.14
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.09
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.08
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.05
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.03
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.99
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.91
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.88
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.76
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.69
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.65
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.28
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.18
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.17
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.06
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.93
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.93
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.85
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 95.66
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.61
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.38
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.36
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.28
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.13
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.08
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 95.06
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.0
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.96
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.91
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.84
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.73
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.69
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.66
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.66
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.65
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 94.51
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 94.51
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.51
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.49
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 94.48
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.45
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 94.43
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 94.37
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.36
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.34
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 94.31
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.27
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.24
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.24
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.17
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.15
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.08
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.05
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.04
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 94.02
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 93.98
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.97
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 93.97
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.96
3qha_A296 Putative oxidoreductase; seattle structural genomi 93.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 93.94
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 93.8
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 93.71
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.67
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 93.67
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 93.58
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 93.55
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 93.51
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 93.51
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.5
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 93.49
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 93.47
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 93.21
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 93.19
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 93.14
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 93.13
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.09
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.05
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.04
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 93.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.99
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.99
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 92.96
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 92.85
1vpd_A299 Tartronate semialdehyde reductase; structural geno 92.76
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.75
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.74
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 92.69
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 92.65
4ezb_A317 Uncharacterized conserved protein; structural geno 92.65
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.62
3l6d_A306 Putative oxidoreductase; structural genomics, prot 92.6
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.57
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 92.55
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.53
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 92.51
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.39
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 92.37
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 92.28
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.27
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 92.13
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.13
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 92.1
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 92.09
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 92.08
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 92.04
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 92.01
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.99
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 91.88
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 91.84
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 91.84
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 91.78
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 91.71
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 91.69
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 91.68
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 91.67
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 91.63
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 91.59
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 91.57
3ius_A286 Uncharacterized conserved protein; APC63810, silic 91.55
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.54
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 91.53
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 91.48
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.43
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.42
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 91.39
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 91.35
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 91.33
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 91.29
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 91.25
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 91.22
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 91.22
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 91.07
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 91.02
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 91.01
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 90.97
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 90.93
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 90.93
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.92
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 90.87
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 90.83
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 90.81
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 90.81
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 90.81
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 90.77
2rir_A300 Dipicolinate synthase, A chain; structural genomic 90.76
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 90.73
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 90.73
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.73
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 90.68
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 90.6
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 90.57
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 90.56
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 90.55
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 90.54
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 90.48
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 90.34
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 90.3
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 90.19
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 90.15
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 90.14
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 90.12
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 90.04
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 90.04
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 90.01
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 90.0
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 89.96
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 89.94
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 89.92
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 89.9
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 89.89
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 89.8
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 89.63
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 89.59
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.56
1yb4_A295 Tartronic semialdehyde reductase; structural genom 89.48
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 89.39
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 89.32
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 89.16
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 89.12
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 89.08
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 89.03
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 89.0
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 88.95
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 88.9
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 88.84
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 88.81
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 88.81
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 88.81
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 88.78
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 88.76
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 88.73
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 88.67
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 88.65
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 88.44
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 88.44
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 88.42
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 88.13
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 88.1
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 88.09
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 87.97
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 87.93
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 87.93
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 87.91
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 87.85
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 87.81
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 87.77
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.76
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 87.67
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 87.48
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 87.42
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 87.31
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.3
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 87.26
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.21
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 87.13
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 87.06
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 87.04
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 86.98
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 87.0
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 87.0
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 86.93
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 86.82
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 86.74
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 86.57
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 86.55
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 86.54
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 86.47
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 86.43
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 86.39
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
Probab=100.00  E-value=1.8e-45  Score=379.05  Aligned_cols=422  Identities=22%  Similarity=0.283  Sum_probs=302.9

Q ss_pred             CCCCeEEEECCCHHHHHHHHHHHHCCCcEEEEeeCCCCCeeEEeecCC-CcEeecCCceeeCCCCCCchHHHHHhcCCCe
Q 010587           26 ARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSF-GFPVDLGASWLHGVCQENPLAPVISRLGLPL  104 (506)
Q Consensus        26 ~~~~dv~IIGaGiaGL~aA~~L~~~G~~V~vlE~~~~~GG~~~s~~~~-g~~~d~G~~~~~~~~~~~~~~~l~~~lgl~~  104 (506)
                      .+++||+|||||++||+||++|++.|++|+|||+++++||+++|.+.. |+.+|.|++++++.  +..+.++++++|++.
T Consensus         2 ~~~~~vvIIGaG~aGL~aA~~L~~~G~~V~vlE~~~~~GGr~~t~~~~~g~~~d~G~~~~~~~--~~~~~~l~~~lgl~~   79 (520)
T 1s3e_A            2 SNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPT--QNRILRLAKELGLET   79 (520)
T ss_dssp             -CBCSEEEECCBHHHHHHHHHHHHTTCCEEEECSSSSSBTTCCEECCTTTSCEESSCCEECTT--CHHHHHHHHHTTCCE
T ss_pred             CCCceEEEECCCHHHHHHHHHHHHCCCCEEEEeCCCCCCCceeecccCCCcccccCceEecCC--cHHHHHHHHHcCCcc
Confidence            356899999999999999999999999999999999999999998885 99999999999743  567889999999986


Q ss_pred             eecCCCCcc-cccchhhhHHHHHHHHhhhccccceeecC-CCCccCHHHHHHHHHHHHHHHHHHHHHhh---------cC
Q 010587          105 YRTSGDNSV-LYDHDLERVLKTVVVSLIQANLCYALFDM-DGNQVPQELVTKVGEAFESILKETDKVRE---------EH  173 (506)
Q Consensus       105 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~  173 (506)
                      ......... .+..+.                . ..+.. ......+.....+...+..+......+..         ..
T Consensus        80 ~~~~~~~~~~~~~~g~----------------~-~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  142 (520)
T 1s3e_A           80 YKVNEVERLIHHVKGK----------------S-YPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAPLAEE  142 (520)
T ss_dssp             EECCCSSEEEEEETTE----------------E-EEECSSSCCCCSHHHHHHHHHHHHHHHHHHTTSCTTCGGGSTTHHH
T ss_pred             eecccCCceEEEECCE----------------E-EEecCCCCCCCCHHHHHHHHHHHHHHHHHHhhcCcCCCccccchhh
Confidence            553322211 111111                0 01111 01101111111111111111111110000         00


Q ss_pred             CCCCCHHHHHHHHHccCchhhhhhhHHHHHHHHHHhh-hhcccCCcccccccccccccc------------cCCCccccc
Q 010587          174 DEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRM-EGWFAADAETISLKSWDKEEL------------LPGGHGLMV  240 (506)
Q Consensus       174 ~~~~s~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~~s~~~~~~~~~------------~~~~~~~~~  240 (506)
                      ..+.++.+++.+...           .+.++.++.++ ...++.++.++++..+.....            -.+....+.
T Consensus       143 ~~~~s~~~~l~~~~~-----------~~~~~~~~~~~~~~~~g~~~~~~s~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~  211 (520)
T 1s3e_A          143 WDNMTMKELLDKLCW-----------TESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFV  211 (520)
T ss_dssp             HHTSBHHHHHHHHCS-----------SHHHHHHHHHHHHHHHSSCTTTSBHHHHHHHHHTTTCHHHHHCSTTSTTSEEET
T ss_pred             hhccCHHHHHHhhCC-----------CHHHHHHHHHHHhhhcCCChHHhHHHHHHHHHhhcCchhhhcccCCCcceEEEe
Confidence            235677777764322           12223344443 456677777777654321100            012235789


Q ss_pred             cchHHHHHHHhc--cCCeeeCCeeEEEEEcCCcEEEEEcCCcEEEcCEEEEecChhhhhcCcccccCCCChHHHHHHHhc
Q 010587          241 RGYLPVINTLAK--GLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDL  318 (506)
Q Consensus       241 ~G~~~l~~~l~~--g~~i~~~~~V~~I~~~~~~v~V~~~~G~~i~ad~VI~a~~~~~~~~~~~~~~~~lp~~~~~~~~~~  318 (506)
                      +|++.++++|.+  |++|++|++|++|+.+++++.|++.+|++++||+||+|+|+..+..+  .+.|+||+...+.+.++
T Consensus       212 gG~~~l~~~l~~~lg~~i~~~~~V~~i~~~~~~v~v~~~~g~~~~ad~VI~a~p~~~l~~l--~~~p~lp~~~~~~i~~~  289 (520)
T 1s3e_A          212 GGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMKI--HFNPPLPMMRNQMITRV  289 (520)
T ss_dssp             TCTHHHHHHHHHHHGGGEESSCCEEEEECSSSSEEEEETTSCEEEESEEEECSCGGGGGGS--EEESCCCHHHHHHTTSC
T ss_pred             CCHHHHHHHHHHHcCCcEEcCCeeEEEEECCCeEEEEECCCeEEEeCEEEECCCHHHHcce--eeCCCCCHHHHHHHHhC
Confidence            999999999987  88999999999999988889999999989999999999999987653  46789999999999999


Q ss_pred             CCccccEEEEEeCCCCCCCCCcceeec--CC-CCcceeeeccccCCCceEEEEEeccchhHHhhcCCHHHHHHHHHHHHH
Q 010587          319 GVGIENKIIMHFDKVFWPNVEFLGVVS--DT-SYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLK  395 (506)
Q Consensus       319 ~~~~~~~v~~~~~~~~~~~~~~~g~~~--~~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~e~~~~~~~~L~  395 (506)
                      +++...|+++.|++++|++..+.|.+.  +. ......+.....+.+..+++.++.+..+..|.+++++++++.++++|.
T Consensus       290 ~~~~~~kv~l~~~~~~w~~~~~~g~~~~~~~~~~~~~~~d~~~~~~~~~~l~~~~~~~~a~~~~~~~~~e~~~~vl~~L~  369 (520)
T 1s3e_A          290 PLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYA  369 (520)
T ss_dssp             CBCCEEEEEEECSSCGGGGGTEEEEEEECSTTCSCSEEEECCCTTSCSCEEEEEEETHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred             CCcceEEEEEEeCCCcccCCCCCceeeccCCCCceEEEeeCCCCCCCCCEEEEEccchhhhhhhcCCHHHHHHHHHHHHH
Confidence            999999999999999998665555432  22 222233333322333477888888877788889999999999999999


Q ss_pred             HHCCC--CCCCcEEEecccCCCCCCCcccc-cCCCCCChHHHHHhcCCCCceEeeccccCCcCcchhhHHHHHHHHHHHH
Q 010587          396 KILPD--ASSPIQYLVSHWGTDANSLGSYS-YDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAED  472 (506)
Q Consensus       396 ~~~p~--~~~~~~~~~~~w~~~~~~~g~~~-~~~~~~~~~~~~~~~~p~~~l~~aG~~~~~~~~g~~egA~~sG~~aA~~  472 (506)
                      ++||.  ..+|..+...+|..+++..|+|. +..+++...+.+.+++|++||||||++++..++|+++||+.||.+||++
T Consensus       370 ~~~~~~~~~~p~~~~~~~W~~~~~~~G~~~~~~~~g~~~~~~~~l~~p~~~L~fAG~~t~~~~~g~v~GAi~SG~~aA~~  449 (520)
T 1s3e_A          370 KVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAARE  449 (520)
T ss_dssp             HHHTCGGGGCCSEEEEEEGGGCTTTCSSSCBCCCTTHHHHHGGGTTCCBTTEEECSGGGCSSSTTSHHHHHHHHHHHHHH
T ss_pred             HHhCccccCCccEEEEEeeCCCCCCCCCCccccCCCccccchHHHhCCCCCEEEeehhhcCcCcEEhHHHHHHHHHHHHH
Confidence            99985  35788899999999999999887 5667776666677899999999999999876779999999999999999


Q ss_pred             HHHHHHH
Q 010587          473 CRMRVLE  479 (506)
Q Consensus       473 i~~~l~~  479 (506)
                      |++.+..
T Consensus       450 i~~~l~~  456 (520)
T 1s3e_A          450 ILHAMGK  456 (520)
T ss_dssp             HHHHTTS
T ss_pred             HHHHHhc
Confidence            9887643
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 506
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 5e-49
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 6e-44
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 3e-32
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-07
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-28
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 5e-27
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 3e-23
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 5e-22
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 2e-19
d2v5za2112 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H 2e-18
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-17
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 3e-16
d2iida2113 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan 4e-16
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 3e-13
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 2e-11
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 7e-09
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 1e-07
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-07
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 5e-07
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-06
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-06
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 2e-06
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 3e-06
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 5e-06
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 6e-06
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 1e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-05
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 2e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-05
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 2e-05
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 3e-05
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 3e-05
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 4e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 4e-05
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 4e-05
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 7e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 1e-04
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 1e-04
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 1e-04
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-04
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 3e-04
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 3e-04
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 4e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-04
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 5e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 5e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 6e-04
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 6e-04
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 6e-04
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 7e-04
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 7e-04
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 8e-04
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 8e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 8e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 0.001
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.001
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 0.001
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.001
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 0.002
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 0.002
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 0.002
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.002
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 0.003
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.003
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.003
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 0.004
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  172 bits (436), Expect = 5e-49
 Identities = 83/478 (17%), Positives = 156/478 (32%), Gaps = 55/478 (11%)

Query: 26  ARSPSVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDYSFGFPVDLGASWLH 85
            ++  VI+IG+G++G+AAAR L      V LLE+RDRVGGRV T     +  DLGA  + 
Sbjct: 3   KKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVT 62

Query: 86  GVCQENPLAPVISRLGLPLYRTSGDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGN 145
           G    NP+A V  ++ + L +                                L++ +G 
Sbjct: 63  G-LGGNPMAVVSKQVNMELAKIKQK--------------------------CPLYEANGQ 95

Query: 146 QVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISI-----VFDRRPELRLEGLAH 200
            VP+E    V + F  +L+ T  +  + D ++   + +S+     V  +  E  ++    
Sbjct: 96  AVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQI 155

Query: 201 KVLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLA----KGLDI 256
           +  +  +   E       + ++LK   KE          V+    +              
Sbjct: 156 EHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLT 215

Query: 257 RLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAID 316
            L     ++      ++  ++  +      V ++     +                + + 
Sbjct: 216 ALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLS 275

Query: 317 DLGVGIENKIIMHFDKVFWPN----VEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAG 372
                 ++        +   N    V             +    +      C ++ +   
Sbjct: 276 LKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTR 335

Query: 373 QLARDIEKMSDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYS--------- 423
             ++      D          LK+  P         +  W T A      +         
Sbjct: 336 STSQTFIYKCDAVLCTLPLGVLKQQPPAV--QFVPPLPEWKTSAVQRMVAAGSSGNDYDL 393

Query: 424 YDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERY 481
                           P+  LFFAGE T  +YP +VHGA  +GL  A     R+ +++
Sbjct: 394 MAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAG----RIADQF 447
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query506
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.97
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.96
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.95
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.94
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.9
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.89
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.85
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.82
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.76
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.71
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.61
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.61
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.54
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.52
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.41
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.4
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.39
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.37
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.31
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.3
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.28
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.15
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.11
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.06
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.05
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.04
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.04
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 99.04
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.03
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.03
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.02
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.02
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.02
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.96
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.95
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.94
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.94
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.93
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.92
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.88
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.88
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.88
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.87
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.87
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.86
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.84
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.83
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.82
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.81
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.8
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.79
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.79
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.77
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.76
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.76
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.76
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.75
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.74
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.74
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 98.74
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.73
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.69
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.67
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.65
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.64
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.63
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.6
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.6
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.56
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.55
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.54
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.54
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.54
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.53
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.53
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.49
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.46
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.39
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.36
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.36
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.31
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.24
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.21
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.16
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.08
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.02
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.02
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.99
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.84
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.82
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.75
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.6
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.45
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.28
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.2
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.18
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.16
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.16
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.01
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.0
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.62
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.61
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.57
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.53
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.38
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.18
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.18
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.06
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.0
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.96
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.91
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.75
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.74
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.73
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.66
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.56
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.48
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.2
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 94.71
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.66
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.65
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.63
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.62
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 94.51
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.35
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 94.33
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.3
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.27
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 94.2
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.11
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 93.94
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.92
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.91
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.86
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.75
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.71
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.56
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.39
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 93.28
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.21
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.19
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.14
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 93.11
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.11
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.72
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.65
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.64
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.6
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.53
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.0
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.68
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.66
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.47
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.26
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 91.15
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.08
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 90.78
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.53
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.25
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 90.23
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.16
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 90.11
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 90.09
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.04
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.92
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.67
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 89.66
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.25
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.2
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 89.08
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.88
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 88.8
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.4
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.37
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.0
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.97
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.81
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.63
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 86.94
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.88
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 86.62
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 85.8
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.65
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.85
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 84.55
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 84.34
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 83.71
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.31
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.75
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 81.4
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.85
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 80.52
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 80.24
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2.6e-29  Score=245.05  Aligned_cols=255  Identities=23%  Similarity=0.299  Sum_probs=156.1

Q ss_pred             eEEEECCCHHHHHHHHHHHHCCCcEEEEeeCCCCCeeEEeec-CCCcEeecCCceeeCCCCCCchHHHHHhcCCCeeecC
Q 010587           30 SVIVIGAGMAGVAAARALHDASFKVVLLESRDRVGGRVHTDY-SFGFPVDLGASWLHGVCQENPLAPVISRLGLPLYRTS  108 (506)
Q Consensus        30 dv~IIGaGiaGL~aA~~L~~~G~~V~vlE~~~~~GG~~~s~~-~~g~~~d~G~~~~~~~~~~~~~~~l~~~lgl~~~~~~  108 (506)
                      ||+|||||++||+||++|+++|++|+||||++++||++.|.. .+|+.+|+|++++++  .+..+.++++++|++.....
T Consensus         1 DViVIGaG~aGL~aA~~L~~~G~~V~VlE~~~~~GGr~~t~~~~~g~~~d~G~~~~~~--~~~~~~~l~~~lgl~~~~~~   78 (383)
T d2v5za1           1 DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGP--TQNRILRLAKELGLETYKVN   78 (383)
T ss_dssp             SEEEECCBHHHHHHHHHHHHTTCCEEEEESSSSSBTTCCEECCTTTSCEESSCCEECT--TCHHHHHHHHHTTCCEEECC
T ss_pred             CEEEECCCHHHHHHHHHHHhCCCCEEEEecCCCCcceeeEEECCCCcEEeCCceEeCC--CChHHHHHHHHcCCcceecc
Confidence            899999999999999999999999999999999999999876 468899999999974  45678999999999877655


Q ss_pred             CCCcccccchhhhHHHHHHHHhhhccccceeecCCCCccCHHHHHHHHHHHHHHHHHH-HHHhhc---------CCCCCC
Q 010587          109 GDNSVLYDHDLERVLKTVVVSLIQANLCYALFDMDGNQVPQELVTKVGEAFESILKET-DKVREE---------HDEDMS  178 (506)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~---------~~~~~s  178 (506)
                      ......+..+..               . ..+..................+....... ......         .....+
T Consensus        79 ~~~~~~~~~~~~---------------~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  142 (383)
T d2v5za1          79 EVERLIHHVKGK---------------S-YPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAPLAEEWDNMT  142 (383)
T ss_dssp             CSSEEEEEETTE---------------E-EEECSSSCCCCSHHHHHHHHHHHHHHHHHHTTSCTTCGGGSTTHHHHHTSB
T ss_pred             CccceEEecCcc---------------c-ccccccccchhhhhhhhhHHHHHHHHHHhhhhcccccccchhhhhhhhhhH
Confidence            444433332211               1 11111111111121111111111111111 111100         011234


Q ss_pred             HHHHHHHHHccCchhhhhhhHHHHHHHHHHhhhhcccCCcccccccccc------------cccccCCCccccccchHHH
Q 010587          179 IQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISLKSWD------------KEELLPGGHGLMVRGYLPV  246 (506)
Q Consensus       179 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~------------~~~~~~~~~~~~~~G~~~l  246 (506)
                      +.+++......       .....+...+   ............+.....            ...........+.++++.+
T Consensus       143 ~~~~~~~~~~~-------~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  212 (383)
T d2v5za1         143 MKELLDKLCWT-------ESAKQLATLF---VNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQV  212 (383)
T ss_dssp             HHHHHHHHCSS-------HHHHHHHHHH---HHHHHSSCTTTSBHHHHHHHHHTTTCHHHHHCSTTSTTSEEETTCTHHH
T ss_pred             HHHHHHHhccc-------hHHHHHHHHh---hhhhhccccchhhHHHHHHHHHhhcccccccccccCcceeeeccchhHH
Confidence            44444322111       0111111111   111122222222211110            0111223345678899999


Q ss_pred             HHHHhc--cCCeeeCCeeEEEEEcCCcEEEEEcCCcEEEcCEEEEecChhhhhcCcccccCCCChHHHHH
Q 010587          247 INTLAK--GLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAA  314 (506)
Q Consensus       247 ~~~l~~--g~~i~~~~~V~~I~~~~~~v~V~~~~G~~i~ad~VI~a~~~~~~~~~~~~~~~~lp~~~~~~  314 (506)
                      .+++.+  |++|++|++|++|+.++++|.|++.+|++++||+||+|+|+..+..  +.+.|+||+...+.
T Consensus       213 ~~~l~~~~g~~i~~~~~v~~I~~~~~~v~v~~~~g~~~~ad~vI~a~p~~~~~~--~~~~p~l~~~~~~~  280 (383)
T d2v5za1         213 SERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEAKYVISAIPPTLGMK--IHFNPPLPMMRNQM  280 (383)
T ss_dssp             HHHHHHHHGGGEEESCCEEEEECSSSSEEEEETTSCEEEESEEEECSCGGGGGG--SEEESCCCHHHHHH
T ss_pred             HHHHHHHcCCeEEecCcceEEEecCCeEEEEECCCCEEECCEEEECCCHHHHhh--CccCCCCCHHHHHH
Confidence            998865  8899999999999999999999999999999999999999988763  35677777665543
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure