Citrus Sinensis ID: 010658
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 505 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FGD7 | 765 | Putative U-box domain-con | no | no | 0.877 | 0.579 | 0.444 | 1e-108 | |
| Q8GUH1 | 834 | U-box domain-containing p | no | no | 0.887 | 0.537 | 0.222 | 4e-13 | |
| Q94A51 | 805 | U-box domain-containing p | no | no | 0.324 | 0.203 | 0.248 | 2e-08 | |
| Q9LQ92 | 308 | U-box domain-containing p | no | no | 0.297 | 0.487 | 0.261 | 2e-07 | |
| Q8GZ84 | 435 | U-box domain-containing p | no | no | 0.275 | 0.319 | 0.285 | 4e-07 | |
| P0C6E7 | 568 | Putative U-box domain-con | no | no | 0.287 | 0.255 | 0.303 | 6e-07 | |
| Q9FKG6 | 845 | U-box domain-containing p | no | no | 0.887 | 0.530 | 0.224 | 3e-05 | |
| Q683D5 | 400 | U-box domain-containing p | no | no | 0.245 | 0.31 | 0.264 | 5e-05 | |
| Q9SW11 | 835 | U-box domain-containing p | no | no | 0.302 | 0.183 | 0.245 | 0.0009 |
| >sp|Q9FGD7|PUB50_ARATH Putative U-box domain-containing protein 50 OS=Arabidopsis thaliana GN=PUB50 PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 392 bits (1007), Expect = e-108, Method: Compositional matrix adjust.
Identities = 222/499 (44%), Positives = 315/499 (63%), Gaps = 56/499 (11%)
Query: 7 KVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATSLSD 66
KVY+AVGND+Q+GY+T+ W ++KW ISIV+LH+ NIS +DFVYTPFGKLPA+S+S+
Sbjct: 21 KVYIAVGNDVQEGYKTIHWALKKWNNIPISIVLLHLC-NIS-QDFVYTPFGKLPASSVSE 78
Query: 67 EKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITKLVM 126
EKL++L+KYE K D LLSKY+ FCGKV +
Sbjct: 79 EKLQVLRKYEDQKIDKLLSKYITFCGKV-----------------------------CPL 109
Query: 127 GLSFMIPSAGKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQGVKF 186
++F++ GKS++A+SGS++V+ + P++CE +IICGGK+VSLK +D
Sbjct: 110 SVNFVL--FGKSKSAISGSFYVYQNKPEFCEFYIICGGKMVSLK---------NDVNNNN 158
Query: 187 AKMRERVNFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRSTWENCVQEIEIYFQHLA 246
+ +R + KMF GRN +R S G + D S S+W+ +QEIE YFQ L
Sbjct: 159 SNIRSWIG------KMFHDPGRNLDR----SSGNNDDPTASGSSWDKNLQEIENYFQQLL 208
Query: 247 SFNLDDASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINEAREMIRLKKKE 306
S NL + E + + + + + + A + +M VAE+ E+++ K+NEA+ MI K +E
Sbjct: 209 SLNL---AEEETENVVEEEQEDDDDVALNVLQHMDVAEKLEYVRRKVNEAKLMIDEKSRE 265
Query: 307 TKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQSCEVIRDVEES 366
K +AER +A+WAI LCNSR + E+ KE+ R ++Q LDS KE E VE+
Sbjct: 266 VKVNAERSNRAEWAISLCNSRIGEFEAWIKEESERREKLQATLDSDKECIEEAKNYVEKG 325
Query: 367 KNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEELRRQRDVLHRRI 426
K +L SL ELQ LS+K++ AK AE +LE+ V+ R E++ +IE+LR QRDV +RRI
Sbjct: 326 KTKLHSLAELQEVLSSKVKTMMEAKSQAEVELERVVLQRGEMITEIEKLRSQRDVFNRRI 385
Query: 427 EFCKEKDAIGMVIRSSELSCAFREYAAEDIRLATEDFSERFRLKCAGDWTNVYRGRLNHA 486
EFCKE++ IG V + E+ C +REY AEDIRLATE +S+R RLK G+WTNVYRGR+ H
Sbjct: 386 EFCKEREVIGSVSK-EEVKCGYREYVAEDIRLATETYSDRLRLKSGGNWTNVYRGRIKHT 444
Query: 487 SVAIKTLNNGLSEEDFQAK 505
+VA+K + + LS+E F AK
Sbjct: 445 TVAVKVIGDSLSDEAFGAK 463
|
Functions as an E3 ubiquitin ligase. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q8GUH1|PUB33_ARATH U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q94A51|PUB32_ARATH U-box domain-containing protein 32 OS=Arabidopsis thaliana GN=PUB32 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LQ92|PUB54_ARATH U-box domain-containing protein 54 OS=Arabidopsis thaliana GN=PUB54 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GZ84|PUB36_ARATH U-box domain-containing protein 36 OS=Arabidopsis thaliana GN=PUB36 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P0C6E7|PUB55_ARATH Putative U-box domain-containing protein 55 OS=Arabidopsis thaliana GN=PUB55 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FKG6|PUB52_ARATH U-box domain-containing protein 52 OS=Arabidopsis thaliana GN=PUB52 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q683D5|PUB37_ARATH U-box domain-containing protein 37 OS=Arabidopsis thaliana GN=PUB37 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SW11|PUB35_ARATH U-box domain-containing protein 35 OS=Arabidopsis thaliana GN=PUB35 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 505 | ||||||
| 356497691 | 803 | PREDICTED: putative U-box domain-contain | 0.982 | 0.617 | 0.562 | 1e-155 | |
| 356529687 | 802 | PREDICTED: putative U-box domain-contain | 0.982 | 0.618 | 0.554 | 1e-154 | |
| 296080877 | 620 | unnamed protein product [Vitis vinifera] | 0.988 | 0.804 | 0.550 | 1e-154 | |
| 357485505 | 808 | U-box domain-containing protein [Medicag | 0.984 | 0.615 | 0.544 | 1e-148 | |
| 449451595 | 806 | PREDICTED: putative U-box domain-contain | 0.982 | 0.615 | 0.503 | 1e-132 | |
| 240256481 | 791 | U-box domain-containing protein kinase f | 0.926 | 0.591 | 0.482 | 1e-117 | |
| 449499876 | 775 | PREDICTED: putative U-box domain-contain | 0.920 | 0.6 | 0.458 | 1e-112 | |
| 255586647 | 724 | ATP binding protein, putative [Ricinus c | 0.813 | 0.567 | 0.495 | 1e-112 | |
| 359497293 | 584 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.837 | 0.724 | 0.494 | 1e-111 | |
| 297797581 | 767 | kinase family protein [Arabidopsis lyrat | 0.879 | 0.578 | 0.452 | 1e-108 |
| >gi|356497691|ref|XP_003517693.1| PREDICTED: putative U-box domain-containing protein 50-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 553 bits (1426), Expect = e-155, Method: Compositional matrix adjust.
Identities = 282/501 (56%), Positives = 375/501 (74%), Gaps = 5/501 (0%)
Query: 7 KVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATSLSD 66
K+YVAVGND+QDGY+TL+W ++KW + ISIVILH+T+N S KD+V+TPFGKLPA S+S+
Sbjct: 8 KIYVAVGNDVQDGYKTLNWALKKWNSHPISIVILHLTHN-STKDYVHTPFGKLPARSVSE 66
Query: 67 EKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLTITKLVM 126
EKL+IL+K EQ K + LLSKY+ FCGKV AEIL+VEK DEP+ K ++DL+ L ITKLVM
Sbjct: 67 EKLQILRKDEQDKINKLLSKYIAFCGKVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVM 126
Query: 127 GLSFMIPSA-GKSRTAVSGSYFVHHHMPDYCELFIICGGKLVSLKGENDEGIMEDDQGVK 185
G SFM PS KS+ A++G + VH P +CELF+ICGGK V L+G+NDE IMEDDQGV
Sbjct: 127 GFSFMKPSMYWKSKGAINGLFHVHEQKPSFCELFVICGGKQVFLRGKNDEKIMEDDQGVM 186
Query: 186 FAKMRERVNFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRSTWENCVQEIEIYFQHL 245
A+MR+++ F + K F + + +SP +R+ WE +QEIE Y+Q L
Sbjct: 187 VARMRDKITFKDWLDKWFKDKTNDSQDRIASLSSSNLESPVNRNQWEFYLQEIENYYQEL 246
Query: 246 ASFNLDDASNSEDGDEILQTRAIEPNAAEQIDSNMSVAERTEFMKSKINEAREMIRLKKK 305
S ++ S ++ D+ Q IEP+ EQ + NMS AE+ E +K+K+NE ++ I+LK+K
Sbjct: 247 LSSKPEEGSCVQENDDS-QIGPIEPHVTEQNNYNMSTAEKIEILKNKLNEGQKTIQLKRK 305
Query: 306 ETKDDAERCAKAKWAICLCNSRADQLESLTKEDVASRMEIQRDLDSLKEQSCEVIRDVEE 365
E KD+ ER KA+WAICLCNSRA++LES +E+V++R E++++ D+ KEQ+ E+ +VEE
Sbjct: 306 EAKDNIERHTKAEWAICLCNSRAEELESRIREEVSAREELKKESDAEKEQTEEMRTEVEE 365
Query: 366 SKNRLSSLIELQSELSNKLQLSTMAKGHAEAQLEKAVIARAEIVKDIEELRRQRDVLHRR 425
K RLSSL E+QSELSN+LQ+ T+AK AE QLEKAV R E+ ++IEELRRQRDVL+RR
Sbjct: 366 RKRRLSSLTEVQSELSNRLQIWTLAKIRAETQLEKAVGERREMGREIEELRRQRDVLNRR 425
Query: 426 IEFCKEKDAIGMVIRSSELS-CAFREYAAEDIRLATEDFSERFRLKCAGDWTNVYRGRLN 484
IEFCK+KDAIGM R +E + CAFREY E++RLAT++FSER RLK GDWTNVYRGR N
Sbjct: 426 IEFCKQKDAIGMAARLAETTFCAFREYTEEELRLATDNFSERLRLKSGGDWTNVYRGRFN 485
Query: 485 HASVAIKTLNNGLSEEDFQAK 505
H++VAIK L + LS + FQ+K
Sbjct: 486 HSTVAIKMLPS-LSPQHFQSK 505
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356529687|ref|XP_003533420.1| PREDICTED: putative U-box domain-containing protein 50-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296080877|emb|CBI14769.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357485505|ref|XP_003613040.1| U-box domain-containing protein [Medicago truncatula] gi|355514375|gb|AES95998.1| U-box domain-containing protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449451595|ref|XP_004143547.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|240256481|ref|NP_201353.4| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] gi|332010681|gb|AED98064.1| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449499876|ref|XP_004160941.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255586647|ref|XP_002533954.1| ATP binding protein, putative [Ricinus communis] gi|223526067|gb|EEF28423.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359497293|ref|XP_003635475.1| PREDICTED: LOW QUALITY PROTEIN: putative U-box domain-containing protein 50-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297797581|ref|XP_002866675.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312510|gb|EFH42934.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 505 | ||||||
| TAIR|locus:2101353 | 805 | AT3G49060 [Arabidopsis thalian | 0.334 | 0.209 | 0.244 | 1.2e-13 | |
| TAIR|locus:2050669 | 834 | AT2G45910 [Arabidopsis thalian | 0.871 | 0.527 | 0.208 | 4.8e-12 | |
| TAIR|locus:2143094 | 701 | AT5G12000 [Arabidopsis thalian | 0.203 | 0.146 | 0.315 | 1.2e-09 | |
| TAIR|locus:2061012 | 788 | AT2G24370 [Arabidopsis thalian | 0.405 | 0.260 | 0.221 | 2.4e-09 | |
| TAIR|locus:2117343 | 835 | AT4G25160 [Arabidopsis thalian | 0.914 | 0.553 | 0.222 | 1.2e-08 | |
| TAIR|locus:504954932 | 789 | AT5G57035 [Arabidopsis thalian | 0.279 | 0.178 | 0.268 | 6.6e-08 | |
| TAIR|locus:2015656 | 758 | AT1G16760 [Arabidopsis thalian | 0.314 | 0.209 | 0.232 | 2.8e-07 | |
| TAIR|locus:2198190 | 308 | PUB54 "plant U-box 54" [Arabid | 0.295 | 0.483 | 0.289 | 3.1e-07 | |
| TAIR|locus:2180677 | 703 | AT5G26150 [Arabidopsis thalian | 0.295 | 0.211 | 0.269 | 7.2e-07 | |
| TAIR|locus:2198165 | 568 | AT1G01660 [Arabidopsis thalian | 0.302 | 0.269 | 0.303 | 6.8e-06 |
| TAIR|locus:2101353 AT3G49060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 158 (60.7 bits), Expect = 1.2e-13, Sum P(2) = 1.2e-13
Identities = 43/176 (24%), Positives = 87/176 (49%)
Query: 1 MDTEEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLP 60
+D +E ++VAV D++ T+ W R + + I ++ +H T + +T KL
Sbjct: 11 LDVDET-IFVAVAEDVERSKTTVLWAARNFSGKKICLLYVHRTARAAS----WT-HKKLV 64
Query: 61 ATSLSDEKLEILKKYEQGKTDNLLSKYLGFCGKVKAEILKVEKSDEPVHKLILDLVSRLT 120
S ++++++ E+ K D L++ YL + + + K+ + + + + I++L++R
Sbjct: 65 GGSFKKHDVKVIERVEKPKVDELMNSYLQLLSETEIQTDKLCIAGQNIEECIVELIARHK 124
Query: 121 ITKLVMGLSFMIPSAGKSRTAVSG-SYFVHHHMPDYCELFIICGGKLVSLKGENDE 175
I LVMG + + K S + FV PD C ++ +C G L+ + ND+
Sbjct: 125 IKWLVMGAASDKHYSWKMTDLKSKKAIFVCKKAPDSCHIWFLCKGYLIFTRASNDD 180
|
|
| TAIR|locus:2050669 AT2G45910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143094 AT5G12000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061012 AT2G24370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117343 AT4G25160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954932 AT5G57035 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015656 AT1G16760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198190 PUB54 "plant U-box 54" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180677 AT5G26150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2198165 AT1G01660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 505 | |||
| cd01989 | 146 | cd01989, STK_N, The N-terminal domain of Eukaryoti | 1e-15 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 |
| >gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases | Back alignment and domain information |
|---|
Score = 73.5 bits (181), Expect = 1e-15
Identities = 48/163 (29%), Positives = 74/163 (45%), Gaps = 22/163 (13%)
Query: 7 KVYVAVGNDLQDGYRTLDWTIRK--WKAQSISIVILHVTYNISIKDFVYTPFGKLPATSL 64
V VAV D + L W + K Q+I V++HV + P +P++S
Sbjct: 1 SVAVAVDKDKK-SKNALKWALDNLATKGQTI--VLVHV----------HPPITSIPSSSG 47
Query: 65 SDEKLEILKKYEQGKTDNLLSKYLGFCG--KVKAEILKVEKSDEPVHKLILDLVSRLTIT 122
E K+ E + LL Y FC V+ E + +E D V K I++ V+ IT
Sbjct: 48 KLEVASAYKQEEDKEAKELLLPYRCFCSRKGVQCEDVVLEDDD--VAKAIVEYVADHGIT 105
Query: 123 KLVMGLSFMIPSAGKSRTA-VSGSYFVHHHMPDYCELFIICGG 164
KLVMG S + K + + V+ S V PD+C ++++ G
Sbjct: 106 KLVMGASSDNHFSMKFKKSDVASS--VLKEAPDFCTVYVVSKG 146
|
The Serine Threonine kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain is predicted to be involved in ATP binding. Length = 146 |
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 505 | |||
| cd01989 | 146 | STK_N The N-terminal domain of Eukaryotic Serine T | 99.92 | |
| PRK15456 | 142 | universal stress protein UspG; Provisional | 99.82 | |
| PRK15005 | 144 | universal stress protein F; Provisional | 99.81 | |
| PRK09982 | 142 | universal stress protein UspD; Provisional | 99.8 | |
| PRK15118 | 144 | universal stress global response regulator UspA; P | 99.76 | |
| cd01987 | 124 | USP_OKCHK USP domain is located between the N-term | 99.74 | |
| cd01988 | 132 | Na_H_Antiporter_C The C-terminal domain of a subfa | 99.7 | |
| PF00582 | 140 | Usp: Universal stress protein family; InterPro: IP | 99.69 | |
| PRK10116 | 142 | universal stress protein UspC; Provisional | 99.69 | |
| PRK11175 | 305 | universal stress protein UspE; Provisional | 99.64 | |
| cd00293 | 130 | USP_Like Usp: Universal stress protein family. The | 99.56 | |
| PRK11175 | 305 | universal stress protein UspE; Provisional | 99.55 | |
| COG0589 | 154 | UspA Universal stress protein UspA and related nuc | 99.47 | |
| PRK12652 | 357 | putative monovalent cation/H+ antiporter subunit E | 99.3 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 98.79 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.69 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 98.53 | |
| cd01984 | 86 | AANH_like Adenine nucleotide alpha hydrolases supe | 97.51 | |
| TIGR02432 | 189 | lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t | 96.09 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.45 | |
| PLN03159 | 832 | cation/H(+) antiporter 15; Provisional | 95.25 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 95.21 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 95.16 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 94.9 | |
| PF01171 | 182 | ATP_bind_3: PP-loop family; InterPro: IPR011063 Th | 94.7 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.44 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 94.39 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.32 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 94.19 | |
| cd01992 | 185 | PP-ATPase N-terminal domain of predicted ATPase of | 94.09 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 93.99 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.99 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 92.93 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 92.78 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 92.5 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 92.18 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.17 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 92.14 | |
| PRK09039 | 343 | hypothetical protein; Validated | 92.1 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 91.74 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 91.7 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 91.61 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 91.32 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 91.3 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 91.1 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 90.57 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 90.46 | |
| PRK10696 | 258 | tRNA 2-thiocytidine biosynthesis protein TtcA; Pro | 90.42 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 90.34 | |
| PTZ00284 | 467 | protein kinase; Provisional | 90.33 | |
| PRK11637 | 428 | AmiB activator; Provisional | 90.15 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 89.93 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 89.86 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 89.79 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 89.74 | |
| cd01993 | 185 | Alpha_ANH_like_II This is a subfamily of Adenine n | 89.36 | |
| TIGR00268 | 252 | conserved hypothetical protein TIGR00268. The N-te | 89.29 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 89.01 | |
| COG0037 | 298 | MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle | 88.98 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.91 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 88.89 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 88.6 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 88.56 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 88.45 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 88.35 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 88.16 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 87.72 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 87.36 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 87.26 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 86.54 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 86.46 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 85.92 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 85.72 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 85.69 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 85.25 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 85.18 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 85.15 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 84.81 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 84.45 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 84.38 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 83.94 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 83.85 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 83.71 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 83.52 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 83.07 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 82.76 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 82.47 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 82.47 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 82.46 | |
| PF05262 | 489 | Borrelia_P83: Borrelia P83/100 protein; InterPro: | 82.28 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 82.01 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 81.94 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 81.78 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 81.76 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 81.75 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 81.73 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 81.71 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 81.65 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 81.52 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 81.5 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 81.32 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 81.3 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 81.29 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 81.14 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 81.09 | |
| PRK13820 | 394 | argininosuccinate synthase; Provisional | 80.82 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 80.51 |
| >cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases | Back alignment and domain information |
|---|
Probab=99.92 E-value=4.6e-24 Score=193.18 Aligned_cols=143 Identities=29% Similarity=0.426 Sum_probs=116.7
Q ss_pred EEEEEecCChHhHHHHHHHHHHhhhcCCCeEEEEEEeeCCCCCcccccCCCCCCCCcCChHHHHHHHHHHHHHHHHHHHH
Q 010658 7 KVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYTPFGKLPATSLSDEKLEILKKYEQGKTDNLLSK 86 (505)
Q Consensus 7 kIlVAVDgS~~~S~~AL~WAl~~~~~~g~~IvllHV~~~~~~~~~i~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~lL~~ 86 (505)
+||||||+|+. |.+||+||++++...++.|++|||.++.+ +.+...+. ......+.+...+.++++|.+
T Consensus 1 ~ILVavD~S~~-s~~al~~a~~~a~~~~~~l~ll~v~~~~~---~~~~~~~~-------~~~~~~~~~~~~~~~~~~l~~ 69 (146)
T cd01989 1 SVAVAVDKDKK-SKNALKWALDNLATKGQTIVLVHVHPPIT---SIPSSSGK-------LEVASAYKQEEDKEAKELLLP 69 (146)
T ss_pred CEEEEecCccc-cHHHHHHHHHhccCCCCcEEEEEeccCcc---cCCCCccc-------hHHHHHHHHHHHHHHHHHHHH
Confidence 59999999998 99999999999998899999999987643 11111110 012234555567778899999
Q ss_pred HHhhhc--cCccEEEEEecCCCChHHHHHHHHHHcCCCEEEEccCCCCCCCCcccccc-cccchhcccCCCceEEEEEeC
Q 010658 87 YLGFCG--KVKAEILKVEKSDEPVHKLILDLVSRLTITKLVMGLSFMIPSAGKSRTAV-SGSYFVHHHMPDYCELFIICG 163 (505)
Q Consensus 87 ~~~~c~--~v~ve~~vve~~~~d~~~~Ive~a~~~~idlLVmGs~g~~~~~~kr~~~g-svs~~V~k~Ap~~C~V~vV~k 163 (505)
+...|. ++++++.++.+ ++|++.|+++|+++++|+||||++|++++ .+.+.| ||+.+|++++|++|+|+||++
T Consensus 70 ~~~~~~~~~~~~~~~~~~g--~~~~~~I~~~a~~~~~dlIV~Gs~g~~~l--~~~~~gssva~~Vi~~a~~~c~Vlvv~~ 145 (146)
T cd01989 70 YRCFCSRKGVQCEDVVLED--DDVAKAIVEYVADHGITKLVMGASSDNHF--SMKFKKSDVASSVLKEAPDFCTVYVVSK 145 (146)
T ss_pred HHHHHhhcCCeEEEEEEeC--CcHHHHHHHHHHHcCCCEEEEeccCCCce--eecccCCchhHHHHhcCCCCceEEEEeC
Confidence 998886 66777777775 48999999999999999999999999887 666666 699999999999999999999
Q ss_pred C
Q 010658 164 G 164 (505)
Q Consensus 164 g 164 (505)
|
T Consensus 146 ~ 146 (146)
T cd01989 146 G 146 (146)
T ss_pred c
Confidence 8
|
The Serine Threonine kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. The N-terminal domain is homologous to the USP family which has a ATP binding fold. The N-terminal domain is predicted to be involved in ATP binding. |
| >PRK15456 universal stress protein UspG; Provisional | Back alignment and domain information |
|---|
| >PRK15005 universal stress protein F; Provisional | Back alignment and domain information |
|---|
| >PRK09982 universal stress protein UspD; Provisional | Back alignment and domain information |
|---|
| >PRK15118 universal stress global response regulator UspA; Provisional | Back alignment and domain information |
|---|
| >cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family | Back alignment and domain information |
|---|
| >cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea | Back alignment and domain information |
|---|
| >PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents | Back alignment and domain information |
|---|
| >PRK10116 universal stress protein UspC; Provisional | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >cd00293 USP_Like Usp: Universal stress protein family | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) | Back alignment and domain information |
|---|
| >TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03159 cation/H(+) antiporter 15; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily | Back alignment and domain information |
|---|
| >TIGR00268 conserved hypothetical protein TIGR00268 | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13820 argininosuccinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 68.3 bits (166), Expect = 3e-12
Identities = 84/611 (13%), Positives = 164/611 (26%), Gaps = 211/611 (34%)
Query: 1 MDTEEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYT---PFG 57
+ +E V V L+ Y + + K + ++ Y I +D +Y F
Sbjct: 72 LSKQEEMVQKFVEEVLRINY---KFLMSPIKTEQRQPSMMTRMY-IEQRDRLYNDNQVFA 127
Query: 58 KLPATSLSDEKLEILKKYEQGKTDNLLS----KYLGFCGKVKAEILKVEKSDEPVHKLIL 113
K + L + L++ LL K + G
Sbjct: 128 KYNVSRL--QPYLKLRQ-------ALLELRPAKNVLIDG--------------------- 157
Query: 114 DLVSRLTITKLVMGLSFMIPSAGKSRTA--VSGSYFVHHHMPDYCELFIICGGKLVSLKG 171
+ +GK+ A V SY V M ++F + S
Sbjct: 158 ------------VL------GSGKTWVALDVCLSYKVQCKMDF--KIFWLNLKNCNS--- 194
Query: 172 ENDEGIMEDDQGVKFAKMRERVNFGNLWTKMFSGNGRNPNRLSICSRGPDADSPYSRSTW 231
E ++E Q L ++ +PN SR + + R
Sbjct: 195 --PETVLEMLQ--------------KLLYQI------DPN---WTSRSDHSSNIKLRIHS 229
Query: 232 ENCVQEIEIYFQHLASFN----LDDASNSEDGDE-------ILQTRAIEPNAAEQIDSNM 280
E+ + N L + N++ + +L TR + + +
Sbjct: 230 IQ--AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFK--QVTDFLSAAT 285
Query: 281 SVAERTEFMKSKIN--EAREMIR--LKKKETKDDAERCAKAKWAICLC-------NSRAD 329
+ + + E + ++ L + E + + + D
Sbjct: 286 TTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWD 345
Query: 330 QLESLTKEDVASRMEIQRDLDSLKE-------QSCEVIR--------------------D 362
+ + + + + I+ L+ L+ V D
Sbjct: 346 NWKHVNCDKLTTI--IESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSD 403
Query: 363 VEESKNRL--SSLIELQSELS----NKLQLSTMAKGHAEAQLEKAVIARAEIVK--DIEE 414
V N+L SL+E Q + S + L K E L ++++ I K D ++
Sbjct: 404 VMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDD 463
Query: 415 L---------------------RRQRDVLHRRI----EFCKEKDAIGMVIRSSELSCA-- 447
L +R L R + F ++K IR +
Sbjct: 464 LIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQK------IRHDSTAWNAS 517
Query: 448 ---------FREYAAEDIRLATEDFSER------FRLKCAGDWTNVYRGRLNHASV---A 489
+ Y I + F K N+ + + + A
Sbjct: 518 GSILNTLQQLKFY-KPYICDNDPKYERLVNAILDFLPKIE---ENLICSK--YTDLLRIA 571
Query: 490 IKTLNNGLSEE 500
+ + + EE
Sbjct: 572 LMAEDEAIFEE 582
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 505 | |||
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 99.85 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 99.83 | |
| 3hgm_A | 147 | Universal stress protein TEAD; rossman fold, signa | 99.82 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 99.82 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 99.8 | |
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 99.8 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 99.8 | |
| 2z08_A | 137 | Universal stress protein family; uncharacterized c | 99.8 | |
| 3tnj_A | 150 | Universal stress protein (USP); structural genomic | 99.79 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 99.78 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 99.77 | |
| 3fdx_A | 143 | Putative filament protein / universal stress PROT; | 99.75 | |
| 1jmv_A | 141 | USPA, universal stress protein A; chaperone; 1.85A | 99.72 | |
| 1q77_A | 138 | Hypothetical protein AQ_178; structural genomics, | 99.67 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 99.66 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 99.66 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 99.63 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 99.63 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 99.63 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 99.6 | |
| 3cis_A | 309 | Uncharacterized protein; alpha/beta hydrolase, ATP | 99.59 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 99.56 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 99.53 | |
| 3ab8_A | 268 | Putative uncharacterized protein TTHA0350; tandem- | 99.39 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.08 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 96.48 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 95.97 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 95.62 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 95.56 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.35 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 95.27 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 94.39 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 94.06 | |
| 3a2k_A | 464 | TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, | 93.64 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 93.48 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 93.47 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 93.25 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 92.73 | |
| 1wy5_A | 317 | TILS, hypothetical UPF0072 protein AQ_1887; N-type | 92.72 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 92.69 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 92.64 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 92.63 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 92.47 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 92.41 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 92.2 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 92.19 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 91.97 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 91.85 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 91.76 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 91.72 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 91.53 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 91.52 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 91.46 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 91.4 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 91.38 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 91.25 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 91.13 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 91.07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 91.0 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 90.67 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 90.66 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 90.62 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 90.52 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 90.39 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 90.36 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 90.23 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 89.76 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 89.43 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 89.38 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 89.35 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 89.26 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 89.19 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 89.13 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 88.96 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 88.9 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 88.87 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 88.85 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 88.75 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 88.74 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 88.67 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 88.56 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 88.51 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 88.43 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 88.36 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 88.22 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 88.11 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 88.08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 88.03 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 87.91 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 87.85 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 87.84 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 87.83 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 87.75 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 87.7 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 87.64 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 87.6 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 87.52 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 87.48 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 87.46 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 87.42 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 87.35 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 87.32 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 87.25 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 87.21 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 87.2 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 87.11 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 87.09 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 87.05 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 87.03 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 86.95 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 86.86 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 86.76 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 86.67 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 86.67 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 86.56 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 86.56 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 86.51 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 86.42 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 86.39 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 86.19 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 86.16 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 86.15 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 86.13 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 86.1 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 86.07 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 86.05 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 85.94 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 85.89 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 85.85 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 85.82 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 85.77 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 85.76 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 85.73 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 85.73 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 85.69 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 85.61 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 85.55 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 85.27 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 85.27 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 85.26 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 85.24 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 85.18 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 85.14 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 85.12 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 84.97 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 84.9 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 84.73 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 84.65 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 84.62 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 84.51 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 84.35 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 84.3 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 84.28 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 84.21 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 84.18 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 84.07 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 84.06 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 84.02 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 84.02 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 83.9 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 83.89 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 83.86 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 83.81 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 83.72 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 83.72 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 83.65 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 83.57 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 83.54 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 83.52 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 83.27 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 83.07 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 82.95 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 82.89 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 82.84 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 82.74 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 82.73 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 82.57 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 82.34 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 82.25 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 81.96 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 81.83 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 81.81 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 81.73 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 81.65 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 81.49 | |
| 1uix_A | 71 | RHO-associated kinase; coiled-coil, transferase; H | 81.26 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 81.24 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 81.03 | |
| 1ni5_A | 433 | Putative cell cycle protein MESJ; structural genom | 80.86 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 80.76 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 80.73 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 80.66 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 80.6 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 80.59 | |
| 2q6q_A | 74 | Spindle POLE BODY component SPC42; SPC42P, budding | 80.1 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 80.08 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 80.07 |
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 | Back alignment and structure |
|---|
Probab=99.85 E-value=1.6e-20 Score=170.77 Aligned_cols=154 Identities=16% Similarity=0.060 Sum_probs=115.5
Q ss_pred CCCCCCEEEEEecCChHhHHHHHHHHHHhhhcCCCeEEEEEEeeCCCCC--cccccCCCC--C-CCCcCChHHHHHHHHH
Q 010658 1 MDTEEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIK--DFVYTPFGK--L-PATSLSDEKLEILKKY 75 (505)
Q Consensus 1 M~~~~~kIlVAVDgS~~~S~~AL~WAl~~~~~~g~~IvllHV~~~~~~~--~~i~~~~~~--~-p~~~~~~~~~~~~~~~ 75 (505)
|....++||||||+|+. |..||+||+.++...++.|++|||.++.... .+.+..... + |. ....+..+.+.
T Consensus 1 M~~~~~~ILv~vD~s~~-s~~al~~a~~la~~~~a~l~ll~v~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~ 76 (162)
T 1mjh_A 1 MSVMYKKILYPTDFSET-AEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKS---VEEFENELKNK 76 (162)
T ss_dssp --CCCCEEEEECCSCHH-HHHHHHHHHHTCCSSCCEEEEEEEEEGGGTC--------------------CHHHHHHHHHH
T ss_pred CccccceEEEEeCCCHH-HHHHHHHHHHHHhhcCCeEEEEEEecCccccccccccccccccccccc---hhhhHHHHHHH
Confidence 66668999999999999 9999999999999889999999998763000 000000000 1 11 10112334455
Q ss_pred HHHHHHHHHHHHHhhhc--cCccEEEEEecCCCChHHHHHHHHHHcCCCEEEEccCCCCCCCCcccccccccchhcccCC
Q 010658 76 EQGKTDNLLSKYLGFCG--KVKAEILKVEKSDEPVHKLILDLVSRLTITKLVMGLSFMIPSAGKSRTAVSGSYFVHHHMP 153 (505)
Q Consensus 76 ~~~~~~~lL~~~~~~c~--~v~ve~~vve~~~~d~~~~Ive~a~~~~idlLVmGs~g~~~~~~kr~~~gsvs~~V~k~Ap 153 (505)
..+.+++.|+.+...+. ++.+++.+..| +|++.|+++|+++++|+||||++|++++ ++.+.||++.+|++++|
T Consensus 77 ~~~~~~~~l~~~~~~~~~~g~~~~~~v~~G---~~~~~I~~~a~~~~~dlIV~G~~g~~~~--~~~~~GSv~~~vl~~~~ 151 (162)
T 1mjh_A 77 LTEEAKNKMENIKKELEDVGFKVKDIIVVG---IPHEEIVKIAEDEGVDIIIMGSHGKTNL--KEILLGSVTENVIKKSN 151 (162)
T ss_dssp HHHHHHHHHHHHHHHHHHTTCEEEEEEEEE---CHHHHHHHHHHHTTCSEEEEESCCSSCC--TTCSSCHHHHHHHHHCC
T ss_pred HHHHHHHHHHHHHHHHHHcCCceEEEEcCC---CHHHHHHHHHHHcCCCEEEEcCCCCCCc--cceEecchHHHHHHhCC
Confidence 56778888888888776 56677777665 8999999999999999999999998887 78889999999999998
Q ss_pred CceEEEEEeCCe
Q 010658 154 DYCELFIICGGK 165 (505)
Q Consensus 154 ~~C~V~vV~kgk 165 (505)
|||+||..++
T Consensus 152 --~pVlvv~~~~ 161 (162)
T 1mjh_A 152 --KPVLVVKRKN 161 (162)
T ss_dssp --SCEEEECCCC
T ss_pred --CCEEEEeCCC
Confidence 9999997653
|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A | Back alignment and structure |
|---|
| >3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* | Back alignment and structure |
|---|
| >1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1uix_A RHO-associated kinase; coiled-coil, transferase; HET: MSE; 1.80A {Bos taurus} SCOP: h.1.27.1 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 505 | |||
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 99.89 | |
| d2gm3a1 | 171 | Putative ethylene-responsive protein AT3g01520/F4P | 99.89 | |
| d2z3va1 | 135 | Hypothetical protein TTHA0895 {Thermus thermophilu | 99.86 | |
| d1tq8a_ | 147 | Hypothetical protein Rv1636 {Mycobacterium tubercu | 99.8 | |
| d1jmva_ | 140 | Universal stress protein A, UspA {Haemophilus infl | 99.78 | |
| d1q77a_ | 138 | Hypothetical protein Aq_178 {Aquifex aeolicus [Tax | 99.71 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 96.72 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 96.01 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 95.84 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 94.61 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 94.19 | |
| d1wy5a1 | 216 | TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId | 93.74 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 93.67 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 93.42 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 92.93 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 92.93 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 92.43 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 92.24 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 92.18 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 92.16 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 92.07 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 91.32 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 91.27 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 90.58 | |
| d1ni5a1 | 227 | tRNA-Ile-lysidine synthetase, TilS, N-terminal dom | 86.33 | |
| d1np7a2 | 204 | Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: | 84.1 |
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Adenine nucleotide alpha hydrolases-like family: Universal stress protein-like domain: "Hypothetical" protein MJ0577 species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=99.89 E-value=1.2e-22 Score=182.93 Aligned_cols=152 Identities=13% Similarity=-0.017 Sum_probs=118.0
Q ss_pred CCCEEEEEecCChHhHHHHHHHHHHhhhcCCCeEEEEEEeeCCCCCccccc---CCCCCCCCcCChHHHHHHHHHHHHHH
Q 010658 4 EEPKVYVAVGNDLQDGYRTLDWTIRKWKAQSISIVILHVTYNISIKDFVYT---PFGKLPATSLSDEKLEILKKYEQGKT 80 (505)
Q Consensus 4 ~~~kIlVAVDgS~~~S~~AL~WAl~~~~~~g~~IvllHV~~~~~~~~~i~~---~~~~~p~~~~~~~~~~~~~~~~~~~~ 80 (505)
-+++||||||+|+. |.+|++||++++...+++|++|||.++.. ....+. ..+........++....+.+...+.+
T Consensus 2 m~~~ILvavD~s~~-s~~al~~a~~la~~~~a~l~llhV~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (160)
T d1mjha_ 2 MYKKILYPTDFSET-AEIALKHVKAFKTLKAEEVILLHVIDERE-IKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEA 79 (160)
T ss_dssp CCCEEEEECCSCHH-HHHHHHHHHHTCCSSCCEEEEEEEEEGGG-TC-----------------CHHHHHHHHHHHHHHH
T ss_pred CcCeEEEEECCCHH-HHHHHHHHHHHHHhcCCEEEEEEeccccc-ccccccccccccccccchhHHHHHHHHHHHHHHHH
Confidence 36999999999999 99999999999999999999999988743 101110 11111111122333344556667788
Q ss_pred HHHHHHHHhhhc--cCccEEEEEecCCCChHHHHHHHHHHcCCCEEEEccCCCCCCCCcccccccccchhcccCCCceEE
Q 010658 81 DNLLSKYLGFCG--KVKAEILKVEKSDEPVHKLILDLVSRLTITKLVMGLSFMIPSAGKSRTAVSGSYFVHHHMPDYCEL 158 (505)
Q Consensus 81 ~~lL~~~~~~c~--~v~ve~~vve~~~~d~~~~Ive~a~~~~idlLVmGs~g~~~~~~kr~~~gsvs~~V~k~Ap~~C~V 158 (505)
++.|+.+...|. ++.+++.+..| +|++.|+++|+++++|+||||++|++++ .+.+.||++.+|++++| |||
T Consensus 80 ~~~l~~~~~~~~~~gv~~~~~~~~G---~~~~~I~~~a~~~~~dliV~G~~~~~~~--~~~~~GS~a~~vl~~s~--~pV 152 (160)
T d1mjha_ 80 KNKMENIKKELEDVGFKVKDIIVVG---IPHEEIVKIAEDEGVDIIIMGSHGKTNL--KEILLGSVTENVIKKSN--KPV 152 (160)
T ss_dssp HHHHHHHHHHHHHTTCEEEEEEEEE---CHHHHHHHHHHHTTCSEEEEESCCSSCC--TTCSSCHHHHHHHHHCC--SCE
T ss_pred HHHHHHHHHHHHhcCCeEEEEEEec---cHHHHHhhhhhccccceEEeccCCCCcc--cccccCcHHHHHHhcCC--CCE
Confidence 899999988887 56666777766 8999999999999999999999999888 78889999999999999 999
Q ss_pred EEEeCC
Q 010658 159 FIICGG 164 (505)
Q Consensus 159 ~vV~kg 164 (505)
|||.+.
T Consensus 153 lvV~~~ 158 (160)
T d1mjha_ 153 LVVKRK 158 (160)
T ss_dssp EEECCC
T ss_pred EEEcCC
Confidence 999875
|
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|