Citrus Sinensis ID: 010679
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 504 | ||||||
| 255581346 | 467 | conserved hypothetical protein [Ricinus | 0.886 | 0.957 | 0.572 | 1e-142 | |
| 224127348 | 482 | predicted protein [Populus trichocarpa] | 0.940 | 0.983 | 0.562 | 1e-135 | |
| 147771156 | 562 | hypothetical protein VITISV_025050 [Viti | 0.734 | 0.658 | 0.690 | 1e-135 | |
| 225451915 | 421 | PREDICTED: uncharacterized protein LOC10 | 0.736 | 0.881 | 0.681 | 1e-133 | |
| 449447462 | 398 | PREDICTED: uncharacterized protein LOC10 | 0.704 | 0.891 | 0.622 | 1e-125 | |
| 356526605 | 418 | PREDICTED: uncharacterized protein LOC10 | 0.738 | 0.889 | 0.596 | 1e-120 | |
| 356567168 | 404 | PREDICTED: uncharacterized protein LOC10 | 0.672 | 0.839 | 0.577 | 1e-106 | |
| 297838451 | 364 | hypothetical protein ARALYDRAFT_475814 [ | 0.623 | 0.862 | 0.591 | 4e-96 | |
| 30697468 | 359 | uncharacterized protein [Arabidopsis tha | 0.623 | 0.874 | 0.583 | 8e-95 | |
| 4204281 | 346 | Hypothetical protein [Arabidopsis thalia | 0.601 | 0.875 | 0.582 | 6e-92 |
| >gi|255581346|ref|XP_002531483.1| conserved hypothetical protein [Ricinus communis] gi|223528910|gb|EEF30907.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 512 bits (1318), Expect = e-142, Method: Compositional matrix adjust.
Identities = 300/524 (57%), Positives = 347/524 (66%), Gaps = 77/524 (14%)
Query: 1 MGSKGRIPPPH-LRRPPPGPGMMHPDPFVSGMRPPMPGAFPPFDMMPPPEVMEQKIASQH 59
MGSKGRIPPPH LRRP PG G+MHPDPF G+ P PG FP FDM+PPPEV+EQK+A Q
Sbjct: 1 MGSKGRIPPPHHLRRPLPGGGIMHPDPFGPGVHGPPPGPFPAFDMLPPPEVLEQKLAGQQ 60
Query: 60 VEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMKSERELQMRNLTEKIAKME 119
VE+Q+LATENQRLAATH TLRQELAAAQ ELQ+LH IG +K+ERE QMR L +KIAKME
Sbjct: 61 VEIQRLATENQRLAATHVTLRQELAAAQQELQMLHNDIGVLKAEREQQMRGLMDKIAKME 120
Query: 120 AELKTAEPVKLEFQKSKTEAQNLVVAREELIAKVHQLTQDLQRAHTDVQQIPALLSELES 179
ELK AEPV+ E Q+++TEA+ LVVAR+EL+ KVHQLTQDL RAH DVQQIP L+SEL+S
Sbjct: 121 TELKAAEPVRSELQQARTEAEKLVVARQELMTKVHQLTQDLHRAHADVQQIPILISELDS 180
Query: 180 LRQEYHHCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELMNAPNVDRRAADG 239
LRQEY CR +++YEKK ++DH ESLQVME NY+TMA EVEKL EL N NVD R G
Sbjct: 181 LRQEYQRCRVSFDYEKKLFSDHRESLQVMENNYVTMAREVEKLHLELTNTSNVDIRTVTG 240
Query: 240 S-YGGATGNSENETSGRPVGQNAYEDGYGV--PQGHGPPP----------SATTAGVVGA 286
YGGATGN+ENETS R VG+N YED YGV QGH P P + + + A
Sbjct: 241 GPYGGATGNNENETSSRSVGENKYEDSYGVSQSQGHTPIPGNSGSAAATAAGSASTGAKA 300
Query: 287 GPNTSTSAYAATQSGT-PMRAAYDIPRGPGYEASKGPGYDASKAPSYDPTKGPSYDPAKG 345
G T Y QSG+ R+AYD PRGP YEA+KGP YD S +G
Sbjct: 301 GTGAGTPTYTGAQSGSASTRSAYDTPRGPNYEATKGPSYDVS----------------RG 344
Query: 346 PGYDPTKGPGYDAQKGSNYDAQRGPNYDIHRGPSYDPQRGLGYDMQRGPNYDMQRGPGYE 405
GYD ++G YDAQ+G +YDAQRGP Y++ RGPSYD Q QR P YD+QR PGY
Sbjct: 345 SGYDLSRGAAYDAQRGHSYDAQRGPGYNMQRGPSYDAQ-------QRVPGYDVQRIPGY- 396
Query: 406 TQRVPGYDVQRGPVYEAQRAPSYIPQRGPGYDLQRGQGYDMRRAPSYDPSRGTGFDGAPR 465
R PGYDVQ+GP Y+A SR G+D A R
Sbjct: 397 APRTPGYDVQQGPHYDA--------------------------------SRVAGYDPAAR 424
Query: 466 GAA--PHGQVPPPLNNVPYGSATPPARSGSG---QPRGGNPARR 504
G A PHGQ+ P NNVPYGSATP R+ SG Q RGGNP RR
Sbjct: 425 GTAVPPHGQMTPA-NNVPYGSATPSTRAVSGYEAQARGGNPVRR 467
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224127348|ref|XP_002329255.1| predicted protein [Populus trichocarpa] gi|222870709|gb|EEF07840.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147771156|emb|CAN65241.1| hypothetical protein VITISV_025050 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225451915|ref|XP_002282805.1| PREDICTED: uncharacterized protein LOC100244706 [Vitis vinifera] gi|298204399|emb|CBI16879.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449447462|ref|XP_004141487.1| PREDICTED: uncharacterized protein LOC101210432 [Cucumis sativus] gi|449481420|ref|XP_004156177.1| PREDICTED: uncharacterized protein LOC101226645 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356526605|ref|XP_003531907.1| PREDICTED: uncharacterized protein LOC100802139 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356567168|ref|XP_003551793.1| PREDICTED: uncharacterized protein LOC100783811 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297838451|ref|XP_002887107.1| hypothetical protein ARALYDRAFT_475814 [Arabidopsis lyrata subsp. lyrata] gi|297332948|gb|EFH63366.1| hypothetical protein ARALYDRAFT_475814 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30697468|ref|NP_176888.2| uncharacterized protein [Arabidopsis thaliana] gi|29028878|gb|AAO64818.1| At1g67170 [Arabidopsis thaliana] gi|110736466|dbj|BAF00201.1| hypothetical protein [Arabidopsis thaliana] gi|332196487|gb|AEE34608.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|4204281|gb|AAD10662.1| Hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 504 | ||||||
| TAIR|locus:2033681 | 359 | AT1G67170 "AT1G67170" [Arabido | 0.623 | 0.874 | 0.567 | 9.9e-87 | |
| TAIR|locus:2089616 | 331 | AT3G14750 "AT3G14750" [Arabido | 0.472 | 0.719 | 0.380 | 2.9e-39 | |
| TAIR|locus:2035751 | 283 | AT1G55170 "AT1G55170" [Arabido | 0.452 | 0.805 | 0.356 | 6.9e-31 | |
| TAIR|locus:2156146 | 238 | AT5G61920 "AT5G61920" [Arabido | 0.363 | 0.768 | 0.349 | 2.2e-25 | |
| FB|FBgn0085362 | 578 | Vml "Vitelline membrane-like" | 0.529 | 0.461 | 0.295 | 3.4e-22 | |
| TAIR|locus:2060848 | 288 | AT2G30120 [Arabidopsis thalian | 0.456 | 0.798 | 0.276 | 1.6e-17 | |
| UNIPROTKB|A2VD00 | 1424 | eif3a "Eukaryotic translation | 0.779 | 0.275 | 0.262 | 1.2e-11 | |
| UNIPROTKB|A4II09 | 1391 | eif3a "Eukaryotic translation | 0.367 | 0.132 | 0.303 | 1.3e-14 | |
| UNIPROTKB|F1S187 | 406 | LOC100518332 "Uncharacterized | 0.418 | 0.519 | 0.315 | 1.4e-13 | |
| UNIPROTKB|P11414 | 467 | POLR2A "DNA-directed RNA polym | 0.416 | 0.449 | 0.292 | 6e-10 |
| TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 867 (310.3 bits), Expect = 9.9e-87, P = 9.9e-87
Identities = 189/333 (56%), Positives = 229/333 (68%)
Query: 30 GMRPPMP--GAFPPFDMMPPPEVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQ 87
G PP G +P F+M+PPPEVMEQK +QH E+Q+LA ENQRL THG+LRQELAAAQ
Sbjct: 35 GAIPPSAAQGVYPSFNMLPPPEVMEQKFVAQHGELQRLAIENQRLGGTHGSLRQELAAAQ 94
Query: 88 HELQILHGQIGGMKSERELQMRNLTEKIAKMEAELKTAEPVKLEFQKSKTEAQNLVVARE 147
HE+Q+LH QIG MKSERE +M L EK+AKME EL+ +E VKLE Q+++ EA++LVVARE
Sbjct: 95 HEIQMLHAQIGSMKSEREQRMMGLAEKVAKMETELQKSEAVKLEMQQARAEARSLVVARE 154
Query: 148 ELIAKVHQLTQDLQRAHTDVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESLQV 207
EL++KVHQLTQ+LQ++ +DVQQIPAL+SELE+LRQEY CR TY+YEKKFYNDHLESLQ
Sbjct: 155 ELMSKVHQLTQELQKSRSDVQQIPALMSELENLRQEYQQCRATYDYEKKFYNDHLESLQA 214
Query: 208 MEKNYITMATEVEKLRAELMNAPNVDRRAADGSYGGATGNSENETSGRPVGQNAYEDGYG 267
MEKNY+TMA EVEKL+A+LMN N DRRA G YG N+E + SG G YED +G
Sbjct: 215 MEKNYMTMAREVEKLQAQLMNNANSDRRAG-GPYGNNI-NAEIDASGHQSGNGYYEDAFG 272
Query: 268 VPQGHGPPPSATTAGVVGAGPNTSTSA----Y-AATQSGT-PMRAAYDIPRGPGYEASKG 321
PQG+ P P A A GPN+ A Y TQ G P R Y+ PRGP S
Sbjct: 273 -PQGYIPQPVAGNA----TGPNSVVGAAQYPYQGVTQPGYFPQRPGYNFPRGP--PGSYD 325
Query: 322 PGYDASKAPSYDP-TKGPSYD-PAKGPGYDPTK 352
P P P GPS + P G +P++
Sbjct: 326 PTTRLPTGPYGAPFPPGPSNNTPYAGTHGNPSR 358
|
|
| TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0085362 Vml "Vitelline membrane-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VD00 eif3a "Eukaryotic translation initiation factor 3 subunit A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4II09 eif3a "Eukaryotic translation initiation factor 3 subunit A" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S187 LOC100518332 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11414 POLR2A "DNA-directed RNA polymerase II subunit RPB1" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 504 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-08 | |
| pfam13851 | 201 | pfam13851, GAS, Growth-arrest specific micro-tubul | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-05 | |
| pfam07926 | 132 | pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-05 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 5e-05 | |
| pfam10473 | 140 | pfam10473, Cenp-F_leu_zip, Leucine-rich repeats of | 6e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 8e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-04 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 3e-04 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 3e-04 | |
| pfam06160 | 559 | pfam06160, EzrA, Septation ring formation regulato | 3e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| pfam06160 | 559 | pfam06160, EzrA, Septation ring formation regulato | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.001 | |
| PRK04778 | 569 | PRK04778, PRK04778, septation ring formation regul | 0.001 | |
| pfam09789 | 319 | pfam09789, DUF2353, Uncharacterized coiled-coil pr | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.002 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| pfam10481 | 288 | pfam10481, Cenp-F_N, Cenp-F N-terminal domain | 0.003 | |
| COG3883 | 265 | COG3883, COG3883, Uncharacterized protein conserve | 0.003 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.003 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 0.003 | |
| COG0497 | 557 | COG0497, RecN, ATPase involved in DNA repair [DNA | 0.003 | |
| pfam09730 | 711 | pfam09730, BicD, Microtubule-associated protein Bi | 0.003 | |
| COG1322 | 448 | COG1322, COG1322, Predicted nuclease of restrictio | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| pfam12329 | 74 | pfam12329, TMF_DNA_bd, TATA element modulatory fac | 0.004 | |
| smart00935 | 140 | smart00935, OmpH, Outer membrane protein (OmpH-lik | 0.004 | |
| TIGR03007 | 498 | TIGR03007, pepcterm_ChnLen, polysaccharide chain l | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 56.3 bits (136), Expect = 3e-08
Identities = 37/166 (22%), Positives = 72/166 (43%), Gaps = 13/166 (7%)
Query: 49 EVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMKSERE--- 105
E E+ +++L + L L ELA ++EL+ L +I ++ E
Sbjct: 358 EAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLS 417
Query: 106 LQMRNLTEKIAKMEAELKTAEPVKLEFQKSKTEAQNLVVAREELIAKVHQLTQDLQRAHT 165
++ +L E++ ++EAEL+ + E ++ E + L EEL ++ +L ++L
Sbjct: 418 ERLEDLKEELKELEAELEELQT---ELEELNEELEELEEQLEELRDRLKELERELAELQE 474
Query: 166 DVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESLQVMEKN 211
++Q+ L EL SL E E++ L+ +E
Sbjct: 475 ELQR---LEKELSSLEARL----DRLEAEQRASQGVRAVLEALESG 513
|
Length = 1163 |
| >gnl|CDD|222417 pfam13851, GAS, Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|149160 pfam07926, TPR_MLP1_2, TPR/MLP1/MLP2-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|151039 pfam10473, Cenp-F_leu_zip, Leucine-rich repeats of kinetochore protein Cenp-F/LEK1 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|114855 pfam06160, EzrA, Septation ring formation regulator, EzrA | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|179877 PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220404 pfam09789, DUF2353, Uncharacterized coiled-coil protein (DUF2353) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|119001 pfam10481, Cenp-F_N, Cenp-F N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|226400 COG3883, COG3883, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|220368 pfam09730, BicD, Microtubule-associated protein Bicaudal-D | Back alignment and domain information |
|---|
| >gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding | Back alignment and domain information |
|---|
| >gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|234084 TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 504 | |||
| PRK11637 | 428 | AmiB activator; Provisional | 99.07 | |
| PRK11637 | 428 | AmiB activator; Provisional | 99.02 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 99.01 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.99 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.92 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.91 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.89 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.89 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.89 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.89 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.88 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.85 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.82 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.81 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.77 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.75 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.75 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.74 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.72 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.71 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.7 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.68 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.68 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 98.67 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.66 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.66 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.65 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.63 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.63 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.63 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.62 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.62 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.62 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.62 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.61 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.61 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.61 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.6 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.57 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.57 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.57 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.57 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.57 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.54 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.53 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 98.48 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.48 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.48 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.48 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.47 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 98.47 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.46 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.45 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.45 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.45 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.44 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 98.43 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.41 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.39 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 98.38 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 98.37 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.36 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.34 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 98.34 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.33 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.32 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 98.32 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.32 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.32 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 98.32 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 98.32 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.31 | |
| KOG1999 | 1024 | consensus RNA polymerase II transcription elongati | 98.31 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 98.3 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 98.29 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.29 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.29 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 98.28 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.28 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.27 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.27 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.25 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.24 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.23 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 98.23 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.23 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 98.23 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.22 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 98.21 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 98.21 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 98.2 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 98.2 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 98.2 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 98.2 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 98.2 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 98.19 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.19 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.18 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 98.18 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 98.18 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.17 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 98.17 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.16 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.16 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 98.16 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.16 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.15 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 98.14 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 98.14 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 98.14 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 98.13 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.13 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.12 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.11 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 98.11 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 98.1 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 98.09 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 98.09 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 98.07 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 98.06 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 98.06 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.06 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 98.04 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 98.04 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 98.04 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 98.04 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 98.03 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 98.03 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 98.03 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.03 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 98.02 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.01 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 98.01 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.99 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 97.99 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 97.98 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.98 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 97.98 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.98 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.97 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 97.97 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.97 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.96 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.96 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 97.95 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.95 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.94 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 97.93 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.91 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 97.9 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 97.9 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.9 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.89 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.89 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 97.89 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 97.89 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.87 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 97.87 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.87 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 97.85 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 97.85 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.85 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.84 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 97.84 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.83 | |
| PF13514 | 1111 | AAA_27: AAA domain | 97.83 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 97.83 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.82 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.81 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 97.81 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.8 | |
| KOG0260 | 1605 | consensus RNA polymerase II, large subunit [Transc | 97.8 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.8 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 97.79 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.79 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 97.79 | |
| PF12815 | 123 | CTD: Spt5 C-terminal nonapeptide repeat binding Sp | 97.78 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 97.78 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.78 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 97.77 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 97.77 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 97.77 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.77 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 97.76 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 97.74 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.74 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 97.73 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 97.7 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 97.69 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 97.67 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.66 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.66 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 97.66 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 97.64 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 97.64 | |
| PF13166 | 712 | AAA_13: AAA domain | 97.64 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 97.64 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.62 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 97.61 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 97.6 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 97.6 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 97.59 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 97.59 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.59 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 97.58 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 97.58 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 97.57 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 97.57 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 97.57 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 97.56 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 97.56 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 97.55 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 97.55 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.55 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 97.54 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 97.54 | |
| PF12815 | 123 | CTD: Spt5 C-terminal nonapeptide repeat binding Sp | 97.53 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.53 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 97.53 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 97.53 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 97.52 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 97.51 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 97.51 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.51 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.5 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.5 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 97.5 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 97.49 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 97.49 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 97.49 | |
| PF13166 | 712 | AAA_13: AAA domain | 97.46 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.45 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 97.44 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 97.42 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 97.42 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.41 | |
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 97.41 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 97.4 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 97.4 | |
| PF00015 | 213 | MCPsignal: Methyl-accepting chemotaxis protein (MC | 97.4 | |
| cd07664 | 234 | BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S | 97.4 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.4 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.39 | |
| PF03915 | 424 | AIP3: Actin interacting protein 3; InterPro: IPR02 | 97.39 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 97.39 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 97.39 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 97.39 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 97.39 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 97.37 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.37 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 97.36 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 97.35 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 97.35 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 97.35 | |
| cd07667 | 240 | BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of | 97.35 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.33 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.33 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 97.33 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 97.32 | |
| PF01442 | 202 | Apolipoprotein: Apolipoprotein A1/A4/E domain; Int | 97.32 | |
| smart00806 | 426 | AIP3 Actin interacting protein 3. Aip3p/Bud6p is a | 97.3 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 97.3 | |
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 97.29 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 97.29 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 97.29 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 97.28 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 97.28 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 97.27 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.27 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 97.27 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 97.26 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 97.25 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 97.24 | |
| cd07627 | 216 | BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of | 97.24 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 97.24 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 97.23 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 97.22 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 97.2 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 97.19 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 97.18 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 97.16 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 97.16 | |
| KOG3958 | 371 | consensus Putative dynamitin [Cytoskeleton] | 97.14 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 97.14 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 97.11 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 97.11 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 97.11 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 97.08 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 97.08 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 97.07 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.07 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 97.06 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 97.05 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 97.05 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 97.05 | |
| cd07624 | 200 | BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o | 97.04 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 97.04 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 97.03 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 97.02 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 97.02 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 97.01 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 97.01 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 97.01 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 97.01 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 97.01 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 97.01 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 97.0 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 97.0 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 96.99 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 96.99 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 96.98 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 96.96 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 96.95 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 96.94 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 96.93 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 96.91 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 96.89 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 96.89 | |
| KOG0992 | 613 | consensus Uncharacterized conserved protein [Funct | 96.89 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 96.88 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 96.88 | |
| COG1322 | 448 | Predicted nuclease of restriction endonuclease-lik | 96.86 | |
| KOG1655 | 218 | consensus Protein involved in vacuolar protein sor | 96.85 | |
| KOG4637 | 464 | consensus Adaptor for phosphoinositide 3-kinase [S | 96.85 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 96.84 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 96.84 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 96.84 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 96.83 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 96.83 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.83 | |
| cd07623 | 224 | BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.82 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 96.81 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 96.81 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 96.81 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 96.79 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 96.79 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 96.79 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 96.78 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 96.77 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 96.76 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 96.76 | |
| PF09325 | 236 | Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp | 96.75 | |
| KOG2273 | 503 | consensus Membrane coat complex Retromer, subunit | 96.74 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 96.74 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 96.73 | |
| COG5074 | 280 | t-SNARE complex subunit, syntaxin [Intracellular t | 96.72 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.71 | |
| cd07664 | 234 | BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.7 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 96.7 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 96.68 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 96.68 | |
| PF14735 | 238 | HAUS4: HAUS augmin-like complex subunit 4 | 96.66 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 96.63 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 96.62 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 96.62 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 96.62 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 96.61 | |
| PF05149 | 289 | Flagellar_rod: Paraflagellar rod protein; InterPro | 96.6 | |
| COG4487 | 438 | Uncharacterized protein conserved in bacteria [Fun | 96.6 | |
| PF04740 | 204 | LXG: LXG domain of WXG superfamily; InterPro: IPR0 | 96.6 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 96.59 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 96.59 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.59 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 96.58 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 96.58 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 96.58 | |
| cd07665 | 234 | BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.57 | |
| PF04108 | 412 | APG17: Autophagy protein Apg17 ; InterPro: IPR0072 | 96.57 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 96.57 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 96.56 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 96.55 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 96.55 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 96.54 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 96.52 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 96.52 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 96.52 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 96.51 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 96.5 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 96.49 | |
| PF04108 | 412 | APG17: Autophagy protein Apg17 ; InterPro: IPR0072 | 96.49 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 96.48 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 96.47 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 96.46 | |
| cd07599 | 216 | BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o | 96.46 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 96.46 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 96.46 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 96.44 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 96.44 | |
| KOG0810 | 297 | consensus SNARE protein Syntaxin 1 and related pro | 96.44 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 96.43 | |
| PF05276 | 239 | SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int | 96.43 | |
| cd07648 | 261 | F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am | 96.43 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 96.42 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 96.42 | |
| cd07598 | 211 | BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.4 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 96.38 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 96.36 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 96.36 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 96.35 | |
| PF11172 | 201 | DUF2959: Protein of unknown function (DUF2959); In | 96.34 | |
| COG3264 | 835 | Small-conductance mechanosensitive channel [Cell e | 96.34 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 96.33 | |
| PF14735 | 238 | HAUS4: HAUS augmin-like complex subunit 4 | 96.29 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 96.27 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 96.26 | |
| KOG1655 | 218 | consensus Protein involved in vacuolar protein sor | 96.25 | |
| KOG4787 | 852 | consensus Uncharacterized conserved protein [Funct | 96.23 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 96.23 | |
| cd07621 | 219 | BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.2 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 96.2 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 96.19 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 96.19 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 96.19 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 96.17 | |
| KOG1666 | 220 | consensus V-SNARE [Intracellular trafficking, secr | 96.17 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 96.14 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 96.14 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 96.13 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 96.13 | |
| PF05769 | 181 | DUF837: Protein of unknown function (DUF837); Inte | 96.12 | |
| cd07663 | 218 | BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.12 | |
| COG5074 | 280 | t-SNARE complex subunit, syntaxin [Intracellular t | 96.12 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 96.12 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 96.12 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 96.11 | |
| PF10191 | 766 | COG7: Golgi complex component 7 (COG7); InterPro: | 96.1 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 96.09 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 96.08 | |
| cd07623 | 224 | BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of | 96.07 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 96.06 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 96.05 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 96.04 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 96.04 | |
| cd07662 | 218 | BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of S | 96.0 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 96.0 | |
| PF13949 | 296 | ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI | 95.99 | |
| PF12004 | 495 | DUF3498: Domain of unknown function (DUF3498); Int | 95.99 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 95.97 | |
| PF01540 | 353 | Lipoprotein_7: Adhesin lipoprotein; InterPro: IPR0 | 95.96 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 95.95 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 95.95 | |
| PF00015 | 213 | MCPsignal: Methyl-accepting chemotaxis protein (MC | 95.95 | |
| KOG0972 | 384 | consensus Huntingtin interacting protein 1 (Hip1) | 95.94 | |
| PF04100 | 383 | Vps53_N: Vps53-like, N-terminal ; InterPro: IPR007 | 95.92 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 95.91 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 95.91 | |
| cd07667 | 240 | BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of | 95.89 | |
| cd07643 | 231 | I-BAR_IMD_MIM Inverse (I)-BAR, also known as the I | 95.89 | |
| KOG2273 | 503 | consensus Membrane coat complex Retromer, subunit | 95.89 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 95.87 | |
| PF03915 | 424 | AIP3: Actin interacting protein 3; InterPro: IPR02 | 95.86 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 95.86 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 95.83 | |
| COG3599 | 212 | DivIVA Cell division initiation protein [Cell divi | 95.81 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 95.8 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 95.8 | |
| PF15233 | 134 | SYCE1: Synaptonemal complex central element protei | 95.79 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 95.78 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.78 | |
| PRK06975 | 656 | bifunctional uroporphyrinogen-III synthetase/uropo | 95.77 | |
| cd07675 | 252 | F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ | 95.76 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 95.75 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 95.75 | |
| COG4487 | 438 | Uncharacterized protein conserved in bacteria [Fun | 95.74 | |
| PF05816 | 333 | TelA: Toxic anion resistance protein (TelA); Inter | 95.72 | |
| PRK15374 | 593 | pathogenicity island 1 effector protein SipB; Prov | 95.72 | |
| COG1322 | 448 | Predicted nuclease of restriction endonuclease-lik | 95.71 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 95.71 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 95.71 | |
| KOG4637 | 464 | consensus Adaptor for phosphoinositide 3-kinase [S | 95.7 | |
| PF15358 | 558 | TSKS: Testis-specific serine kinase substrate | 95.69 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 95.69 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 95.69 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 95.68 | |
| PF13094 | 160 | CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub | 95.67 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 95.66 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 95.65 | |
| KOG0811 | 269 | consensus SNARE protein PEP12/VAM3/Syntaxin 7/Synt | 95.63 | |
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 95.59 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 95.59 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 95.58 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 95.56 | |
| cd07595 | 244 | BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) | 95.55 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 95.55 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 95.55 | |
| PF14817 | 632 | HAUS5: HAUS augmin-like complex subunit 5 | 95.54 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 95.52 | |
| KOG0811 | 269 | consensus SNARE protein PEP12/VAM3/Syntaxin 7/Synt | 95.51 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 95.5 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 95.5 | |
| KOG4657 | 246 | consensus Uncharacterized conserved protein [Funct | 95.49 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 95.48 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 95.48 | |
| PTZ00446 | 191 | vacuolar sorting protein SNF7-like; Provisional | 95.48 | |
| cd07593 | 215 | BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom | 95.48 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 95.47 | |
| cd07676 | 253 | F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A | 95.47 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 95.47 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 95.47 | |
| smart00806 | 426 | AIP3 Actin interacting protein 3. Aip3p/Bud6p is a | 95.45 |
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
Probab=99.07 E-value=8.3e-08 Score=102.95 Aligned_cols=75 Identities=12% Similarity=0.180 Sum_probs=42.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccchH---HHHHHHHHHHHHHHHHHHHHH
Q 010679 49 EVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMKS---ERELQMRNLTEKIAKMEAELK 123 (504)
Q Consensus 49 ~~LEqeLe~~~eEIq~Le~e~qrLe~qi~~LkqELa~lqqEL~~L~~~L~~l~a---e~E~eL~eL~eki~kLEaEL~ 123 (504)
..++++|..++.+|+.++.++..+..++..+..+|..+..+|..+...|..+.. +.+.+|..++++|.++++++.
T Consensus 43 ~~~~~~l~~l~~qi~~~~~~i~~~~~~~~~~~~~l~~l~~qi~~~~~~i~~~~~~i~~~~~ei~~l~~eI~~~q~~l~ 120 (428)
T PRK11637 43 SDNRDQLKSIQQDIAAKEKSVRQQQQQRASLLAQLKKQEEAISQASRKLRETQNTLNQLNKQIDELNASIAKLEQQQA 120 (428)
T ss_pred hhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 566777777777777766666666666666666666666655555555544221 234444444444444444443
|
|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG0260 consensus RNA polymerase II, large subunit [Transcription] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF12815 CTD: Spt5 C-terminal nonapeptide repeat binding Spt4; PDB: 2E70_A | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12815 CTD: Spt5 C-terminal nonapeptide repeat binding Spt4; PDB: 2E70_A | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF00015 MCPsignal: Methyl-accepting chemotaxis protein (MCP) signalling domain; InterPro: IPR004089 Methyl-accepting chemotaxis proteins (MCPs) are a family of bacterial receptors that mediate chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behaviour [] | Back alignment and domain information |
|---|
| >cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF01442 Apolipoprotein: Apolipoprotein A1/A4/E domain; InterPro: IPR000074 Exchangeable apolipoproteins (apoA, apoC and apoE) have the same genomic structure and are members of a multi-gene family that probably evolved from a common ancestral gene | Back alignment and domain information |
|---|
| >smart00806 AIP3 Actin interacting protein 3 | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG3958 consensus Putative dynamitin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >KOG0992 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking | Back alignment and domain information |
|---|
| >KOG2273 consensus Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF14735 HAUS4: HAUS augmin-like complex subunit 4 | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05149 Flagellar_rod: Paraflagellar rod protein; InterPro: IPR007824 This family consists of several eukaryotic paraflagellar rod component proteins | Back alignment and domain information |
|---|
| >COG4487 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04740 LXG: LXG domain of WXG superfamily; InterPro: IPR006829 This group of putative transposases is found in Gram-positive bacteria, mostly Bacillus members and is thought to be a Cytosolic protein | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 | Back alignment and domain information |
|---|
| >PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0810 consensus SNARE protein Syntaxin 1 and related proteins [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells | Back alignment and domain information |
|---|
| >cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11172 DUF2959: Protein of unknown function (DUF2959); InterPro: IPR021342 This family of proteins with unknown function appears to be restricted to Gammaproteobacteria | Back alignment and domain information |
|---|
| >COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PF14735 HAUS4: HAUS augmin-like complex subunit 4 | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4787 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6 | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1666 consensus V-SNARE [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 | Back alignment and domain information |
|---|
| >COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF10191 COG7: Golgi complex component 7 (COG7); InterPro: IPR019335 The conserved oligomeric Golgi (COG) complex is an eight-subunit (Cog1-8) peripheral Golgi protein involved in membrane trafficking and glycoconjugate synthesis [] | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6 | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A | Back alignment and domain information |
|---|
| >PF12004 DUF3498: Domain of unknown function (DUF3498); InterPro: IPR021887 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF01540 Lipoprotein_7: Adhesin lipoprotein; InterPro: IPR002520 This family consists of the p50 and variable adherence-associated antigen (Vaa) adhesins from Mycoplasma hominis | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00015 MCPsignal: Methyl-accepting chemotaxis protein (MCP) signalling domain; InterPro: IPR004089 Methyl-accepting chemotaxis proteins (MCPs) are a family of bacterial receptors that mediate chemotaxis to diverse signals, responding to changes in the concentration of attractants and repellents in the environment by altering swimming behaviour [] | Back alignment and domain information |
|---|
| >KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04100 Vps53_N: Vps53-like, N-terminal ; InterPro: IPR007234 Vps53 complexes with Vps52 and Vps54 to form a multi-subunit complex involved in regulating membrane trafficking events [] | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 | Back alignment and domain information |
|---|
| >cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis | Back alignment and domain information |
|---|
| >KOG2273 consensus Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >COG3599 DivIVA Cell division initiation protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF15233 SYCE1: Synaptonemal complex central element protein 1 | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4487 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF05816 TelA: Toxic anion resistance protein (TelA); InterPro: IPR008863 This family consists of several prokaryotic TelA like proteins | Back alignment and domain information |
|---|
| >PRK15374 pathogenicity island 1 effector protein SipB; Provisional | Back alignment and domain information |
|---|
| >COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >KOG4637 consensus Adaptor for phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15358 TSKS: Testis-specific serine kinase substrate | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0811 consensus SNARE protein PEP12/VAM3/Syntaxin 7/Syntaxin 17 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14817 HAUS5: HAUS augmin-like complex subunit 5 | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0811 consensus SNARE protein PEP12/VAM3/Syntaxin 7/Syntaxin 17 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >KOG4657 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PTZ00446 vacuolar sorting protein SNF7-like; Provisional | Back alignment and domain information |
|---|
| >cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >smart00806 AIP3 Actin interacting protein 3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 504 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-10 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-09 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-06 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 1e-07 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 1e-07 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 2e-06 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 2e-06 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 7e-07 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 1e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 3e-05 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 2e-04 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 2e-04 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 3e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 9e-04 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
Score = 60.8 bits (147), Expect = 2e-10
Identities = 26/187 (13%), Positives = 67/187 (35%), Gaps = 7/187 (3%)
Query: 49 EVMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQIGGMKSE---RE 105
+++K+ + E+ K + + ++ A+ ++ L+ +I + E +
Sbjct: 44 VSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQ 103
Query: 106 LQMRNLTEKIAKMEAELKTAEPV--KLEFQKSKTEAQ--NLVVAREELIAKVHQLTQDLQ 161
++ +K+ + E +E +E + K E + + +E + +
Sbjct: 104 ERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYE 163
Query: 162 RAHTDVQQIPALLSELESLRQEYHHCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEK 221
+ I + L E + E E K ++L+SL+ + Y + E+
Sbjct: 164 EVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEE 223
Query: 222 LRAELMN 228
L +
Sbjct: 224 EIKVLSD 230
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B Length = 170 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 504 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 98.82 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.77 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.75 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.75 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.57 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 98.43 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 98.43 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 98.37 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.35 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 98.18 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.0 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.98 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 97.96 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.96 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 97.92 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.9 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 97.84 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.81 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 97.58 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.5 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 97.46 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 97.45 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 97.45 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 97.4 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.39 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 97.35 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 97.32 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 97.29 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 97.2 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 97.18 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 97.13 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 97.13 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.12 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 97.09 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 97.08 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 97.07 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 97.01 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 96.99 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 96.97 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 96.97 | |
| 3g67_A | 213 | Methyl-accepting chemotaxis protein; four-helix bu | 96.97 | |
| 2fic_A | 251 | Bridging integrator 1; BAR domain, homodimer, coil | 96.96 | |
| 3g67_A | 213 | Methyl-accepting chemotaxis protein; four-helix bu | 96.89 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 96.82 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 96.79 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 96.79 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 96.67 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 96.66 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 96.65 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 96.62 | |
| 2nrj_A | 346 | HBL B protein; enterotoxin, hemolysis, transmembra | 96.58 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 96.57 | |
| 2nrj_A | 346 | HBL B protein; enterotoxin, hemolysis, transmembra | 96.55 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 96.54 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 96.53 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 96.53 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 96.52 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 96.51 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 96.51 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 96.49 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 96.49 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 96.46 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 96.44 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 96.44 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.43 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 96.42 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 96.39 | |
| 3zx6_A | 341 | HAMP, methyl-accepting chemotaxis protein I; signa | 96.39 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 96.37 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 96.32 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 96.32 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 96.31 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 96.27 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 96.24 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 96.24 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 96.23 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 96.2 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 96.19 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 96.17 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 96.17 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 96.17 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 96.16 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 96.16 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 96.15 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 96.09 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 96.07 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 96.06 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 96.06 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 96.05 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 96.02 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 96.0 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 95.95 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 95.93 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 95.9 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 95.89 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 95.89 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 95.89 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 95.83 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 95.79 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 95.76 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.75 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 95.71 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 95.71 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 95.63 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 95.6 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 95.59 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 95.58 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 95.55 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 95.54 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 95.52 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 95.5 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 95.47 | |
| 2xhe_B | 279 | Syntaxin1; exocytosis, exocytosis complex, snare, | 95.44 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 95.41 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 95.37 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 95.35 | |
| 3tul_A | 158 | Cell invasion protein SIPB; translocator, type thr | 95.32 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 95.3 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 95.24 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 95.23 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 95.14 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 95.13 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 95.12 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 95.11 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 95.1 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 95.03 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 95.03 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 95.03 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 95.02 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 95.0 | |
| 3k29_A | 169 | Putative uncharacterized protein; YSCO, type III s | 94.97 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.93 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 94.92 | |
| 1fio_A | 196 | SSO1 protein; four helix bundle, alpha helix, memb | 94.9 | |
| 2fic_A | 251 | Bridging integrator 1; BAR domain, homodimer, coil | 94.88 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 94.83 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 94.8 | |
| 4abx_A | 175 | DNA repair protein RECN; DNA binding protein, ATP | 94.73 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 94.71 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 94.69 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 94.67 | |
| 3okq_A | 141 | BUD site selection protein 6; coiled-coil, protein | 94.65 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 94.63 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 94.63 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 94.6 | |
| 3c98_B | 279 | Syntaxin-1A; protein complex, alternative splicing | 94.6 | |
| 2avr_X | 119 | Adhesion A; antiparallel helix-loop-helix, leucine | 94.57 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.5 | |
| 2a01_A | 243 | Apolipoprotein A-I; four-helix bundle, lipid trans | 94.46 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 94.45 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 94.45 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 94.44 | |
| 1uru_A | 244 | Amphiphysin; endocytosis, coiled-coil, membrane cu | 94.43 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 94.39 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 94.3 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 94.24 | |
| 2p22_C | 192 | Protein SRN2; endosome, trafficking complex, VPS23 | 94.22 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 94.21 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 94.16 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 94.16 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 94.15 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 94.15 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 94.13 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 94.06 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 94.06 | |
| 3tul_A | 158 | Cell invasion protein SIPB; translocator, type thr | 94.05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 94.04 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 94.0 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 93.93 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 93.92 | |
| 2avr_X | 119 | Adhesion A; antiparallel helix-loop-helix, leucine | 93.89 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 93.89 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 93.87 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 93.86 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 93.81 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 93.81 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 93.76 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 93.75 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 93.73 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 93.63 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 93.61 | |
| 1uru_A | 244 | Amphiphysin; endocytosis, coiled-coil, membrane cu | 93.51 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 93.48 | |
| 2l7b_A | 307 | Apolipoprotein E, APO-E; lipid transport, atherosc | 93.47 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 93.44 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 93.36 | |
| 1qu7_A | 227 | Methyl-accepting chemotaxis protein I; serine, fou | 93.36 | |
| 2pms_C | 125 | Pneumococcal surface protein A (PSPA); lactoferrin | 93.34 | |
| 1dn1_B | 267 | Syntaxin 1A, syntaxin binding protein 1; protein-p | 93.3 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 93.3 | |
| 2lem_A | 216 | Apolipoprotein A-I; lipid transport; NMR {Mus musc | 93.29 | |
| 2pms_C | 125 | Pneumococcal surface protein A (PSPA); lactoferrin | 93.29 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 93.23 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 93.19 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 93.15 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 93.05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 93.04 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 92.95 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 92.93 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 92.93 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 92.88 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 92.84 | |
| 4hpq_C | 413 | ATG17, KLTH0D15642P; autophagy, protein transport; | 92.8 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 92.76 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 92.59 | |
| 1qu7_A | 227 | Methyl-accepting chemotaxis protein I; serine, fou | 92.58 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 92.47 | |
| 1xaw_A | 140 | Occludin; coiled-coil, cell adhesion; 1.45A {Homo | 92.41 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 92.36 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 92.28 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 92.17 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 92.16 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 92.1 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 92.07 | |
| 3r2p_A | 185 | Apolipoprotein A-I; amphipathic alpha-helix, major | 92.06 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 92.05 | |
| 2d1l_A | 253 | Metastasis suppressor protein 1; IRSP53, actin bin | 92.03 | |
| 3fhn_A | 706 | Protein transport protein TIP20; TIP20P, vesicle t | 92.0 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 91.97 | |
| 4avm_A | 237 | Bridging integrator 2; protein binding, plasma mem | 91.95 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 91.94 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 91.9 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 91.88 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 91.72 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 91.72 | |
| 3fx0_A | 96 | NF-kappa-B essential modulator; coiled-coil, coile | 91.72 | |
| 2qih_A | 157 | Protein USPA1; trimeric, parallel alpha-helical co | 91.64 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 91.57 | |
| 4dnd_A | 130 | Syntaxin-10, SYN10; structural genomics, protein s | 91.52 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 91.48 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 91.44 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 91.44 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 91.41 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 91.35 | |
| 2bsg_A | 487 | Fibritin; viral protein, attachment protein, bacte | 91.25 | |
| 4a3a_A | 243 | Amphiphysin; structural genomics, invagination, kn | 91.21 | |
| 2ap3_A | 199 | Conserved hypothetical protein; structural genomic | 91.14 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 91.11 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 91.04 | |
| 1gqe_A | 365 | Release factor 2, RF2; protein synthesis, ribosome | 90.89 | |
| 1t3j_A | 96 | Mitofusin 1; coiled coil antiparallel, dimer, memb | 90.89 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 90.81 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 90.78 | |
| 1hci_A | 476 | Alpha-actinin 2; triple-helix coiled coil, contrac | 90.71 | |
| 4e61_A | 106 | Protein BIM1; EB1-like motif, coiled-coil, spindle | 90.62 | |
| 4dvz_A | 569 | Cytotoxicity-associated immunodominant antigen; on | 90.61 | |
| 2bsg_A | 487 | Fibritin; viral protein, attachment protein, bacte | 90.58 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 90.54 | |
| 1hs7_A | 97 | Syntaxin VAM3; UP-and-DOWN three-helix bundle inse | 90.49 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 90.34 | |
| 1t3j_A | 96 | Mitofusin 1; coiled coil antiparallel, dimer, memb | 90.32 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 90.23 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 90.11 | |
| 2zdi_C | 151 | Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 | 89.87 | |
| 2zdi_C | 151 | Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 | 89.84 | |
| 3qwe_A | 279 | GMIP, GEM-interacting protein; structural genomics | 89.83 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 89.81 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 89.8 | |
| 3ni0_A | 99 | Bone marrow stromal antigen 2; coiled-coil, antivi | 89.61 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 89.51 | |
| 3he5_B | 52 | Synzip2; heterodimeric coiled-coil, de novo protei | 89.34 | |
| 2etd_A | 171 | LEMA protein; bromodomain-like fold, structural ge | 89.32 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 89.17 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 89.12 | |
| 2k48_A | 107 | Nucleoprotein; viral protein; NMR {Andes virus} | 89.08 | |
| 2iak_A | 224 | Bullous pemphigoid antigen 1, isoform 5; triple he | 89.06 | |
| 3zbh_A | 99 | ESXA; unknown function, type 7 secretion, ESAT6 fa | 88.99 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.97 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 88.97 | |
| 2ke4_A | 98 | CDC42-interacting protein 4; CIP4, TC10, coiled-co | 88.94 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 88.93 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 88.87 | |
| 2dnx_A | 130 | Syntaxin-12; snare, HABC domain, UP and DOWN three | 88.8 | |
| 1gqe_A | 365 | Release factor 2, RF2; protein synthesis, ribosome | 88.74 | |
| 3m3w_A | 320 | Pacsin3, protein kinase C and casein kinase II sub | 88.6 | |
| 3thf_A | 190 | Protein shroom; coiled-coil, anti-parallel, helica | 88.55 | |
| 1vcs_A | 102 | Vesicle transport through interaction with T- snar | 88.54 | |
| 2d4y_A | 463 | HAP1, flagellar HOOK-associated protein 1; multi-d | 88.5 | |
| 2qyw_A | 102 | Vesicle transport through interaction with T-SNAR | 88.37 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 88.23 | |
| 3zbh_A | 99 | ESXA; unknown function, type 7 secretion, ESAT6 fa | 88.16 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 88.12 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 88.0 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 87.87 | |
| 1zww_A | 256 | SH3-containing GRB2-like protein 2; coiled coil, t | 87.72 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 87.59 | |
| 2ap3_A | 199 | Conserved hypothetical protein; structural genomic | 87.58 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 87.3 | |
| 2yfa_A | 258 | MCPS, methyl-accepting chemotaxis transducer; rece | 87.14 | |
| 3vp9_A | 92 | General transcriptional corepressor TUP1; four hel | 87.11 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 87.05 | |
| 3cl3_D | 130 | NF-kappa-B essential modulator; death effector dom | 86.99 | |
| 2p22_A | 174 | Suppressor protein STP22 of temperature- sensitive | 86.99 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 86.99 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 86.82 | |
| 3g9g_A | 287 | Suppressor of yeast profilin deletion; SYP1, BAR d | 86.6 | |
| 3gwk_C | 98 | SAG1039, putative uncharacterized protein SAG1039; | 86.53 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 86.46 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 86.45 | |
| 4g2k_A | 125 | General control protein GCN4, envelope glycoprote | 86.44 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 86.34 | |
| 4aj5_K | 123 | Spindle and kinetochore-associated protein 2; cell | 86.26 | |
| 1s94_A | 180 | S-syntaxin; three helix bundle, structural plastic | 86.16 | |
| 3ilw_A | 470 | DNA gyrase subunit A; DNA topology, topoisomerase, | 86.01 | |
| 3he5_B | 52 | Synzip2; heterodimeric coiled-coil, de novo protei | 85.91 | |
| 2pih_A | 151 | Protein YMCA; regulate community development, stru | 85.91 | |
| 2fup_A | 157 | Hypothetical protein PA3352; structural genomics, | 85.87 | |
| 2z0v_A | 240 | SH3-containing GRB2-like protein 3; helix bundle, | 85.61 | |
| 2q6q_A | 74 | Spindle POLE BODY component SPC42; SPC42P, budding | 85.6 | |
| 4dvy_P | 876 | Cytotoxicity-associated immunodominant antigen; on | 85.54 | |
| 3c9i_A | 242 | Tail needle protein GP26; xenon, coiled-coil, prot | 85.46 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 85.44 | |
| 3opc_A | 154 | Uncharacterized protein; structural genomics, PSI- | 85.42 | |
| 3csx_A | 81 | Putative uncharacterized protein; metalloprotein, | 85.4 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 85.18 | |
| 1i6z_A | 135 | BAG-family molecular chaperone regulator-1; triple | 85.11 | |
| 1xaw_A | 140 | Occludin; coiled-coil, cell adhesion; 1.45A {Homo | 85.08 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 84.86 | |
| 2qyw_A | 102 | Vesicle transport through interaction with T-SNAR | 84.7 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 84.65 | |
| 3onj_A | 97 | T-snare VTI1; helix, HABC, protein transport; 1.92 | 84.6 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 84.52 | |
| 3ni0_A | 99 | Bone marrow stromal antigen 2; coiled-coil, antivi | 84.5 | |
| 2p01_A | 323 | Alpha-2-macroglobulin receptor-associated protein; | 84.4 | |
| 4dci_A | 150 | Uncharacterized protein; PSI-biology, midwest cent | 84.38 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 84.29 | |
| 2iub_A | 363 | CORA, divalent cation transport-related protein; m | 84.07 | |
| 2js5_A | 71 | Uncharacterized protein; homodimer, protein struct | 83.7 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 83.67 | |
| 1r8i_A | 213 | TRAC; VIRB5, helical bundle, structural protein; 3 | 83.67 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 83.62 | |
| 2inr_A | 514 | DNA topoisomerase 4 subunit A; topoisomerase II fo | 83.54 | |
| 3rrk_A | 357 | V-type ATPase 116 kDa subunit; alpha beta fold, pr | 83.45 | |
| 3ilw_A | 470 | DNA gyrase subunit A; DNA topology, topoisomerase, | 83.22 | |
| 2c5k_T | 95 | Syntaxin TLG1, T-snare affecting A late golgi comp | 83.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 82.99 | |
| 4fi5_A | 113 | Nucleoprotein; structural genomics, niaid, nationa | 82.96 | |
| 3ra3_B | 28 | P2F; coiled coil domain, fiber, KIH interactions, | 82.94 | |
| 1lq7_A | 67 | Alpha3W; three helix bundle, de novo protein; NMR | 82.84 | |
| 1zvu_A | 716 | Topoisomerase IV subunit A; beta-pinwheel, ATPase, | 82.79 | |
| 2ke4_A | 98 | CDC42-interacting protein 4; CIP4, TC10, coiled-co | 82.49 | |
| 3dyt_A | 366 | Sorting nexin-9; 3-helix bundle, BAR domain, PX do | 82.43 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 82.38 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 82.17 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 82.15 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 82.08 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 82.05 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 81.71 | |
| 2xcs_B | 692 | DNA gyrase subunit B, DNA gyrase subunit A; isomer | 81.7 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 81.68 | |
| 4hpq_C | 413 | ATG17, KLTH0D15642P; autophagy, protein transport; | 81.65 | |
| 2w6b_A | 56 | RHO guanine nucleotide exchange factor 7; X-RAY cr | 81.5 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 81.4 | |
| 4aj5_K | 123 | Spindle and kinetochore-associated protein 2; cell | 81.25 | |
| 2cly_A | 214 | ATP synthase B chain, mitochondrial; mitochondrion | 81.11 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 81.07 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 81.04 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 80.99 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 80.78 | |
| 4b6x_A | 90 | AVRRPS4, avirulence protein; toxin, type 3 secrete | 80.64 | |
| 4a3a_A | 243 | Amphiphysin; structural genomics, invagination, kn | 80.58 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 80.52 | |
| 1kmi_Z | 214 | CHEZ, chemotaxis protein CHEZ; four-helix bundle, | 80.3 | |
| 3fhn_A | 706 | Protein transport protein TIP20; TIP20P, vesicle t | 80.25 | |
| 3u0c_A | 201 | Invasin IPAB, 62 kDa antigen; translocator, type t | 80.11 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.00 E-value=3.2e-07 Score=87.60 Aligned_cols=48 Identities=10% Similarity=0.180 Sum_probs=23.7
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 010679 50 VMEQKIASQHVEMQKLATENQRLAATHGTLRQELAAAQHELQILHGQI 97 (504)
Q Consensus 50 ~LEqeLe~~~eEIq~Le~e~qrLe~qi~~LkqELa~lqqEL~~L~~~L 97 (504)
.|..++..+..++..+..+...|..++..++.++..+..++..+...+
T Consensus 3 ~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~ 50 (284)
T 1c1g_A 3 AIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKL 50 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 344555555555555555555555555555444444444444444433
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3g67_A Methyl-accepting chemotaxis protein; four-helix bundle, signaling protein; 2.17A {Thermotoga maritima} PDB: 3g6b_A 3ur1_C | Back alignment and structure |
|---|
| >2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A | Back alignment and structure |
|---|
| >3g67_A Methyl-accepting chemotaxis protein; four-helix bundle, signaling protein; 2.17A {Thermotoga maritima} PDB: 3g6b_A 3ur1_C | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3zx6_A HAMP, methyl-accepting chemotaxis protein I; signaling, HAMP domain, TSR receptor, fusion; 2.65A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2xhe_B Syntaxin1; exocytosis, exocytosis complex, snare, neuro fusion, SM PROT choanoflagellates; 2.80A {Monosiga brevicollis} | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3tul_A Cell invasion protein SIPB; translocator, type three secretion system, coiled-coil, VIRU cell invasion; 2.79A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >1fio_A SSO1 protein; four helix bundle, alpha helix, membrane protein; 2.10A {Saccharomyces cerevisiae} SCOP: a.47.2.1 | Back alignment and structure |
|---|
| >2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4abx_A DNA repair protein RECN; DNA binding protein, ATP binding protein, double break repair, coiled-coil; HET: DNA; 2.04A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A | Back alignment and structure |
|---|
| >3okq_A BUD site selection protein 6; coiled-coil, protein binding; 2.04A {Saccharomyces cerevisiae} PDB: 3onx_A | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3c98_B Syntaxin-1A; protein complex, alternative splicing, cytoplasm, membrane, phosphoprotein, protein transport, transport, coiled coil; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >2p22_C Protein SRN2; endosome, trafficking complex, VPS23, VPS28, VPS37, MVB12; 2.70A {Saccharomyces cerevisiae} PDB: 2caz_C 2f66_C | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3tul_A Cell invasion protein SIPB; translocator, type three secretion system, coiled-coil, VIRU cell invasion; 2.79A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >1qu7_A Methyl-accepting chemotaxis protein I; serine, four helical-bundle, signaling protein; 2.60A {Escherichia coli} SCOP: h.4.5.1 | Back alignment and structure |
|---|
| >2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 | Back alignment and structure |
|---|
| >1dn1_B Syntaxin 1A, syntaxin binding protein 1; protein-protein complex, multi-subunit; 2.60A {Rattus norvegicus} PDB: 3c98_B | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2lem_A Apolipoprotein A-I; lipid transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4hpq_C ATG17, KLTH0D15642P; autophagy, protein transport; 3.06A {Lachancea thermotolerans cbs 6340} | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qu7_A Methyl-accepting chemotaxis protein I; serine, four helical-bundle, signaling protein; 2.60A {Escherichia coli} SCOP: h.4.5.1 | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1xaw_A Occludin; coiled-coil, cell adhesion; 1.45A {Homo sapiens} SCOP: h.4.17.1 PDB: 1wpa_A 3g7c_A | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3r2p_A Apolipoprotein A-I; amphipathic alpha-helix, major protein of high density lipop (HDL), lipid binding, plasma, lipid transport; 2.20A {Homo sapiens} PDB: 1gw3_A 1gw4_A | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} | Back alignment and structure |
|---|
| >3fhn_A Protein transport protein TIP20; TIP20P, vesicle tethering, endoplasmic reticulum, ER-golgi transport, membrane, phosphoprotein; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3fx0_A NF-kappa-B essential modulator; coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia, HOST-virus interaction; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2qih_A Protein USPA1; trimeric, parallel alpha-helical coiled-coil, cell adhesion; 1.90A {Moraxella catarrhalis} | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4dnd_A Syntaxin-10, SYN10; structural genomics, protein structure initiative, nysgrc, P biology, NEW YORK structural genomics research consortium; HET: MSE; 1.40A {Homo sapiens} PDB: 1lvf_A | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ap3_A Conserved hypothetical protein; structural genomics, tetra helix, PSI, protein structure INI midwest center for structural genomics; 1.60A {Staphylococcus aureus subsp} SCOP: a.24.27.1 | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* | Back alignment and structure |
|---|
| >1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dvz_A Cytotoxicity-associated immunodominant antigen; oncoprotein; 3.19A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >1hs7_A Syntaxin VAM3; UP-and-DOWN three-helix bundle insertion preceding proline in AN alpha-helix, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: a.47.2.1 | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qwe_A GMIP, GEM-interacting protein; structural genomics consortium, SGC, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >2etd_A LEMA protein; bromodomain-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.28A {Thermotoga maritima} SCOP: a.29.9.1 | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2k48_A Nucleoprotein; viral protein; NMR {Andes virus} | Back alignment and structure |
|---|
| >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3zbh_A ESXA; unknown function, type 7 secretion, ESAT6 family proteins, W protein ESS; 1.94A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >2dnx_A Syntaxin-12; snare, HABC domain, UP and DOWN three helix bundle, LEFT-handed twist, membrane fusion, vesicle transport, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gqe_A Release factor 2, RF2; protein synthesis, ribosome, macromolecular mimicry, translation; 1.81A {Escherichia coli} SCOP: e.38.1.1 PDB: 1mi6_A 1ml5_Z* | Back alignment and structure |
|---|
| >3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A | Back alignment and structure |
|---|
| >3thf_A Protein shroom; coiled-coil, anti-parallel, helical, RHO-kinase, actin-bindi protein binding, cytoskeleton regulator; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vcs_A Vesicle transport through interaction with T- snares homolog 1A; HABC domain, VTI1, UP and DOWN three helix bundle, LEFT-handed twist; NMR {Mus musculus} SCOP: a.47.2.1 | Back alignment and structure |
|---|
| >2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >3zbh_A ESXA; unknown function, type 7 secretion, ESAT6 family proteins, W protein ESS; 1.94A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2ap3_A Conserved hypothetical protein; structural genomics, tetra helix, PSI, protein structure INI midwest center for structural genomics; 1.60A {Staphylococcus aureus subsp} SCOP: a.24.27.1 | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >2yfa_A MCPS, methyl-accepting chemotaxis transducer; receptor, chemoreceptor; 1.80A {Pseudomonas putida} PDB: 2yfb_A | Back alignment and structure |
|---|
| >3vp9_A General transcriptional corepressor TUP1; four helix bundle; 1.80A {Saccharomyces cerevisiae} PDB: 3vp8_A | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2p22_A Suppressor protein STP22 of temperature- sensitive alpha-factor receptor and arginine...; endosome, trafficking complex, VPS23, VPS28, VPS37, MVB12; 2.70A {Saccharomyces cerevisiae} PDB: 2caz_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gwk_C SAG1039, putative uncharacterized protein SAG1039; WXG motif, four-helical bundle, viral protein; 1.30A {Streptococcus agalactiae serogroup V} PDB: 3gvm_A 3o9o_A | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g2k_A General control protein GCN4, envelope glycoprote chimera; GP2-GCN4 fusion, viral protein; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
| >4aj5_K Spindle and kinetochore-associated protein 2; cell cycle, SKA complex, mitosis, cell division, kinetochore microtubule attachment; 3.32A {Homo sapiens} | Back alignment and structure |
|---|
| >1s94_A S-syntaxin; three helix bundle, structural plasticity, endocytosis-exocy complex; 3.34A {Loligo pealei} SCOP: a.47.2.1 | Back alignment and structure |
|---|
| >3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} SCOP: e.11.1.0 PDB: 3ifz_A* | Back alignment and structure |
|---|
| >3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >2pih_A Protein YMCA; regulate community development, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} SCOP: a.281.1.1 | Back alignment and structure |
|---|
| >2fup_A Hypothetical protein PA3352; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.48A {Pseudomonas aeruginosa} SCOP: a.47.5.1 | Back alignment and structure |
|---|
| >2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dvy_P Cytotoxicity-associated immunodominant antigen; oncoprotein; 3.30A {Helicobacter pylori} PDB: 4g0h_A | Back alignment and structure |
|---|
| >3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >3opc_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, chaperone; HET: MSE; 2.09A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3csx_A Putative uncharacterized protein; metalloprotein, nitrogen fixation, cyanobacteria, circadian rhythms, metal binding protein, unknown function; 1.84A {Cyanothece} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >1i6z_A BAG-family molecular chaperone regulator-1; triple helix bundle; NMR {Mus musculus} SCOP: a.7.7.1 | Back alignment and structure |
|---|
| >1xaw_A Occludin; coiled-coil, cell adhesion; 1.45A {Homo sapiens} SCOP: h.4.17.1 PDB: 1wpa_A 3g7c_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3onj_A T-snare VTI1; helix, HABC, protein transport; 1.92A {Saccharomyces cerevisiae} PDB: 3onl_C | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} | Back alignment and structure |
|---|
| >2p01_A Alpha-2-macroglobulin receptor-associated protein; RAP, cell adhesion; NMR {Homo sapiens} PDB: 2p03_A | Back alignment and structure |
|---|
| >4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2iub_A CORA, divalent cation transport-related protein; membrane protein, ION transporter; 2.9A {Thermotoga maritima} SCOP: d.328.1.1 f.17.3.1 PDB: 2hn2_A 2bbj_A | Back alignment and structure |
|---|
| >2js5_A Uncharacterized protein; homodimer, protein structure, spectroscopy, structural genomics, PSI-2, protein structure initiative; NMR {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >1r8i_A TRAC; VIRB5, helical bundle, structural protein; 3.00A {Escherichia coli} SCOP: a.8.7.1 | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3rrk_A V-type ATPase 116 kDa subunit; alpha beta fold, proton pump, subunit I/A, V-ATPase, proton; HET: NHE; 2.64A {Meiothermus ruber} | Back alignment and structure |
|---|
| >3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} SCOP: e.11.1.0 PDB: 3ifz_A* | Back alignment and structure |
|---|
| >2c5k_T Syntaxin TLG1, T-snare affecting A late golgi compartment protein 1; protein transport/complex, snare, VFT complex, protein transport, phosphorylation; 2.05A {Saccharomyces cerevisiae} PDB: 2c5j_A 2c5i_T | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >4fi5_A Nucleoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.20A {Hantaan virus} | Back alignment and structure |
|---|
| >3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} | Back alignment and structure |
|---|
| >1lq7_A Alpha3W; three helix bundle, de novo protein; NMR {} SCOP: k.9.1.1 | Back alignment and structure |
|---|
| >1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xct_B* 2xcr_B* 2xcq_A* 2xco_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4hpq_C ATG17, KLTH0D15642P; autophagy, protein transport; 3.06A {Lachancea thermotolerans cbs 6340} | Back alignment and structure |
|---|
| >2w6b_A RHO guanine nucleotide exchange factor 7; X-RAY crystallography, phosphoprotein, guanine-nucleotide releasing factor, GIT, PAK, PIX, COOL; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >4aj5_K Spindle and kinetochore-associated protein 2; cell cycle, SKA complex, mitosis, cell division, kinetochore microtubule attachment; 3.32A {Homo sapiens} | Back alignment and structure |
|---|
| >2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 PDB: 2wss_T* | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >4b6x_A AVRRPS4, avirulence protein; toxin, type 3 secreted effector; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >1kmi_Z CHEZ, chemotaxis protein CHEZ; four-helix bundle, signaling protein; HET: BCN; 2.90A {Escherichia coli} SCOP: h.4.11.1 | Back alignment and structure |
|---|
| >3fhn_A Protein transport protein TIP20; TIP20P, vesicle tethering, endoplasmic reticulum, ER-golgi transport, membrane, phosphoprotein; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u0c_A Invasin IPAB, 62 kDa antigen; translocator, type three secretion system, coiled-coil, VIRU cell invasion; 2.05A {Shigella flexneri} PDB: 3gz1_P | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 504 | ||||
| d1u2ma_ | 143 | f.48.1.1 (A:) Periplasmic chaperon skp (HlpA) {Esc | 7e-04 |
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 504 | |||
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 97.43 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 97.08 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 96.97 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 96.81 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 96.69 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 96.54 | |
| d1urua_ | 217 | Amphiphysin {Fruit fly (Drosophila melanogaster) [ | 96.34 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 96.26 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 96.2 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 96.18 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 95.97 | |
| d1urua_ | 217 | Amphiphysin {Fruit fly (Drosophila melanogaster) [ | 95.87 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 95.87 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 95.66 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 95.41 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.43 | |
| d1fioa_ | 196 | Sso1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.4 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 94.06 | |
| d1fioa_ | 196 | Sso1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 93.85 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 93.84 | |
| d1bf5a1 | 181 | STAT-1, coiled coil domain {Human (Homo sapiens) [ | 93.66 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.63 | |
| d2etda1 | 149 | Hypothetical protein TM0961 {Thermotoga maritima [ | 92.85 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 90.78 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 90.06 | |
| d1bg1a1 | 186 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 89.87 | |
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 89.33 | |
| d1y2oa1 | 248 | BAP2/IRSp53 N-terminal domain {Human (Homo sapiens | 88.74 | |
| d1bf5a1 | 181 | STAT-1, coiled coil domain {Human (Homo sapiens) [ | 88.32 | |
| d1bjta_ | 760 | DNA topoisomerase II, C-terminal fragment (residue | 87.98 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 87.77 | |
| d1eq1a_ | 166 | Apolipophorin-III {Manduca sexta [TaxId: 7130]} | 87.09 | |
| d1bg1a1 | 186 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 86.21 | |
| d1vcsa1 | 89 | Vesicle transport v-SNARE protein Vti1-like 2 {Mou | 84.53 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 83.98 | |
| d2elba1 | 268 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 81.56 |
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: MW0975(SA0943)-like family: MW0975(SA0943)-like domain: Hypothetical protein MW0975 (SA0943) species: Staphylococcus aureus [TaxId: 1280]
Probab=97.43 E-value=0.0067 Score=50.96 Aligned_cols=48 Identities=8% Similarity=-0.018 Sum_probs=20.8
Q ss_pred HHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 010679 180 LRQEYHHCRGTYEYEKKFYNDHLESLQVMEKNYITMATEVEKLRAELM 227 (504)
Q Consensus 180 LrqELq~LR~eLe~~kk~~~el~eqlqemek~L~sme~EiekLraELe 227 (504)
+...+..+...+..+...+..+...+..+...+..+...+.++..+..
T Consensus 135 ~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~ek~ 182 (185)
T d2ap3a1 135 LFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVQKEKQ 182 (185)
T ss_dssp HHHHHTSTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence 333333333344444444444444444444444444444444444433
|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2etda1 a.29.9.1 (A:35-183) Hypothetical protein TM0961 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg1a1 a.47.1.1 (A:136-321) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Manduca sexta [TaxId: 7130]} | Back information, alignment and structure |
|---|
| >d1bg1a1 a.47.1.1 (A:136-321) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|