Citrus Sinensis ID: 010673

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS
ccccccccccccEEEEEcccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHccccccccccEEccccccccccccccccEEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEccccEEEEEEEEEccccHHHHHcccHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccEEEcccccEEHHHHHHHHHHHHHccHHHHHHHHHHHccccccccEEEEEccccHHccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEcccccEEEEEEEEcccccHHHHHccHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccccccHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MGPIMQQFREIETCVECsattmiqvpDVFYYAQKavlhptaplfdhdeqtlKPRCVRALKRIFIICDhdmdgalndAELNEFQVKcfnaplqpaeiVGVKRVVQEkqhdgvndlgltLSGFLFLHALFIEKGRLETTWAVLRKfgygddlelrddflpvptklspdqsVELASEAVEFLRGIFglydidndgavrpaELEDlfltapespwdeapykdaaettaLGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFrcllfgpqnagkSALLNSflerpfsenyapttgeqYAVNvvdqpggnkktlILQEIPEEGVKKILSNkealascdvtifvydssdeysWKRTKELLVEVARLgedsgygvpclliaskddlkpytmaVQDSARVTqelgieppipvsmkskdlnNVFSRIIWAaehphlnipetetgrnrkrYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTaplfdhdeqTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTrkrsvdrkkqqternvfrcllfgpqNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILsnkealascDVTIFvydssdeyswKRTKELLVEVArlgedsgygVPCLLIASKDDLKPYTMAVQDSARVTQElgieppipvsmkskDLNNVFSRIIwaaehphlnipetetgrnrKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNsslvfvsvgaavavvglaayrayaarrnsss
*******FREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKL****SVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVT*************RNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGI***I*V****KDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYA*******
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAA*******************VFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLK************TQELGIEPPIPVSMKSKDLNNVFSRIIWAAE*********************VNSSLVFVSVGAAVAVVGLAAYRAY*ARR****
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALR*************TERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSV*R*KQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVSVGAAVAVVGLAAYRAYAARRNSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query504 2.2.26 [Sep-21-2011]
P0CO78686 Mitochondrial Rho GTPase yes no 0.950 0.698 0.391 5e-96
P0CO79686 Mitochondrial Rho GTPase N/A no 0.950 0.698 0.391 5e-96
Q5ZM83618 Mitochondrial Rho GTPase yes no 0.944 0.770 0.415 1e-95
Q2HJF8631 Mitochondrial Rho GTPase yes no 0.936 0.748 0.406 5e-94
Q8IXI2618 Mitochondrial Rho GTPase yes no 0.936 0.763 0.404 1e-93
Q8BG51631 Mitochondrial Rho GTPase yes no 0.936 0.748 0.402 4e-93
Q5ZM73619 Mitochondrial Rho GTPase no no 0.942 0.767 0.401 3e-92
Q6NVC5619 Mitochondrial Rho GTPase yes no 0.928 0.756 0.398 9e-92
Q6DIS1616 Mitochondrial Rho GTPase yes no 0.906 0.741 0.4 1e-90
Q5E9M9618 Mitochondrial Rho GTPase no no 0.771 0.629 0.445 1e-88
>sp|P0CO78|GEM1_CRYNJ Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GEM1 PE=3 SV=1 Back     alignment and function desciption
 Score =  352 bits (902), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 209/534 (39%), Positives = 294/534 (55%), Gaps = 55/534 (10%)

Query: 2   GPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKR 61
            PIM++F+E+ET VECSA   + V +VFY+AQKAVLHPTAPL+D  E TLKP+C+ ALKR
Sbjct: 136 APIMREFKEVETVVECSALLPLNVSEVFYFAQKAVLHPTAPLYDSREHTLKPKCLEALKR 195

Query: 62  IFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDL------- 114
           IF I D D DG LN  ELN+FQ KCF+ PLQ  E+ G+  +V+      V  L       
Sbjct: 196 IFTISDVDKDGLLNAHELNQFQQKCFSTPLQSQELDGILEIVRSYDPYAVQPLPSSSPNT 255

Query: 115 --------------------------GLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGD 148
                                     G+T  GFL+LH +FI++GR+ETTW VLRKFGYG+
Sbjct: 256 PLSRDSSYGQLHYFNNNVVPPSPPQEGITELGFLYLHTMFIQQGRMETTWTVLRKFGYGE 315

Query: 149 DLELRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPE 208
            L+LR+DFL     +  D SVEL+    +FL  IF  YD D DGA+   EL+DLF T+P 
Sbjct: 316 SLDLREDFLAPKFDVPSDCSVELSPLGNQFLTDIFEAYDKDQDGALSQNELDDLFSTSPG 375

Query: 209 SPWDEAPYKDAAETTALGNLTLKGFVSKWALMTLLDPRHSLANLIYVGYGGDPA------ 262
           +PW    + D   T  +G +TL+G++++W++ TLL+ R +L  L Y+GY   PA      
Sbjct: 376 NPWLSQGFPDTTITDDMGRVTLQGWLAQWSMTTLLNHRTTLNYLAYLGYSSSPATDLPTP 435

Query: 263 AALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFS------ENYAPT 316
            AL VTR R  DR++++  RNVF C + G   +GK++LL SF+ RPF         Y PT
Sbjct: 436 TALHVTRPRKQDRRQRKVTRNVFLCYVLGATGSGKTSLLRSFVNRPFKGGEDGLGGYEPT 495

Query: 317 TGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKR 376
           T     VN V+   G +K L+LQE   +   +IL N + L   D+ I+V+DSSD  S+  
Sbjct: 496 TKVLSVVNSVEME-GVEKYLVLQEFGSKYESEILRNSKRLDMADIIIYVHDSSDTNSFSY 554

Query: 377 TKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARV-TQELGIEPPIPVSMKS 435
              L  +       S   +P + +A+K DL       +    V  + LG++ P+ VS + 
Sbjct: 555 ISNLRQQY------SLDHIPSIFVATKSDLDLAQQRHEVQPDVYCRRLGLQAPMAVSSRL 608

Query: 436 KDLNNVFSRIIWAAEHPHLNIPETETGRNR--KRYRHLVNSSLVFVSVGAAVAV 487
             L+N++  I   A  P  ++P     +    +R R +    L   ++ A VAV
Sbjct: 609 GPLHNLWVAITRVALDPTSSLPRGPRSQMSPAQRIRVVARWGLAATTISAIVAV 662
Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (taxid: 214684)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -
>sp|P0CO79|GEM1_CRYNB Mitochondrial Rho GTPase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GEM1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZM83|MIRO2_CHICK Mitochondrial Rho GTPase 2 OS=Gallus gallus GN=RHOT2 PE=2 SV=1 Back     alignment and function description
>sp|Q2HJF8|MIRO1_BOVIN Mitochondrial Rho GTPase 1 OS=Bos taurus GN=RHOT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IXI2|MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens GN=RHOT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BG51|MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus GN=Rhot1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM73|MIRO1_CHICK Mitochondrial Rho GTPase 1 OS=Gallus gallus GN=RHOT1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NVC5|MIRO1_DANRE Mitochondrial Rho GTPase 1-A OS=Danio rerio GN=rhot1a PE=2 SV=1 Back     alignment and function description
>sp|Q6DIS1|MIRO2_XENTR Mitochondrial Rho GTPase 2 OS=Xenopus tropicalis GN=rhot2 PE=2 SV=1 Back     alignment and function description
>sp|Q5E9M9|MIRO2_BOVIN Mitochondrial Rho GTPase 2 OS=Bos taurus GN=RHOT2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
255559464 644 rac-GTP binding protein, putative [Ricin 1.0 0.782 0.748 0.0
225436934 639 PREDICTED: mitochondrial Rho GTPase 1 [V 1.0 0.788 0.740 0.0
225450975 647 PREDICTED: mitochondrial Rho GTPase 1 [V 1.0 0.778 0.722 0.0
296088320 684 unnamed protein product [Vitis vinifera] 1.0 0.736 0.722 0.0
224082628 645 predicted protein [Populus trichocarpa] 1.0 0.781 0.757 0.0
150036254 647 ATP/GTP/Ca++ binding protein [Cucumis me 1.0 0.778 0.714 0.0
449442827 647 PREDICTED: mitochondrial Rho GTPase 1-li 1.0 0.778 0.712 0.0
449482860 648 PREDICTED: mitochondrial Rho GTPase 1-li 1.0 0.777 0.710 0.0
449462328 639 PREDICTED: LOW QUALITY PROTEIN: mitochon 0.996 0.785 0.714 0.0
224125274 651 predicted protein [Populus trichocarpa] 0.996 0.771 0.705 0.0
>gi|255559464|ref|XP_002520752.1| rac-GTP binding protein, putative [Ricinus communis] gi|223540137|gb|EEF41714.1| rac-GTP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/504 (74%), Positives = 438/504 (86%)

Query: 1   MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALK 60
           MGPIMQQ REIETC+ECSA T++QVPDVF+YAQKAVLHPTAPLFD +  TLKPRC RAL+
Sbjct: 141 MGPIMQQHREIETCIECSAVTLMQVPDVFFYAQKAVLHPTAPLFDQEHHTLKPRCERALR 200

Query: 61  RIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSG 120
           RIF++CDHDMDGALND ELN FQVKCFNAPLQPAEIVGV+RVVQEK+ DGVND+GLTL G
Sbjct: 201 RIFLLCDHDMDGALNDLELNNFQVKCFNAPLQPAEIVGVRRVVQEKKRDGVNDIGLTLEG 260

Query: 121 FLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLR 180
           FLFLH+LFI++GR+ETTW VLRKFGY D+L+LRDD LPVP K +PDQS+EL  E VEFLR
Sbjct: 261 FLFLHSLFIDRGRIETTWTVLRKFGYDDELKLRDDLLPVPYKHAPDQSIELTIEVVEFLR 320

Query: 181 GIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALM 240
           GIF L+DIDN GA+RP+EL++LF TAPE+PW EAPYKDAAE T   +LT KGF+S W LM
Sbjct: 321 GIFRLFDIDNHGALRPSELDELFSTAPENPWCEAPYKDAAERTMQRSLTFKGFLSGWDLM 380

Query: 241 TLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSAL 300
           TLL+P+ SLANLIYVGY G+PA+AL VTR+R+VDRKKQQTERNVF CL+FGP+NAGKSAL
Sbjct: 381 TLLNPKSSLANLIYVGYSGNPASALHVTRRRTVDRKKQQTERNVFHCLVFGPKNAGKSAL 440

Query: 301 LNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCD 360
           LNSFL RPFSE++    GE +A NVVDQ GG KKTLIL+E+PE+GVKK LSNKE+LA+CD
Sbjct: 441 LNSFLGRPFSESFHLPIGEHFAANVVDQLGGIKKTLILREVPEDGVKKYLSNKESLAACD 500

Query: 361 VTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVT 420
           V +FVYD SDEYSWKR+ ELLVE+ R GE+SGYG+PCLLIA+KDDL PY MAVQDS  V 
Sbjct: 501 VAVFVYDCSDEYSWKRSCELLVEIVRQGEESGYGMPCLLIAAKDDLDPYPMAVQDSVAVC 560

Query: 421 QELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNSSLVFVS 480
           QELGIE PIPVS K  ++NNVF RI+ AA  PHLNIPETE+GR RK +R LVN SL+F+S
Sbjct: 561 QELGIEAPIPVSTKLGEMNNVFCRILSAAVRPHLNIPETESGRRRKVFRQLVNHSLIFMS 620

Query: 481 VGAAVAVVGLAAYRAYAARRNSSS 504
           VGA +AVVGLAA+RAY+AR+NSS+
Sbjct: 621 VGAGLAVVGLAAFRAYSARKNSSN 644

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225436934|ref|XP_002275434.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera] gi|296086704|emb|CBI32339.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450975|ref|XP_002284757.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088320|emb|CBI36765.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224082628|ref|XP_002306771.1| predicted protein [Populus trichocarpa] gi|222856220|gb|EEE93767.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|150036254|gb|ABR67417.1| ATP/GTP/Ca++ binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449442827|ref|XP_004139182.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449482860|ref|XP_004156425.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449462328|ref|XP_004148893.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224125274|ref|XP_002319545.1| predicted protein [Populus trichocarpa] gi|222857921|gb|EEE95468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
TAIR|locus:2099232643 MIRO2 "MIRO-related GTP-ase 2" 0.938 0.735 0.676 3.9e-179
TAIR|locus:2146385648 MIRO1 "MIRO-related GTP-ase 1" 0.936 0.728 0.643 8e-172
TAIR|locus:2096224648 MIRO3 "MIRO-related GTP-ase 3" 0.914 0.711 0.519 2.2e-128
UNIPROTKB|Q5ZM83618 RHOT2 "Mitochondrial Rho GTPas 0.882 0.720 0.432 7.7e-87
UNIPROTKB|G1K237631 RHOT1 "Mitochondrial Rho GTPas 0.867 0.692 0.421 2.4e-85
UNIPROTKB|J9NUJ0720 RHOT1 "Mitochondrial Rho GTPas 0.871 0.609 0.419 2.4e-85
UNIPROTKB|F1NSQ4618 RHOT1 "Mitochondrial Rho GTPas 0.871 0.710 0.421 3.8e-85
UNIPROTKB|Q2HJF8631 RHOT1 "Mitochondrial Rho GTPas 0.867 0.692 0.421 3.8e-85
UNIPROTKB|H7BXZ6597 RHOT1 "Mitochondrial Rho GTPas 0.867 0.731 0.419 6.2e-85
UNIPROTKB|J9JIH9659 RHOT1 "Mitochondrial Rho GTPas 0.871 0.666 0.417 6.2e-85
TAIR|locus:2099232 MIRO2 "MIRO-related GTP-ase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1739 (617.2 bits), Expect = 3.9e-179, P = 3.9e-179
 Identities = 320/473 (67%), Positives = 395/473 (83%)

Query:     1 MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALK 60
             M PIM+++REIETC+ECSA T+IQVPDVFY+A KAVLHPT PLFD ++Q LKPR  RA++
Sbjct:   142 MSPIMKEYREIETCIECSALTLIQVPDVFYFASKAVLHPTFPLFDQEKQCLKPRLRRAVQ 201

Query:    61 RIFIICDHDMDGALNDAELNEFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSG 120
             RIF +CDHD+DGALNDAELN+FQV CF APL P E++GVK+VVQE+Q DGV DLGLTL G
Sbjct:   202 RIFNLCDHDLDGALNDAELNDFQVNCFGAPLDPVELMGVKKVVQERQPDGVTDLGLTLPG 261

Query:   121 FLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFLPVPTKLSPDQSVELASEAVEFLR 180
             FLFL +LFIE+GR ET WA+LRK GY D LEL  + LPVP K SPDQS+EL +EA++FL 
Sbjct:   262 FLFLFSLFIERGRPETAWAILRKCGYNDSLELHAELLPVPAKQSPDQSIELTNEAMDFLS 321

Query:   181 GIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWALM 240
             GIF LYD+DNDGA++PAEL+DLF TAP+SPW E PYK+AAE T  G+LT+ GF+S+WALM
Sbjct:   322 GIFQLYDLDNDGALQPAELDDLFQTAPDSPWLEDPYKEAAEKTPGGSLTINGFLSEWALM 381

Query:   241 TLLDPRHSLANLIYVGYGGDPAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSAL 300
             TLLDPR SLANL Y+GYG DPA+   VTRKRSVDRKKQ+TERNVF+C +FGP+ +GKSAL
Sbjct:   382 TLLDPRKSLANLTYIGYGHDPASTFSVTRKRSVDRKKQRTERNVFQCFVFGPKKSGKSAL 441

Query:   301 LNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCD 360
             L+SFL R FS +Y  T GE+YA NV+DQPGG+KKTLIL+EIPE+ VKK L+NKE+LA+CD
Sbjct:   442 LDSFLGRKFSNSYKATMGERYAANVIDQPGGSKKTLILREIPEDRVKKFLTNKESLAACD 501

Query:   361 VTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDSARVT 420
             V + VYDSSD YSW++ +E+L+EVAR GE+ GYG PCLL+A+KDDL PY M+VQ+S RV 
Sbjct:   502 VAVVVYDSSDVYSWRKAREILMEVARRGEERGYGTPCLLVAAKDDLDPYPMSVQESDRVC 561

Query:   421 QELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVN 473
              ELGI+ P+ +SMK  + N++FSRI+  AE+PH++IPETE+GR  +  R LVN
Sbjct:   562 MELGIDIPVSLSMKLGEPNSLFSRIVSTAENPHMSIPETESGRRSRNIRQLVN 614
GO:0003924 "GTPase activity" evidence=IEA;IDA
GO:0005509 "calcium ion binding" evidence=IEA;IDA
GO:0005525 "GTP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0005741 "mitochondrial outer membrane" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0019725 "cellular homeostasis" evidence=IEA
GO:0009737 "response to abscisic acid stimulus" evidence=IMP
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:2146385 MIRO1 "MIRO-related GTP-ase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096224 MIRO3 "MIRO-related GTP-ase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM83 RHOT2 "Mitochondrial Rho GTPase 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K237 RHOT1 "Mitochondrial Rho GTPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUJ0 RHOT1 "Mitochondrial Rho GTPase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSQ4 RHOT1 "Mitochondrial Rho GTPase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJF8 RHOT1 "Mitochondrial Rho GTPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H7BXZ6 RHOT1 "Mitochondrial Rho GTPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9JIH9 RHOT1 "Mitochondrial Rho GTPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
cd01892180 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2) 5e-65
pfam0835689 pfam08356, EF_assoc_2, EF hand associated 3e-42
pfam0835575 pfam08355, EF_assoc_1, EF hand associated 8e-29
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 8e-20
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-13
pfam08477116 pfam08477, Miro, Miro-like protein 4e-13
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 5e-13
cd00880161 cd00880, Era_like, E 1e-09
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 9e-07
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-06
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-06
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 3e-06
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 4e-06
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 6e-06
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 7e-06
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 9e-06
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 1e-05
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 2e-05
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 3e-05
cd01874175 cd01874, Cdc42, cell division cycle 42 (Cdc42) is 6e-05
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 9e-05
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 2e-04
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 2e-04
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 3e-04
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 4e-04
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 5e-04
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 6e-04
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 6e-04
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 9e-04
pfam09439181 pfam09439, SRPRB, Signal recognition particle rece 0.001
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 0.002
COG0486454 COG0486, ThdF, Predicted GTPase [General function 0.003
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 0.003
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 0.003
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 0.003
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 0.004
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 0.004
>gnl|CDD|206679 cd01892, Miro2, Mitochondrial Rho family 2 (Miro2), C-terminal Back     alignment and domain information 
 Score =  208 bits (531), Expect = 5e-65
 Identities = 78/187 (41%), Positives = 111/187 (59%), Gaps = 10/187 (5%)

Query: 281 ERNVFRCLLFGPQNAGKSALLNSFLERPFSEN-YAPTTGEQYAVNVVDQPGGNKKTLILQ 339
           +RNVF C + G + +GKSALL +FL R FS+N Y+PT   +YAVN V+ P G +K LIL+
Sbjct: 1   QRNVFLCFVLGAKGSGKSALLQAFLGRSFSQNAYSPTIKPRYAVNTVEVP-GQEKYLILR 59

Query: 340 EIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLL 399
           E+ E+    IL N   LA+CDV   VYDSSD  S+        EV +     G  +PCL 
Sbjct: 60  EVGEDEE-AILLNDAELAACDVACLVYDSSDPNSFSY----CAEVYKKYFMLG-EIPCLF 113

Query: 400 IASKDDLKPYT-MAVQDSARVTQELGIEPPIPVSMKSKD-LNNVFSRIIWAAEHPHLNIP 457
           +A+K DL      A        ++LG+ PP+  S +  D  N +F+++  AA++PHL+IP
Sbjct: 114 VAAKADLDEQQQRAEVQPDEFCRKLGLPPPLHFSSRLGDSSNELFTKLATAAQYPHLSIP 173

Query: 458 ETETGRN 464
           E E+G+ 
Sbjct: 174 ELESGKT 180

Miro2 subfamily. Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the putative GTPase domain in the C terminus of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature. Length = 180
>gnl|CDD|192013 pfam08356, EF_assoc_2, EF hand associated Back     alignment and domain information
>gnl|CDD|192012 pfam08355, EF_assoc_1, EF hand associated Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|204242 pfam09439, SRPRB, Signal recognition particle receptor beta subunit Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 504
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 100.0
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.97
PRK11058426 GTPase HflX; Provisional 99.96
COG2262411 HflX GTPases [General function prediction only] 99.96
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.96
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.96
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.96
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.96
KOG0394210 consensus Ras-related GTPase [General function pre 99.95
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.95
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.95
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.95
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.95
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.95
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.94
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.94
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.94
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.94
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.94
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.94
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.94
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.93
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.93
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.93
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.93
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.93
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.93
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.93
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.93
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.93
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.93
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.93
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.93
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.93
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.93
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.92
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.92
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.92
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.92
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.92
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.92
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.92
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.92
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.92
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.92
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.92
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.92
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.92
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.92
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.92
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.92
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.92
PTZ00369189 Ras-like protein; Provisional 99.92
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.92
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.92
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.92
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.92
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.92
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.91
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.91
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.91
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.91
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.91
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.91
PLN03110216 Rab GTPase; Provisional 99.91
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.91
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.91
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.91
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.91
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.91
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.91
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.91
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.91
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.91
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.9
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.9
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.9
PLN03108210 Rab family protein; Provisional 99.9
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.9
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.9
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.9
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.9
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.9
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.89
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.89
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.89
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.89
PLN03118211 Rab family protein; Provisional 99.89
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.89
KOG0395196 consensus Ras-related GTPase [General function pre 99.88
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.88
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.88
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.88
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.88
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.88
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.87
PLN00223181 ADP-ribosylation factor; Provisional 99.87
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.87
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.87
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.87
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.87
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.87
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.87
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.87
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.86
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.86
PTZ00133182 ADP-ribosylation factor; Provisional 99.86
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.86
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.86
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.86
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.85
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.85
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.85
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.85
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.85
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.85
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.85
KOG4252246 consensus GTP-binding protein [Signal transduction 99.84
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.84
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.83
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.83
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.83
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.83
COG0486454 ThdF Predicted GTPase [General function prediction 99.83
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.83
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.83
PLN00023334 GTP-binding protein; Provisional 99.83
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.82
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.82
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.82
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.82
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.81
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.81
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.81
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.81
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.8
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.8
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.8
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.8
COG1159298 Era GTPase [General function prediction only] 99.79
PRK12299335 obgE GTPase CgtA; Reviewed 99.79
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.79
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.78
PF0835689 EF_assoc_2: EF hand associated; InterPro: IPR01356 99.78
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.77
PRK15494339 era GTPase Era; Provisional 99.77
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.77
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.76
PTZ00099176 rab6; Provisional 99.76
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.76
PRK00089292 era GTPase Era; Reviewed 99.76
PRK12298390 obgE GTPase CgtA; Reviewed 99.76
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.75
PRK03003472 GTP-binding protein Der; Reviewed 99.74
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.74
COG1160 444 Predicted GTPases [General function prediction onl 99.74
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.73
COG1100219 GTPase SAR1 and related small G proteins [General 99.72
PRK12296 500 obgE GTPase CgtA; Reviewed 99.72
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.72
PRK03003 472 GTP-binding protein Der; Reviewed 99.72
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.71
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.7
PRK12297424 obgE GTPase CgtA; Reviewed 99.7
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.7
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.7
cd00881189 GTP_translation_factor GTP translation factor fami 99.69
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.69
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.69
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.69
COG1160444 Predicted GTPases [General function prediction onl 99.69
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.69
PRK04213201 GTP-binding protein; Provisional 99.69
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.68
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.68
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.68
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.66
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.66
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.66
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.66
KOG0410410 consensus Predicted GTP binding protein [General f 99.65
PF0835576 EF_assoc_1: EF hand associated; InterPro: IPR01356 99.65
PRK00093435 GTP-binding protein Der; Reviewed 99.65
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.65
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.65
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.65
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.64
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.64
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.64
PRK00093 435 GTP-binding protein Der; Reviewed 99.64
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.63
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.63
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.62
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.61
KOG1673205 consensus Ras GTPases [General function prediction 99.6
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.6
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.59
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.59
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.58
PTZ00183158 centrin; Provisional 99.58
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.58
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.58
CHL00189 742 infB translation initiation factor 2; Provisional 99.57
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.57
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.56
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.56
cd01896233 DRG The developmentally regulated GTP-binding prot 99.56
cd04105203 SR_beta Signal recognition particle receptor, beta 99.56
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.56
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.54
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 99.54
COG0218200 Predicted GTPase [General function prediction only 99.54
PRK05306 787 infB translation initiation factor IF-2; Validated 99.54
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.53
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.53
PRK05433 600 GTP-binding protein LepA; Provisional 99.52
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.51
COG1084346 Predicted GTPase [General function prediction only 99.5
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.5
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.49
PTZ00184149 calmodulin; Provisional 99.48
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.48
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.47
PRK10218 607 GTP-binding protein; Provisional 99.44
PRK12317 425 elongation factor 1-alpha; Reviewed 99.44
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.43
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.43
COG2229187 Predicted GTPase [General function prediction only 99.42
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.41
COG1163365 DRG Predicted GTPase [General function prediction 99.41
COG0536369 Obg Predicted GTPase [General function prediction 99.41
PRK04004 586 translation initiation factor IF-2; Validated 99.41
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.4
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.39
PRK12736 394 elongation factor Tu; Reviewed 99.38
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.38
PRK12735 396 elongation factor Tu; Reviewed 99.37
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.37
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.37
CHL00071 409 tufA elongation factor Tu 99.34
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.33
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.33
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.33
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.31
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.3
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.29
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.28
PLN03126 478 Elongation factor Tu; Provisional 99.28
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.28
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.28
PRK00049 396 elongation factor Tu; Reviewed 99.27
PRK09602396 translation-associated GTPase; Reviewed 99.27
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.26
PRK09866 741 hypothetical protein; Provisional 99.25
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.24
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.24
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.23
KOG1145 683 consensus Mitochondrial translation initiation fac 99.23
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.23
PLN03127 447 Elongation factor Tu; Provisional 99.22
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.21
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.21
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.18
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.17
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.17
PRK13351 687 elongation factor G; Reviewed 99.16
COG3596296 Predicted GTPase [General function prediction only 99.15
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.13
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.11
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.11
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.11
PLN00043 447 elongation factor 1-alpha; Provisional 99.1
PTZ00258 390 GTP-binding protein; Provisional 99.08
PRK12739 691 elongation factor G; Reviewed 99.06
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.06
PTZ00141 446 elongation factor 1- alpha; Provisional 99.03
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.03
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.02
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.02
KOG0462 650 consensus Elongation factor-type GTP-binding prote 98.99
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.98
PRK00007 693 elongation factor G; Reviewed 98.97
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.94
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.94
KOG3905 473 consensus Dynein light intermediate chain [Cell mo 98.93
PRK12740 668 elongation factor G; Reviewed 98.92
KOG0090238 consensus Signal recognition particle receptor, be 98.92
PRK09601 364 GTP-binding protein YchF; Reviewed 98.91
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.89
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 98.89
PRK09435332 membrane ATPase/protein kinase; Provisional 98.87
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.87
PRK14845 1049 translation initiation factor IF-2; Provisional 98.87
PLN02964644 phosphatidylserine decarboxylase 98.85
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.85
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.84
KOG0036463 consensus Predicted mitochondrial carrier protein 98.82
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.82
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 98.82
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.8
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.79
PRK13768253 GTPase; Provisional 98.78
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.77
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.76
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.74
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 98.74
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.72
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.71
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.7
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.7
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.68
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.67
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.67
PF1465866 EF-hand_9: EF-hand domain 98.62
COG1217 603 TypA Predicted membrane GTPase involved in stress 98.61
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.61
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.6
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.58
COG0012372 Predicted GTPase, probable translation factor [Tra 98.57
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.56
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.56
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.55
PTZ00416 836 elongation factor 2; Provisional 98.55
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.53
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.52
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.51
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 98.5
PLN00116 843 translation elongation factor EF-2 subunit; Provis 98.49
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.49
PRK12289 352 GTPase RsgA; Reviewed 98.49
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.47
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.47
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 98.46
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.46
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.45
PRK00098298 GTPase RsgA; Reviewed 98.45
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 98.44
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.44
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.43
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.43
PRK07560 731 elongation factor EF-2; Reviewed 98.4
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.39
cd0005267 EH Eps15 homology domain; found in proteins implic 98.38
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.37
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.36
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.36
PRK12288347 GTPase RsgA; Reviewed 98.34
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 98.33
KOG3886295 consensus GTP-binding protein [Signal transduction 98.31
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.31
COG0050 394 TufB GTPases - translation elongation factors [Tra 98.29
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 98.27
KOG0461 522 consensus Selenocysteine-specific elongation facto 98.27
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.26
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.25
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.19
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.19
PTZ00183158 centrin; Provisional 98.17
PRK13796 365 GTPase YqeH; Provisional 98.17
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.16
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.16
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.16
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.16
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.15
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.14
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 98.14
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.13
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.11
KOG2486320 consensus Predicted GTPase [General function predi 98.08
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.07
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 98.06
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.01
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 98.0
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.0
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.99
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 97.98
PRK09563 287 rbgA GTPase YlqF; Reviewed 97.97
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.96
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.95
PTZ00184149 calmodulin; Provisional 97.95
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.93
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.9
PLN02964 644 phosphatidylserine decarboxylase 97.89
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.88
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.87
COG5019373 CDC3 Septin family protein [Cell division and chro 97.81
PRK09563287 rbgA GTPase YlqF; Reviewed 97.8
COG1161322 Predicted GTPases [General function prediction onl 97.78
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 97.77
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.76
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.76
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.75
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.74
COG5258 527 GTPBP1 GTPase [General function prediction only] 97.72
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.69
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 97.68
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.65
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.63
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.62
KOG0460 449 consensus Mitochondrial translation elongation fac 97.61
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 97.6
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.52
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 97.51
PRK01889 356 GTPase RsgA; Reviewed 97.5
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.49
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.46
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.46
cd0005267 EH Eps15 homology domain; found in proteins implic 97.45
cd03112158 CobW_like The function of this protein family is u 97.45
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.44
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.42
KOG0082354 consensus G-protein alpha subunit (small G protein 97.4
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.39
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.37
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.37
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 97.36
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.34
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.32
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.31
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.31
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.28
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.27
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.26
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.25
KOG1491 391 consensus Predicted GTP-binding protein (ODN super 97.25
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.24
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.24
KOG1143 591 consensus Predicted translation elongation factor 97.22
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.21
PRK12289352 GTPase RsgA; Reviewed 97.2
PRK12288347 GTPase RsgA; Reviewed 97.12
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 97.05
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.05
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.02
PRK13695174 putative NTPase; Provisional 97.02
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.0
PRK13796365 GTPase YqeH; Provisional 96.99
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.99
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 96.98
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 96.93
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.92
KOG0466 466 consensus Translation initiation factor 2, gamma s 96.91
KOG0467 887 consensus Translation elongation factor 2/ribosome 96.89
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.89
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 96.88
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 96.86
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.85
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.85
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 96.85
COG1162301 Predicted GTPases [General function prediction onl 96.83
KOG0038189 consensus Ca2+-binding kinase interacting protein 96.83
KOG4251362 consensus Calcium binding protein [General functio 96.8
PRK11537318 putative GTP-binding protein YjiA; Provisional 96.76
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 96.73
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.71
COG1162301 Predicted GTPases [General function prediction onl 96.71
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.67
COG0523323 Putative GTPases (G3E family) [General function pr 96.64
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.62
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 96.58
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 96.53
KOG0036463 consensus Predicted mitochondrial carrier protein 96.52
PRK00098298 GTPase RsgA; Reviewed 96.5
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 96.48
PRK10416318 signal recognition particle-docking protein FtsY; 96.46
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.38
COG3523 1188 IcmF Type VI protein secretion system component Va 96.37
KOG4273 418 consensus Uncharacterized conserved protein [Funct 96.35
TIGR00064272 ftsY signal recognition particle-docking protein F 96.34
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.3
PRK14974336 cell division protein FtsY; Provisional 96.3
COG1161 322 Predicted GTPases [General function prediction onl 96.27
KOG2484 435 consensus GTPase [General function prediction only 96.26
KOG0377631 consensus Protein serine/threonine phosphatase RDG 96.26
KOG2484435 consensus GTPase [General function prediction only 96.25
TIGR02475 341 CobW cobalamin biosynthesis protein CobW. A broade 96.21
cd03115173 SRP The signal recognition particle (SRP) mediates 96.2
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.17
cd0503088 calgranulins Calgranulins: S-100 domain found in p 96.14
KOG3887347 consensus Predicted small GTPase involved in nucle 96.07
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.04
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.0
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.81
KOG4251362 consensus Calcium binding protein [General functio 95.76
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.74
KOG2423572 consensus Nucleolar GTPase [General function predi 95.72
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.67
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 95.65
KOG1424 562 consensus Predicted GTP-binding protein MMR1 [Gene 95.65
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 95.44
PRK08118167 topology modulation protein; Reviewed 95.35
PRK07261171 topology modulation protein; Provisional 95.27
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.26
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.24
PF1355562 AAA_29: P-loop containing region of AAA domain 95.21
PRK00771437 signal recognition particle protein Srp54; Provisi 95.17
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.15
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.15
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.14
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=9.3e-93  Score=708.24  Aligned_cols=480  Identities=55%  Similarity=0.907  Sum_probs=441.7

Q ss_pred             ChhhhhccchhhheeeecccccCChhHHHHHhhhccccCCCcccccccCcchHHHHHHHHHhHhhhcCCCCCccCHHHHH
Q 010673            1 MGPIMQQFREIETCVECSATTMIQVPDVFYYAQKAVLHPTAPLFDHDEQTLKPRCVRALKRIFIICDHDMDGALNDAELN   80 (504)
Q Consensus         1 ~~~~~~~~~~~~~~~~csa~~~~~~~~~~~~~~~~~~~p~~pl~~~~~~~l~~~~~~~l~~~F~~~D~d~dG~l~~~El~   80 (504)
                      |+|||++|+|||+||||||+++.|++|+||||||||+||+.||||++.++|++.|++||+|||++||.|+||.+|+.||+
T Consensus       139 ~~pim~~f~EiEtciecSA~~~~n~~e~fYyaqKaVihPt~PLyda~~qelkp~~v~al~RIFki~D~d~D~~Lsd~Eln  218 (625)
T KOG1707|consen  139 TLPIMIAFAEIETCIECSALTLANVSELFYYAQKAVIHPTSPLYDAEEQELKPRCVKALKRIFKISDSDNDGALSDAELN  218 (625)
T ss_pred             HHHHHHHhHHHHHHHhhhhhhhhhhHhhhhhhhheeeccCccccccccccccHHHHHHHHHHHhhhccccccccchhhhh
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCCHHHHHHHHHHhhhhccCCcCCCCCCHHhHHHHHHHHHhcCCchhHHHHHHhhcCCCCccccCCCC-CC
Q 010673           81 EFQVKCFNAPLQPAEIVGVKRVVQEKQHDGVNDLGLTLSGFLFLHALFIEKGRLETTWAVLRKFGYGDDLELRDDFL-PV  159 (504)
Q Consensus        81 ~~~~~~~g~~~~~~e~~~~~~~~~~~~~~~~~~~~i~~~~Fl~l~~~~~~~~~~e~~~~~~~~f~~d~~~~i~~~~l-~~  159 (504)
                      .||++||+.+++..+++.++..+...+|+|+.+.++++.|||.|+..|+++|++|++|.++|+|+|++++.+++++| | 
T Consensus       219 ~fQ~~CF~~pl~p~~l~~vk~vv~e~~p~gv~~~~ltl~GFLfL~~lfiergr~EttW~iLR~fgY~DsleL~~~~l~p-  297 (625)
T KOG1707|consen  219 DFQKKCFNTPLDPQELEDVKNVVQEICPDGVYERGLTLPGFLFLNTLFIERGRHETTWTILRKFGYTDSLELTDEYLPP-  297 (625)
T ss_pred             HHHHHhcCCCCCHHHHHHHHHHHHhhcCchhhhccccccchHHHHHHHHHhccccchhhhhhhcCCcchhhhhhhhcCc-
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999 8 


Q ss_pred             CCCCCCCCccccChhHHHHHHHhhhhhcCCCCCCCCHHHHhhhhccCCCCCCCCCccccccccccCCcccHHHHHHhhhh
Q 010673          160 PTKLSPDQSVELASEAVEFLRGIFGLYDIDNDGAVRPAELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFVSKWAL  239 (504)
Q Consensus       160 ~~~~~~~~~~~l~~~~~~~l~~lf~~~D~d~dG~l~~~e~~~l~~~~p~~p~~~~~~~~~~~~~~~g~i~~~~~l~~w~~  239 (504)
                      .++++++++++|++.+++|+..+|..||.|+||.|+.+||..+|+++|..||....+++.++.+..||++++|||++|++
T Consensus       298 ~~~~~p~~s~ELs~~~~~Fl~~~f~~~D~d~Dg~L~p~El~~LF~~~P~~pW~~~~~~~~t~~~~~G~ltl~g~l~~WsL  377 (625)
T KOG1707|consen  298 RLKVPPDQSVELSPKGYRFLVDVFEKFDRDNDGALSPEELKDLFSTAPGSPWTSSPYKDSTVKNERGWLTLNGFLSQWSL  377 (625)
T ss_pred             cccCCCCcceeccHHHHHHHHHHHHhccCCCCCCcCHHHHHHHhhhCCCCCCCCCcccccceecccceeehhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCHHHHHHHHHHhcCCCC---hHHHHHHhhhhhhhhhhhcccCceEEEEEEcCCCchhhHHHHHHhcCCCCCCCCCC
Q 010673          240 MTLLDPRHSLANLIYVGYGGD---PAAALRVTRKRSVDRKKQQTERNVFRCLLFGPQNAGKSALLNSFLERPFSENYAPT  316 (504)
Q Consensus       240 ~~~~~~~~~~~~l~~lg~~~~---~~~~l~~~~~~~~~~~~~~~~~~~~kI~vvG~~~vGKSSLin~l~~~~~~~~~~~T  316 (504)
                      +|++|+.++++||+|+||+.+   +.+++.++|+|..++++++..|++++|.|+|+.++|||.|++.|+++.+...+.++
T Consensus       378 ~Tlld~~~t~~~L~Ylgf~~~~~~~~~ai~vtRkr~~d~~~~~~~R~Vf~C~V~G~k~~GKs~lL~sflgr~~~~~~~~~  457 (625)
T KOG1707|consen  378 MTLLDPRRTLEYLAYLGFPTDAGSQASAIRVTRKRKLDRKKKQTDRKVFQCFVVGPKNCGKSALLQSFLGRSMSDNNTGT  457 (625)
T ss_pred             HhhccHHHHHHHHHhcCCcccccccccceehhhhhhhhhccccccceeeeEEEEcCCcCchHHHHHHHhccccccccccC
Confidence            999999999999999999977   78999999999999999999999999999999999999999999999998877788


Q ss_pred             ccceEEEEEEEcCCCcEEEEEEecCChhhHhhhhhhhhhcccccEEEEEEeCCCcccHHHHHHHHHHHHHhccCCCCCCc
Q 010673          317 TGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVP  396 (504)
Q Consensus       317 ~~~~~~~~~v~~~~~~~~~li~d~~g~~~~~~~~~~~~~~~~ad~iilV~D~s~~~s~~~~~~~~~~l~~~~~~~~~~~p  396 (504)
                      +...+.++.+... |..+++++.+++.. ...+....+  ..||+++++||++++.||..+...++....     ....|
T Consensus       458 ~~~~~avn~v~~~-g~~k~LiL~ei~~~-~~~~l~~ke--~~cDv~~~~YDsS~p~sf~~~a~v~~~~~~-----~~~~P  528 (625)
T KOG1707|consen  458 TKPRYAVNSVEVK-GQQKYLILREIGED-DQDFLTSKE--AACDVACLVYDSSNPRSFEYLAEVYNKYFD-----LYKIP  528 (625)
T ss_pred             CCCceeeeeeeec-cccceEEEeecCcc-ccccccCcc--ceeeeEEEecccCCchHHHHHHHHHHHhhh-----ccCCc
Confidence            8888999999998 88999999999875 333333333  789999999999999999998777666543     35899


Q ss_pred             EEEEEECCCCCCCccchH-HHHHHHHHhCCCCeEEEeccc-cCHHHHHHHHHHHHhCCCCCCCCcccccchhhHHhhhcc
Q 010673          397 CLLIASKDDLKPYTMAVQ-DSARVTQELGIEPPIPVSMKS-KDLNNVFSRIIWAAEHPHLNIPETETGRNRKRYRHLVNS  474 (504)
Q Consensus       397 iilV~NK~Dl~~~~~~~~-~~~~~~~~~~~~~~~~vSak~-~gi~el~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~r  474 (504)
                      |++|++|+|+.+..+... +..++|.++++++++.+|+++ .. .++|..|+..+..|+  .++.+...+.     +.++
T Consensus       529 c~~va~K~dlDe~~Q~~~iqpde~~~~~~i~~P~~~S~~~~~s-~~lf~kL~~~A~~Ph--~~~~~~~~~~-----~~~~  600 (625)
T KOG1707|consen  529 CLMVATKADLDEVPQRYSIQPDEFCRQLGLPPPIHISSKTLSS-NELFIKLATMAQYPH--IPRIEEEKSS-----LQNR  600 (625)
T ss_pred             eEEEeeccccchhhhccCCChHHHHHhcCCCCCeeeccCCCCC-chHHHHHHHhhhCCC--ccccccccch-----hhHH
Confidence            999999999988776544 569999999999999999997 55 999999999999999  6666655544     4567


Q ss_pred             hhhhhhhhhHHHHhHHHHHHHHHhh
Q 010673          475 SLVFVSVGAAVAVVGLAAYRAYAAR  499 (504)
Q Consensus       475 ~~~~~~~g~~v~~~~~~~~~~~~~~  499 (504)
                      ....++.| ++.++|.+.+..++.+
T Consensus       601 ~l~~~~~g-~~~~~g~~~~~~~~~~  624 (625)
T KOG1707|consen  601 LLMAVSGG-AVAVAGLALYKLYKAR  624 (625)
T ss_pred             HHHHHHHH-HHHHhhHHHHhhhhcc
Confidence            76777777 7777777777766543

>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF08356 EF_assoc_2: EF hand associated; InterPro: IPR013567 This region predominantly appears near EF-hands (IPR002048 from INTERPRO) in GTP-binding proteins Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PF08355 EF_assoc_1: EF hand associated; InterPro: IPR013566 This region typically appears on the C terminus of EF hands in GTP-binding proteins such as Arht/Rhot (may be involved in mitochondrial homeostasis and apoptosis[]) Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4273 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 3e-08
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 4e-08
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 5e-08
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 6e-08
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 9e-08
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-07
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 2e-07
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 2e-07
4fmc_B171 Espg-Rab1 Complex Length = 171 3e-07
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 3e-07
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 3e-07
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 5e-07
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 6e-07
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 8e-07
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 2e-06
4fmc_F117 Espg-Rab1 Complex Length = 117 1e-05
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 2e-04
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 3e-04
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 3e-04
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 4e-04
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 4e-04
2dpx_A174 Crystal Structure Of Human Rad Gtpase Length = 174 4e-04
2gjs_A176 The Crystal Structure Of Human Rrad In Complex With 4e-04
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 6e-04
3q72_A166 Crystal Structure Of Rad G-Domain-Gtp Analog Comple 7e-04
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 8e-04
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 73/163 (44%), Gaps = 11/163 (6%)
Query: 283 NVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIP 342
           ++ + LL G    GKS LL  F+E  F+ ++  T G  + +  VD  G   K  I     
Sbjct: 2   SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTAG 61
Query: 343 EEGVKKILSN--KEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLI 400
           +E  + I +   + A+      I VYD +DE ++   K+    V     D       LL+
Sbjct: 62  QERFRTITTAYYRGAMG----IILVYDITDERTFTNIKQWFKTVNEHANDEA---QLLLV 114
Query: 401 ASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKD-LNNVF 442
            +K D++   +       + +ELGI P I  S K+ D +N +F
Sbjct: 115 GNKSDMETRVVTADQGEALAKELGI-PFIESSAKNDDNVNEIF 156
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|2DPX|A Chain A, Crystal Structure Of Human Rad Gtpase Length = 174 Back     alignment and structure
>pdb|2GJS|A Chain A, The Crystal Structure Of Human Rrad In Complex With Gdp Length = 176 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|3Q72|A Chain A, Crystal Structure Of Rad G-Domain-Gtp Analog Complex Length = 166 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3t1o_A198 Gliding protein MGLA; G domain containing protein, 3e-07
2ged_A193 SR-beta, signal recognition particle receptor beta 6e-07
2fh5_B214 SR-beta, signal recognition particle receptor beta 8e-07
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-06
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-06
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 3e-06
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 3e-06
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 8e-06
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 1e-05
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 1e-05
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-05
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 3e-05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 3e-05
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 4e-05
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 5e-05
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 5e-05
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 6e-05
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 7e-05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 8e-05
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 9e-05
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 1e-04
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 1e-04
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 1e-04
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 1e-04
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 1e-04
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 1e-04
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 1e-04
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 1e-04
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 1e-04
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 1e-04
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 1e-04
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 1e-04
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 2e-04
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 2e-04
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 2e-04
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 2e-04
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 2e-04
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 2e-04
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 2e-04
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 3e-04
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 3e-04
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 3e-04
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 3e-04
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 3e-04
3llu_A196 RAS-related GTP-binding protein C; structural geno 3e-04
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 3e-04
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 4e-04
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 4e-04
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 6e-04
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 6e-04
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 7e-04
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.5 bits (143), Expect = 2e-09
 Identities = 59/399 (14%), Positives = 114/399 (28%), Gaps = 123/399 (30%)

Query: 143 KFGYGDDLE-LRDDFLPVPTKLSPDQSVELASEAVEFLRGIFGLYDIDN-----DGAVRP 196
           ++ Y D L    D F+        +   +   +  +  + I    +ID+     D     
Sbjct: 15  QYQYKDILSVFEDAFVD-------NFDCK---DVQDMPKSILSKEEIDHIIMSKDAVSGT 64

Query: 197 AELEDLFLTAPESPWDEAPYKDAAETTALGNLTLKGFV-SKWALMTLLDPRHSLANLIYV 255
             L    L+  E        +   E     N     F+ S         P  S+   +Y+
Sbjct: 65  LRLFWTLLSKQEEM-----VQKFVEEVLRINY---KFLMSPIKTEQR-QP--SMMTRMYI 113

Query: 256 GY------GGDPAAALRVTRKRSVDR-----KKQQTERNVFRCLLFGPQNAGKSAL---- 300
                        A   V+R +   +      + +  +NV    + G   +GK+ +    
Sbjct: 114 EQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVL---IDGVLGSGKTWVALDV 170

Query: 301 LNSF-LERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASC 359
             S+ ++            + + +N+      N  +        E V ++L         
Sbjct: 171 CLSYKVQCKMD-------FKIFWLNL-----KNCNS-------PETVLEMLQKLLYQIDP 211

Query: 360 DVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQDS--- 416
           + T    D S      R   +  E+ RL +   Y   CLL+    +       VQ++   
Sbjct: 212 NWTSRS-DHSSNIK-LRIHSIQAELRRLLKSKPY-ENCLLVL--LN-------VQNAKAW 259

Query: 417 ---------------ARVTQELGIEPPIPVSM----------KSKDLNNVFSRIIWAAE- 450
                           +VT  L       +S+          + K L     + +     
Sbjct: 260 NAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSL---LLKYLDCRPQ 316

Query: 451 ---------HP-HLN-IPE-TETGRNR-KRYRHLVNSSL 476
                    +P  L+ I E    G      ++H+    L
Sbjct: 317 DLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKL 355
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.96
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.93
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.92
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.92
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.92
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.92
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.92
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.92
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.92
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.92
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.92
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.92
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.92
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.92
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.92
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.92
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.92
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.92
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.92
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.92
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.92
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.92
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.92
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.92
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.92
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.91
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.91
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.91
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.91
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.91
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.91
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.91
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.91
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.91
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.91
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.91
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.91
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.91
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.91
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.91
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.91
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.91
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.91
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.91
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.91
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.91
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.91
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.91
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.91
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.91
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.91
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.91
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.91
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.91
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.91
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.9
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.9
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.9
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.9
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.9
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.9
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.9
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.9
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.9
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.9
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.9
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.9
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.9
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.9
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.9
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.9
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.89
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.89
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.89
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.89
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.89
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.89
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.88
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.88
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.88
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.88
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.88
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.88
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.88
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.87
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.87
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.87
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.87
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.87
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.87
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.87
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.86
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.86
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.85
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.76
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.85
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.85
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.85
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.85
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.84
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.83
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.83
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.83
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.83
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.82
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.82
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.82
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.82
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.82
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.82
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.82
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.81
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.81
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.81
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.81
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.8
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.8
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.8
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.8
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.8
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.79
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.79
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.78
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.78
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.78
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.78
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.77
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.77
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.77
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.76
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.76
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.75
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.74
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.73
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.73
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.73
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.73
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.73
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.73
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.73
3fwb_A161 Cell division control protein 31; gene gating, com 99.72
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.71
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.71
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.7
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.7
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.7
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.7
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.69
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.69
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.69
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.69
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.68
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.68
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.68
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.68
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.68
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.67
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.67
1y1x_A191 Leishmania major homolog of programmed cell death 99.67
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.67
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.67
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.66
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.66
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.66
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.66
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.66
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.66
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.66
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.65
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.64
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.64
2ged_A193 SR-beta, signal recognition particle receptor beta 99.64
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.63
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.63
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.63
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.63
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.62
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.62
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.62
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.62
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.62
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.62
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.62
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.61
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.61
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.61
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.61
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.61
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.6
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.6
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.6
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.6
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.6
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.6
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.59
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.59
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.59
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.59
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.58
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.58
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.58
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.58
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.57
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.57
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.56
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.56
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.56
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.56
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.56
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.56
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.55
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.54
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.54
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.53
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.53
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.53
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.52
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.52
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.52
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.51
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.51
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.5
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.5
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.5
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.5
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.49
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.49
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.49
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.49
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.49
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.48
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.48
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.48
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.48
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.47
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.47
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.47
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.47
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.47
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.47
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.46
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.46
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.46
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.45
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.45
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.45
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.45
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.44
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.43
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.43
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.43
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.42
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.42
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.41
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.4
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.4
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.39
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.39
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.39
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.39
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.38
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.36
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.36
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.36
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.35
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.35
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.33
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.32
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.31
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.3
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.29
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.29
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.29
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.28
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.26
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.26
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.26
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.24
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.24
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.24
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.23
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.22
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.18
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.17
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.17
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.16
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.16
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.15
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.15
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.14
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.13
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.12
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.12
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.12
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.11
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.1
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.1
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.09
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.09
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.08
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.07
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.07
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.07
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.07
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.06
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.06
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.05
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.05
1y1x_A191 Leishmania major homolog of programmed cell death 99.04
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.04
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.04
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.03
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.03
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.02
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.02
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.02
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.01
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.01
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.0
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.0
1c07_A95 Protein (epidermal growth factor receptor pathway 99.0
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.99
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.97
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.97
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.96
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.95
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.93
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.92
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.91
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.9
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.9
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.89
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.88
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.86
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.86
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.85
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.85
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.85
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.84
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.83
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.82
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.81
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.79
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.79
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.79
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.78
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.78
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.78
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.78
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.77
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.76
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.74
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.74
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.74
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.74
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.71
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.71
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.71
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.71
3li6_A66 Calcium-binding protein; calcium signaling protein 98.7
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.69
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.69
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.68
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.68
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.67
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.67
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.66
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.66
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.66
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.65
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.65
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.65
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.65
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.65
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.64
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.64
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.64
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.63
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.63
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.63
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.62
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.62
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.61
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.61
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.6
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.6
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.59
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.58
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.58
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.57
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.57
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.57
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.56
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.54
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.54
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.53
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.52
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.51
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.51
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.5
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.5
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.49
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.48
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.48
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.45
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.45
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.45
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.44
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.42
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.41
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.41
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.41
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.4
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.4
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.39
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.36
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.36
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.35
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.35
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.35
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.35
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.34
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.34
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.34
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.34
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.33
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.33
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.33
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.32
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.32
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.31
3fwb_A161 Cell division control protein 31; gene gating, com 98.31
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.31
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.29
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.29
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.28
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.28
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.28
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.27
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.27
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.27
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.27
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.27
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.26
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.26
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.26
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.26
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.25
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.24
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.23
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.22
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.22
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.22
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.22
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.22
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.21
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.21
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.2
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.19
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.16
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.14
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.13
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.12
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.11
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.1
3li6_A66 Calcium-binding protein; calcium signaling protein 98.1
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.1
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.08
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.06
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.05
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.04
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.03
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.02
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.02
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.02
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.0
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.97
1c07_A95 Protein (epidermal growth factor receptor pathway 97.97
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.97
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.97
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 97.96
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.93
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 97.91
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.89
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.89
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.89
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.86
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 97.86
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.86
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.86
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.96  E-value=1.8e-28  Score=229.79  Aligned_cols=163  Identities=20%  Similarity=0.346  Sum_probs=136.1

Q ss_pred             ceEEEEEEcCCCchhhHHHHHHhcCCCCCCCCCCccceEEEEEEEcCCCcEEEEEEecCChhhHhhhhhhhhhcccccEE
Q 010673          283 NVFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVT  362 (504)
Q Consensus       283 ~~~kI~vvG~~~vGKSSLin~l~~~~~~~~~~~T~~~~~~~~~v~~~~~~~~~li~d~~g~~~~~~~~~~~~~~~~ad~i  362 (504)
                      +.+||+|+|++|||||||+++|+.+.|...+.||++.++..+.+.+++....+.+||++|++.+..+.  ..+++.+|++
T Consensus        12 k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~--~~~~~~a~~~   89 (216)
T 4dkx_A           12 RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLI--PSYIRDSAAA   89 (216)
T ss_dssp             -CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGH--HHHHTTCSEE
T ss_pred             CcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHH--HHHhccccEE
Confidence            45899999999999999999999999999999999988888888888666677899999999988887  5689999999


Q ss_pred             EEEEeCCCcccHHHHHHHHHHHHHhccCCCCCCcEEEEEECCCCCCCccchH-HHHHHHHHhCCCCeEEEeccc-cCHHH
Q 010673          363 IFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAVQ-DSARVTQELGIEPPIPVSMKS-KDLNN  440 (504)
Q Consensus       363 ilV~D~s~~~s~~~~~~~~~~l~~~~~~~~~~~piilV~NK~Dl~~~~~~~~-~~~~~~~~~~~~~~~~vSak~-~gi~e  440 (504)
                      ++|||++++.||+.+..|+..+....   .+++|+++||||+|+...+++.. ++++++++++++ +++|||++ .||++
T Consensus        90 ilv~di~~~~Sf~~i~~~~~~i~~~~---~~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~-~~e~SAktg~nV~e  165 (216)
T 4dkx_A           90 VVVYDITNVNSFQQTTKWIDDVRTER---GSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVM-FIETSAKAGYNVKQ  165 (216)
T ss_dssp             EEEEETTCHHHHHTHHHHHHHHHHHH---TTSSEEEEEEECTTCGGGCCSCHHHHHHHHHHHTCE-EEEEBTTTTBSHHH
T ss_pred             EEEeecchhHHHHHHHHHHHHHHHhc---CCCCeEEEEeeccchHhcCcccHHHHhhHHHHhCCe-eEEEeCCCCcCHHH
Confidence            99999999999999999999987663   45899999999999988776654 899999999997 99999999 99999


Q ss_pred             HHHHHHHHHhC
Q 010673          441 VFSRIIWAAEH  451 (504)
Q Consensus       441 l~~~l~~~~~~  451 (504)
                      +|+.|++.+..
T Consensus       166 ~F~~i~~~i~~  176 (216)
T 4dkx_A          166 LFRRVAAALPG  176 (216)
T ss_dssp             HHHHHHHHC--
T ss_pred             HHHHHHHHHHh
Confidence            99999998754
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 504
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-15
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-12
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-12
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 3e-12
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-11
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 7e-11
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 9e-11
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 9e-11
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 1e-10
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 1e-09
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 1e-09
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-09
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 5e-09
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 5e-09
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 7e-09
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 1e-08
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 2e-08
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 3e-08
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-08
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 4e-08
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 3e-04
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 4e-08
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 5e-08
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 6e-08
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 6e-08
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 7e-08
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 0.001
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 9e-08
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9e-08
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-07
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 5e-07
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 8e-07
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 9e-07
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 3e-06
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 4e-06
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 6e-06
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 1e-05
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 1e-05
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 1e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 1e-05
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-05
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-05
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 3e-05
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 4e-05
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 4e-05
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 6e-05
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 7e-05
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 8e-05
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 9e-05
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 9e-05
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 9e-05
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 1e-04
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 1e-04
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-04
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 3e-04
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 3e-04
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-04
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 0.002
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 0.002
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 0.002
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 0.002
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 0.003
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.003
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.004
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab11b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 70.7 bits (172), Expect = 5e-15
 Identities = 35/164 (21%), Positives = 61/164 (37%), Gaps = 6/164 (3%)

Query: 284 VFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPE 343
           +F+ +L G    GKS LL+ F    F+     T G ++A   +   G   K  I     +
Sbjct: 4   LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQ 63

Query: 344 EGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASK 403
           E  ++I             + VYD +   +++  +  L E+    +     +  +L+ +K
Sbjct: 64  ERYRRI--TSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADS---NIVIMLVGNK 118

Query: 404 DDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKD-LNNVFSRII 446
            DL+       D AR   E      I  S      +   F  I+
Sbjct: 119 SDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNIL 162
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.94
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.94
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.94
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.93
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.93
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.93
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.93
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.92
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.92
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.92
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.9
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.89
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.88
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.87
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.86
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.83
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.82
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.79
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.78
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.78
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.77
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.76
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.75
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.75
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.75
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.74
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.73
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.73
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.72
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.72
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.71
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.71
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.71
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.71
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.7
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.69
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.68
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.68
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.67
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.67
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.65
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.63
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.63
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.63
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.63
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.62
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.62
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.62
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.57
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.57
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.56
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.54
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.52
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.52
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.52
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.5
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.47
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.47
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.47
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.46
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.45
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.45
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.42
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.42
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.41
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.4
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.4
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.4
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.39
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.39
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.38
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.37
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.37
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.36
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.35
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.31
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.3
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.26
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.24
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.17
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.17
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.16
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.14
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.14
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.12
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.1
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.09
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.08
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.06
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.06
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.04
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.03
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.02
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.01
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.99
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.99
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.94
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.94
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.93
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.86
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.86
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.83
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.82
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.82
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.81
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.79
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.78
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.77
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.74
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.71
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.71
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.71
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.71
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.7
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.68
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.67
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.67
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.66
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.66
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.66
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.62
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.61
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.6
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.59
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.58
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.57
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.57
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.56
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.54
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.53
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.52
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.51
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.48
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.48
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.47
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.46
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.44
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.43
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.43
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.43
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.39
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.39
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.38
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.38
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.38
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.36
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.36
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.36
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.36
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.36
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.36
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.35
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.34
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.33
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.3
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.29
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.29
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.28
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.26
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.24
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.2
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.19
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.15
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.14
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.14
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.1
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.03
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.03
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.01
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.98
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.98
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.98
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.96
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.95
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.94
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.87
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 97.81
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 97.79
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.77
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 97.72
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 97.68
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.67
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.65
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.62
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 97.61
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.6
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.6
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.57
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.55
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 97.52
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.51
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.5
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.43
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.38
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.37
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.29
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.24
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.24
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.23
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.0
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 96.93
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 96.86
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.79
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.57
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.55
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 96.55
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.3
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.01
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.88
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.88
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 95.7
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.62
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.45
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.44
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.38
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.3
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 95.23
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.2
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.16
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.13
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.12
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.09
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.08
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.07
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.04
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 94.97
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.81
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.76
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.74
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.65
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.63
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.62
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.61
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.58
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.47
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.47
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.44
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.42
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.39
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.39
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.34
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.32
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.31
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.3
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.26
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.22
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 94.11
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.11
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.09
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.07
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.99
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.94
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.89
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.72
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.68
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.65
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 93.62
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.6
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.6
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.59
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.58
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.47
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.4
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.37
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.35
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.24
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.18
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 93.07
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.02
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.99
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.92
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.82
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.81
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.8
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.73
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.72
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.71
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 92.57
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.53
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.24
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 92.09
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.94
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.94
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.9
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.65
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.54
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 91.51
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.41
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.37
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.34
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.09
d1vmaa2213 GTPase domain of the signal recognition particle r 89.98
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.95
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.67
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.61
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 89.37
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.36
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.26
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.23
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.86
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.75
d1okkd2207 GTPase domain of the signal recognition particle r 88.33
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.31
d2qy9a2211 GTPase domain of the signal recognition particle r 88.03
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.83
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 87.52
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.45
d1ls1a2207 GTPase domain of the signal sequence recognition p 87.34
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.32
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.29
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 86.84
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 86.63
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 86.54
d1svma_362 Papillomavirus large T antigen helicase domain {Si 86.4
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.19
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.16
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.79
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 85.79
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.19
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.04
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.85
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 84.75
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 84.56
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.53
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.43
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.38
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 84.25
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 84.16
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 84.07
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.83
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.79
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.21
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 83.16
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.12
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 82.95
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 82.38
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 82.24
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.97
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 81.55
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 80.5
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.42
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 80.27
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 80.25
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=6.7e-28  Score=214.24  Aligned_cols=160  Identities=16%  Similarity=0.270  Sum_probs=139.8

Q ss_pred             eEEEEEEcCCCchhhHHHHHHhcCCCCCCCCCCccceEEEEEEEcCCCcEEEEEEecCChhhHhhhhhhhhhcccccEEE
Q 010673          284 VFRCLLFGPQNAGKSALLNSFLERPFSENYAPTTGEQYAVNVVDQPGGNKKTLILQEIPEEGVKKILSNKEALASCDVTI  363 (504)
Q Consensus       284 ~~kI~vvG~~~vGKSSLin~l~~~~~~~~~~~T~~~~~~~~~v~~~~~~~~~li~d~~g~~~~~~~~~~~~~~~~ad~ii  363 (504)
                      .+||+++|++|||||||+++|+++.+...+.||.+.++....+...+......+||++|.+.+..+.  ..+++.+|+++
T Consensus         2 ~iKv~liG~~~vGKSsLi~rl~~~~~~~~~~~ti~~~~~~~~~~~~~~~~~~~i~d~~g~~~~~~~~--~~~~~~~~~~i   79 (164)
T d1z2aa1           2 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAIT--KAYYRGAQACV   79 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHHCCCCCCSSCCCSSSEEEEEEEETTEEEEEEEECCTTGGGTTCCC--HHHHTTCCEEE
T ss_pred             eEEEEEECCCCcCHHHHHHHHHhCCCCcccccccccccceeeeeecCceeeeeeeccCCccchhhhh--hhhhccCceEE
Confidence            3799999999999999999999999988888999877777777777555566778888887776665  56889999999


Q ss_pred             EEEeCCCcccHHHHHHHHHHHHHhccCCCCCCcEEEEEECCCCCCCccch-HHHHHHHHHhCCCCeEEEeccc-cCHHHH
Q 010673          364 FVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCLLIASKDDLKPYTMAV-QDSARVTQELGIEPPIPVSMKS-KDLNNV  441 (504)
Q Consensus       364 lV~D~s~~~s~~~~~~~~~~l~~~~~~~~~~~piilV~NK~Dl~~~~~~~-~~~~~~~~~~~~~~~~~vSak~-~gi~el  441 (504)
                      +|||++++.||+.+..|+.++.+.    .+++|+++||||+|+.+++++. +++++++++++++ +++|||++ .||+++
T Consensus        80 ~v~d~~~~~s~~~~~~~~~~i~~~----~~~~~iilVgnK~Dl~~~~~v~~~~~~~~~~~~~~~-~~e~Sak~g~~v~e~  154 (164)
T d1z2aa1          80 LVFSTTDRESFEAISSWREKVVAE----VGDIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKLR-FYRTSVKEDLNVSEV  154 (164)
T ss_dssp             EEEETTCHHHHHTHHHHHHHHHHH----HCSCCEEEEEECGGGGGGCSSCHHHHHHHHHHHTCE-EEECBTTTTBSSHHH
T ss_pred             EEEeccchhhhhhccccccccccc----CCCceEEEeeccCCcccceeeeehhhHHHHHHcCCE-EEEeccCCCcCHHHH
Confidence            999999999999999999999876    4589999999999998776664 4889999999996 99999999 999999


Q ss_pred             HHHHHHHHh
Q 010673          442 FSRIIWAAE  450 (504)
Q Consensus       442 ~~~l~~~~~  450 (504)
                      |+.|++.+.
T Consensus       155 f~~l~~~~l  163 (164)
T d1z2aa1         155 FKYLAEKHL  163 (164)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHh
Confidence            999998764
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure