Citrus Sinensis ID: 010790

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-

MSNTTSTNPSKPNKKRKTNPNPETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLCITRPNVCESRDEAQ

cccccccccccHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHcccEEEEEEEcccEEEEccccccEEEEccccccEEEEccccccccccEEEEEcccccccccccc

cccccccccccHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccEcccccEEEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccEEEEccHHHEcccccccccccHHHHHHHHHHHHHHccccEEEEHHHccccccccccHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccEEEccHHHHHHHHHHccccHHHHHHHccEEEEEEccccEEEEccccccEEEEEcccccEEEEEEcccccccEEEEEEcccccccccccc

msnttstnpskpnkkrktnpnpetnFLINLqsctkskdlTTAISLYESAHSQNLRLSLHHFNALLYLcsdsatdpsskdsalrHGFRVFDQMlsnnvipneasVTSVARLAASKNDGDYAFVLIKRMNnefnvvprlrtydpalfCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWfsgqkvngvscdlglVKNAVLkngggwhglgwigqgkwvvkrgsvdesgkccscgdqlacvdiddAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDganiglyqqnfteggfsvpQLDAVVKKLYErsgnkwplvILHNKrlrslwenpshrnlveeWNEKGVLymtphgsnddWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVkgnlklqmpppyssviqesekgswhvpilvkgnssqtwlcitrpnvcesrdeaq

msnttstnpskpnkkrktnpnpetNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKlrstvrcvnEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGggwhglgwigqGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYErsgnkwplvilhnkrlrslwenpshrnLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVkgnssqtwlcitrpnvcesrdeaq

MSNTTstnpskpnkkrktnpnpETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNgggwhglgwigqgKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLCITRPNVCESRDEAQ

*************************FLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCS*************RHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLCITRPNV********

************************NFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFT**GFSVPQLDAVVKKLYERSGNKWPLVILH***************LVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLC**************

*******************PNPETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDS********SALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLCITRPNV********

*******************PNPETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGNSSQTWLCITRPN*********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		501	2.2.26 [Sep-21-2011]
Q680B9		528	Proteinaceous RNase P 2 O	yes	no	0.972	0.922	0.632	0.0
F4JKB6		576	Proteinaceous RNase P 3 O	no	no	0.934	0.812	0.630	1e-180
Q66GI4		572	Proteinaceous RNase P 1,	no	no	0.960	0.840	0.478	1e-120
O15091		583	Mitochondrial ribonucleas	yes	no	0.453	0.389	0.239	9e-11
B5DF07		587	Mitochondrial ribonucleas	yes	no	0.465	0.396	0.235	1e-10
Q8JZY4		584	Mitochondrial ribonucleas	yes	no	0.465	0.398	0.235	2e-09
Q9LR67		660	Pentatricopeptide repeat-	no	no	0.331	0.251	0.214	5e-06
Q9LSQ2		659	Putative pentatricopeptid	no	no	0.209	0.159	0.283	0.0003

>sp\|Q680B9\|PRRP2_ARATH Proteinaceous RNase P 2 OS=Arabidopsis thaliana GN=PRORP2 PE=1 SV=1	Back alignment and function desciption

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/504 (63%), Positives = 395/504 (78%), Gaps = 17/504 (3%)

Query: 10  SKPNKKRKTNPNPETNFLINLQSCTKSKDLTTAISLYESA-HSQNLRLSLHHFNALLYLC 68
           S+PNKK+K + NPETN L NL SC+KSKDL+ A++LY++A  S  +RLS  HF  LLYLC
Sbjct: 17  SRPNKKKKVSRNPETNLLFNLNSCSKSKDLSAALALYDAAITSSEVRLSQQHFQTLLYLC 76

Query: 69  SDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMN 128
           S S TD S +  A+  GF +FD+M+S+ + PNEASVTSVARLAA+K +GDYAF ++K   
Sbjct: 77  SASITDISLQYLAIDRGFEIFDRMVSSGISPNEASVTSVARLAAAKGNGDYAFKVVKEFV 136

Query: 129 NEFNV-VPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGR 187
           +   V +PRLRTY PAL CFCE LEAEK YEVEEHM   G++LE+ EI+ALLKVSA TGR
Sbjct: 137 SVGGVSIPRLRTYAPALLCFCEKLEAEKGYEVEEHMEAAGIALEEAEISALLKVSAATGR 196

Query: 188 VEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKV-----NGVSCDLGLVKNAVLKNGGG 242
             KVY+YL KLR  V CV+EET KIIE+WF G+K      NG+  D+G+++ AVL NGGG
Sbjct: 197 ENKVYRYLHKLREYVGCVSEETLKIIEEWFCGEKAGEVGDNGIGSDVGMLREAVLNNGGG 256

Query: 243 WHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKA 302
           WHG GW+G+GKW VK+G+V  +G+C SC +QLACVD ++ ET++F  S+ ALAM+R+ K 
Sbjct: 257 WHGHGWVGEGKWTVKKGNVSSTGRCLSCSEQLACVDTNEVETQKFVDSLVALAMDRKTKM 316

Query: 303 N-------FSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSG 355
           N       FSEFQDWLEK+ +YEAIVDGANIGLYQQNF +G FS+ QL++V+K+LY  SG
Sbjct: 317 NSCETNVVFSEFQDWLEKHGDYEAIVDGANIGLYQQNFVDGSFSLSQLESVMKELYRESG 376

Query: 356 N-KWPLVILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLL 414
           N KWPL++LH +R+++L ENP+HRNLVEEW   GVLY TP GSNDDWYWLYAA KL+CLL
Sbjct: 377 NNKWPLILLHKRRVKTLLENPTHRNLVEEWISNGVLYATPPGSNDDWYWLYAAAKLKCLL 436

Query: 415 VTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVP 474
           VTNDEMRDHIFELLGS FF KWKERHQV YTFVKGNLKL+MP P+S VIQESEKGSWH P
Sbjct: 437 VTNDEMRDHIFELLGSTFFQKWKERHQVRYTFVKGNLKLEMPSPFSVVIQESEKGSWHFP 496

Query: 475 ILVKGN--SSQTWLCITRPNVCES 496
           +  + N  SS+TW+CI+R ++ +S
Sbjct: 497 VSCENNEESSRTWMCISRQSILDS 520

Endonuclease RNase P responsible for the 5' maturation of tRNA precursors. Also involved in the maturation of mRNA and small nucleolar RNA (snoRNA).
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: 6EC: .EC: 5

>sp\|F4JKB6\|PRRP3_ARATH Proteinaceous RNase P 3 OS=Arabidopsis thaliana GN=PRORP3 PE=1 SV=1	Back alignment and function description

>sp\|Q66GI4\|PRRP1_ARATH Proteinaceous RNase P 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PRORP1 PE=1 SV=1	Back alignment and function description

>sp\|O15091\|MRRP3_HUMAN Mitochondrial ribonuclease P protein 3 OS=Homo sapiens GN=KIAA0391 PE=1 SV=2	Back alignment and function description

>sp\|B5DF07\|MRRP3_RAT Mitochondrial ribonuclease P protein 3 OS=Rattus norvegicus GN=Mrpp3 PE=2 SV=1	Back alignment and function description

>sp\|Q8JZY4\|MRRP3_MOUSE Mitochondrial ribonuclease P protein 3 OS=Mus musculus GN=Kiaa0391 PE=2 SV=1	Back alignment and function description

>sp\|Q9LR67\|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1	Back alignment and function description

>sp\|Q9LSQ2\|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		501
255576329		561	multidrug resistance pump, putative [Ric	0.994	0.887	0.683	0.0
224080794		557	predicted protein [Populus trichocarpa]	0.970	0.872	0.709	0.0
224132016		557	predicted protein [Populus trichocarpa]	0.970	0.872	0.707	0.0
224103055		482	predicted protein [Populus trichocarpa]	0.940	0.977	0.706	0.0
356543574		530	PREDICTED: pentatricopeptide repeat-cont	0.940	0.888	0.696	0.0
356547141		550	PREDICTED: pentatricopeptide repeat-cont	0.958	0.872	0.700	0.0
297799862		517	predicted protein [Arabidopsis lyrata su	0.970	0.940	0.632	0.0
359486225		551	PREDICTED: pentatricopeptide repeat-cont	0.936	0.851	0.654	0.0
449480803		538	PREDICTED: proteinaceous RNase P 3-like	0.984	0.916	0.607	0.0
449466671		538	PREDICTED: proteinaceous RNase P 3-like	0.984	0.916	0.607	1e-180

>gi\|255576329\|ref\|XP_002529057.1\| multidrug resistance pump, putative [Ricinus communis] gi\|223531469\|gb\|EEF33301.1\| multidrug resistance pump, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/502 (68%), Positives = 409/502 (81%), Gaps = 4/502 (0%)

Query: 2   SNTTSTNPSKPNKKRKTNPNPETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHF 61
           + TT+T P    K  K N  PE+ F  NL   +KSKDL +AISLY++A S   +L+ HH+
Sbjct: 3   TGTTTTAPVGKKKPNKKNQTPESQFNYNLNFYSKSKDLNSAISLYKTAISNKTQLNQHHY 62

Query: 62  NALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAF 121
           N LLYLCS S  DPS K+ AL++GF +F+ M++  +  NEAS+T++ARLAA+K DGDYAF
Sbjct: 63  NTLLYLCSISLNDPSEKELALQNGFDIFEHMVATGIKRNEASITAIARLAAAKGDGDYAF 122

Query: 122 VLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKV 181
            LIK M  + N +PRLRTYDP LFCFCE LEA KAYEVE+H+  MG++LE+ EIAALLKV
Sbjct: 123 NLIKNMLVD-NQLPRLRTYDPVLFCFCEKLEAFKAYEVEDHIVSMGMNLEELEIAALLKV 181

Query: 182 SAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGG 241
           S ET   E+VY YLQKLR TVRCV EET KI+EDWF   +VNG   D+GLV+ AV+KNGG
Sbjct: 182 SVETKNKERVYGYLQKLRKTVRCVKEETAKIVEDWFKDFEVNGKELDVGLVRKAVVKNGG 241

Query: 242 GWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVK 301
           GWHGLGWI +GKW VKRG++D  G+CC CG+ LACVDIDD ETERFA S+A LAMEREVK
Sbjct: 242 GWHGLGWIEKGKWGVKRGNMDMDGRCCCCGESLACVDIDDLETERFAGSLAGLAMEREVK 301

Query: 302 ANFSEFQDWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLV 361
           ANFSEFQDWL+KNA+Y+AIVDGAN+GLYQQNF EGGFS+ QLDAVVK+LY+RSG KWPL+
Sbjct: 302 ANFSEFQDWLDKNADYDAIVDGANVGLYQQNFAEGGFSISQLDAVVKELYDRSG-KWPLI 360

Query: 362 ILHNKRLRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMR 421
           +LHNKR+R++ ENPS RNL++EW EK +LY TPHGSNDDWYWLYAAVKL+CLLVTNDEMR
Sbjct: 361 VLHNKRVRAILENPSQRNLIQEWTEKDILYTTPHGSNDDWYWLYAAVKLKCLLVTNDEMR 420

Query: 422 DHIFELLGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGN- 480
           DHIFELLGS+FFLKWKERHQV YTFVKG LKLQMPPP+S +IQESEKGSWHVPI   GN 
Sbjct: 421 DHIFELLGSSFFLKWKERHQVRYTFVKGKLKLQMPPPFSVLIQESEKGSWHVPIAGDGNE 480

Query: 481 -SSQTWLCITRPNVCESRDEAQ 501
            S+Q+WLCITR + C + D+ +
Sbjct: 481 DSAQSWLCITRSSACYAPDKDE 502

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224080794\|ref\|XP_002306233.1\| predicted protein [Populus trichocarpa] gi\|222849197\|gb\|EEE86744.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224132016\|ref\|XP_002328164.1\| predicted protein [Populus trichocarpa] gi\|222837679\|gb\|EEE76044.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224103055\|ref\|XP_002312906.1\| predicted protein [Populus trichocarpa] gi\|222849314\|gb\|EEE86861.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356543574\|ref\|XP_003540235.1\| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|356547141\|ref\|XP_003541975.1\| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|297799862\|ref\|XP_002867815.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297313651\|gb\|EFH44074.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|359486225\|ref\|XP_003633416.1\| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449480803\|ref\|XP_004156000.1\| PREDICTED: proteinaceous RNase P 3-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449466671\|ref\|XP_004151049.1\| PREDICTED: proteinaceous RNase P 3-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		501
TAIR\|locus:2059824		528	PRORP2 "proteinaceous RNase P	0.946	0.897	0.613	1.9e-161
TAIR\|locus:2141662		576	PRORP3 "AT4G21900" [Arabidopsi	0.934	0.812	0.608	1e-155
TAIR\|locus:2045432		572	PRORP1 "proteinaceous RNase P	0.908	0.795	0.473	1.1e-110
TAIR\|locus:2175178		156	AT5G60430 [Arabidopsis thalian	0.225	0.724	0.533	3e-30
RGD\|1305089		587	RGD1305089 "similar to 1110008	0.465	0.396	0.235	1.9e-11
MGI\|MGI:1913382		584	1110008L16Rik "RIKEN cDNA 1110	0.465	0.398	0.235	3.7e-10
UNIPROTKB\|O15091		583	KIAA0391 "Mitochondrial ribonu	0.453	0.389	0.239	1.8e-09
TAIR\|locus:2020808		660	AT1G03560 [Arabidopsis thalian	0.341	0.259	0.218	0.00014
TAIR\|locus:2086032		659	PPR40 "pentatricopeptide (PPR)	0.263	0.200	0.251	0.0005

TAIR\|locus:2059824 PRORP2 "proteinaceous RNase P 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1572 (558.4 bits), Expect = 1.9e-161, P = 1.9e-161
 Identities = 301/491 (61%), Positives = 372/491 (75%)

Query:    23 ETNFLINLQSCTKSKDLTTAISLYESA-HSQNLRLSLHHFNALLYLCSDSATDPSSKDSA 81
             ETN L NL SC+KSKDL+ A++LY++A  S  +RLS  HF  LLYLCS S TD S +  A
Sbjct:    30 ETNLLFNLNSCSKSKDLSAALALYDAAITSSEVRLSQQHFQTLLYLCSASITDISLQYLA 89

Query:    82 LRHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNV-VPRLRTY 140
             +  GF +FD+M+S+ + PNEASVTSVARLAA+K +GDYAF ++K   +   V +PRLRTY
Sbjct:    90 IDRGFEIFDRMVSSGISPNEASVTSVARLAAAKGNGDYAFKVVKEFVSVGGVSIPRLRTY 149

Query:   141 DPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRS 200
              PAL CFCE LEAEK YEVEEHM   G++LE+ EI+ALLKVSA TGR  KVY+YL KLR 
Sbjct:   150 APALLCFCEKLEAEKGYEVEEHMEAAGIALEEAEISALLKVSAATGRENKVYRYLHKLRE 209

Query:   201 TVRCVNEETGKIIEDWFSGQKV-----NGVSCDLGLVKNAVLKNXXXXXXXXXXXXXKWV 255
              V CV+EET KIIE+WF G+K      NG+  D+G+++ AVL N             KW 
Sbjct:   210 YVGCVSEETLKIIEEWFCGEKAGEVGDNGIGSDVGMLREAVLNNGGGWHGHGWVGEGKWT 269

Query:   256 VKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKAN-------FSEFQ 308
             VK+G+V  +G+C SC +QLACVD ++ ET++F  S+ ALAM+R+ K N       FSEFQ
Sbjct:   270 VKKGNVSSTGRCLSCSEQLACVDTNEVETQKFVDSLVALAMDRKTKMNSCETNVVFSEFQ 329

Query:   309 DWLEKNANYEAIVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGN-KWPLVILHNKR 367
             DWLEK+ +YEAIVDGANIGLYQQNF +G FS+ QL++V+K+LY  SGN KWPL++LH +R
Sbjct:   330 DWLEKHGDYEAIVDGANIGLYQQNFVDGSFSLSQLESVMKELYRESGNNKWPLILLHKRR 389

Query:   368 LRSLWENPSHRNLVEEWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFEL 427
             +++L ENP+HRNLVEEW   GVLY TP GSNDDWYWLYAA KL+CLLVTNDEMRDHIFEL
Sbjct:   390 VKTLLENPTHRNLVEEWISNGVLYATPPGSNDDWYWLYAAAKLKCLLVTNDEMRDHIFEL 449

Query:   428 LGSNFFLKWKERHQVHYTFVKGNLKLQMPPPYSSVIQESEKGSWHVPILVKGN--SSQTW 485
             LGS FF KWKERHQV YTFVKGNLKL+MP P+S VIQESEKGSWH P+  + N  SS+TW
Sbjct:   450 LGSTFFQKWKERHQVRYTFVKGNLKLEMPSPFSVVIQESEKGSWHFPVSCENNEESSRTW 509

Query:   486 LCITRPNVCES 496
             +CI+R ++ +S
Sbjct:   510 MCISRQSILDS 520

GO:0005739 "mitochondrion" evidence=ISM

GO:0016020 "membrane" evidence=IEA

GO:0005634 "nucleus" evidence=IDA

GO:0001682 "tRNA 5'-leader removal" evidence=IDA

GO:0004526 "ribonuclease P activity" evidence=IDA

GO:0006397 "mRNA processing" evidence=IMP

GO:0043144 "snoRNA processing" evidence=IMP

TAIR\|locus:2141662 PRORP3 "AT4G21900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2045432 PRORP1 "proteinaceous RNase P 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175178 AT5G60430 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

RGD\|1305089 RGD1305089 "similar to 1110008L16Rik protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1913382 1110008L16Rik "RIKEN cDNA 1110008L16 gene" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|O15091 KIAA0391 "Mitochondrial ribonuclease P protein 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2020808 AT1G03560 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2086032 PPR40 "pentatricopeptide (PPR) domain protein 40" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q680B9	PRRP2_ARATH	3, ., 1, ., 2, 6, ., 5	0.6329	0.9720	0.9223	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.IV.1562.1	hypothetical protein (481 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		501
PLN03218		1060	PLN03218, PLN03218, maturation of RBCL 1; Provisio	3e-04
pfam11977		155	pfam11977, RNase_Zc3h12a, Zc3h12a-like Ribonucleas	0.001

>gnl\|CDD\|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional	Back alignment and domain information

 Score = 42.9 bits (101), Expect = 3e-04
 Identities = 35/185 (18%), Positives = 74/185 (40%), Gaps = 11/185 (5%)

Query: 30  LQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVF 89
           +++C  +  +  A  +Y+  H  N++ +   +   +  CS                  ++
Sbjct: 586 MKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGD--------WDFALSIY 637

Query: 90  DQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCE 149
           D M    V P+E   +++  +A    D D AF +++    +  +     +Y  +L   C 
Sbjct: 638 DDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQ-GIKLGTVSYS-SLMGACS 695

Query: 150 NL-EAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEE 208
           N    +KA E+ E +  + L      + AL+    E  ++ K  + L +++    C N  
Sbjct: 696 NAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTI 755

Query: 209 TGKII 213
           T  I+
Sbjct: 756 TYSIL 760

Length = 1060

>gnl\|CDD\|221353 pfam11977, RNase_Zc3h12a, Zc3h12a-like Ribonuclease NYN domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		501
PLN03218		1060	maturation of RBCL 1; Provisional	100.0
PLN03077		857	Protein ECB2; Provisional	100.0
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	100.0
PLN03218		1060	maturation of RBCL 1; Provisional	100.0
PLN03077		857	Protein ECB2; Provisional	100.0
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.98
PF11977		155	RNase_Zc3h12a: Zc3h12a-like Ribonuclease NYN domai	99.93
PF13041		50	PPR_2: PPR repeat family	99.41
PF13041		50	PPR_2: PPR repeat family	99.37
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.29
KOG4422		625	consensus Uncharacterized conserved protein [Funct	99.29
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.26
KOG4422		625	consensus Uncharacterized conserved protein [Funct	99.09
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	98.83
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	98.83
PF12854		34	PPR_1: PPR repeat	98.83
PF12854		34	PPR_1: PPR repeat	98.76
KOG4318		1088	consensus Bicoid mRNA stability factor [RNA proces	98.56
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.54
KOG3777		443	consensus Uncharacterized conserved protein [Funct	98.39
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.32
TIGR00756		35	PPR pentatricopeptide repeat domain (PPR motif). T	98.27
TIGR00756		35	PPR pentatricopeptide repeat domain (PPR motif). T	98.18
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	98.17
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	98.16
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	98.13
PF13812		34	PPR_3: Pentatricopeptide repeat domain	98.13
KOG4318		1088	consensus Bicoid mRNA stability factor [RNA proces	98.12
PF13812		34	PPR_3: Pentatricopeptide repeat domain	98.07
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	98.06
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.05
PF01535		31	PPR: PPR repeat; InterPro: IPR002885 This entry re	97.98
PF08579		120	RPM2: Mitochondrial ribonuclease P subunit (RPM2);	97.98
PF10037		429	MRP-S27: Mitochondrial 28S ribosomal protein S27;	97.9
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	97.88
PRK12370		553	invasion protein regulator; Provisional	97.81
PF01535		31	PPR: PPR repeat; InterPro: IPR002885 This entry re	97.8
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	97.78
PRK12370		553	invasion protein regulator; Provisional	97.76
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	97.75
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	97.71
PF10037		429	MRP-S27: Mitochondrial 28S ribosomal protein S27;	97.65
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	97.63
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	97.54
PF08579		120	RPM2: Mitochondrial ribonuclease P subunit (RPM2);	97.53
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	97.48
KOG1129		478	consensus TPR repeat-containing protein [General f	97.47
PRK14574		822	hmsH outer membrane protein; Provisional	97.39
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.39
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	97.39
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	97.36
PF06239		228	ECSIT: Evolutionarily conserved signalling interme	97.36
PRK14574		822	hmsH outer membrane protein; Provisional	97.34
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	97.31
KOG2003		840	consensus TPR repeat-containing protein [General f	97.24
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.21
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	97.18
PF06239		228	ECSIT: Evolutionarily conserved signalling interme	97.13
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	97.11
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	97.11
PRK11189		296	lipoprotein NlpI; Provisional	97.1
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.09
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.05
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	97.05
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	97.0
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	96.97
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	96.88
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.82
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	96.82
KOG1126		638	consensus DNA-binding cell division cycle control	96.81
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	96.8
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	96.79
PRK11189		296	lipoprotein NlpI; Provisional	96.78
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	96.77
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	96.77
PF12921		126	ATP13: Mitochondrial ATPase expression; InterPro:	96.76
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	96.67
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	96.54
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	96.45
PRK15359		144	type III secretion system chaperone protein SscB;	96.43
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	96.39
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	96.32
COG4783		484	Putative Zn-dependent protease, contains TPR repea	96.23
KOG2076		895	consensus RNA polymerase III transcription factor	96.22
PRK10370		198	formate-dependent nitrite reductase complex subuni	96.19
PRK15359		144	type III secretion system chaperone protein SscB;	96.17
TIGR02552		135	LcrH_SycD type III secretion low calcium response	96.15
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	96.12
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.11
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	96.1
PF12921		126	ATP13: Mitochondrial ATPase expression; InterPro:	96.08
KOG2003		840	consensus TPR repeat-containing protein [General f	96.06
KOG1129		478	consensus TPR repeat-containing protein [General f	95.96
TIGR02552		135	LcrH_SycD type III secretion low calcium response	95.95
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	95.91
PRK10370		198	formate-dependent nitrite reductase complex subuni	95.75
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	95.71
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	95.65
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	95.64
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	95.6
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	95.42
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	95.38
smart00299		140	CLH Clathrin heavy chain repeat homology.	95.35
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	95.3
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	95.29
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	95.26
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	95.26
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	95.12
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	95.06
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	95.0
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	94.94
PF03704		146	BTAD: Bacterial transcriptional activator domain;	94.93
KOG1915		677	consensus Cell cycle control protein (crooked neck	94.87
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	94.78
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	94.63
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	94.6
KOG4340		459	consensus Uncharacterized conserved protein [Funct	94.59
KOG1126		638	consensus DNA-binding cell division cycle control	94.49
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	94.45
KOG1128		777	consensus Uncharacterized conserved protein, conta	94.43
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	94.36
KOG3941		406	consensus Intermediate in Toll signal transduction	94.36
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	94.3
PF13170		297	DUF4003: Protein of unknown function (DUF4003)	94.23
KOG3785		557	consensus Uncharacterized conserved protein [Funct	94.22
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	94.2
KOG2076		895	consensus RNA polymerase III transcription factor	94.2
KOG3941		406	consensus Intermediate in Toll signal transduction	94.19
KOG0547		606	consensus Translocase of outer mitochondrial membr	94.14
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	94.02
PF03704		146	BTAD: Bacterial transcriptional activator domain;	93.91
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	93.87
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	93.83
PF05991		166	NYN_YacP: YacP-like NYN domain; InterPro: IPR01029	93.77
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	93.6
PF13170		297	DUF4003: Protein of unknown function (DUF4003)	93.12
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	93.07
PF13929		292	mRNA_stabil: mRNA stabilisation	93.07
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	93.05
KOG1915		677	consensus Cell cycle control protein (crooked neck	93.05
PF12688		120	TPR_5: Tetratrico peptide repeat	92.97
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	92.8
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	92.79
PRK10803		263	tol-pal system protein YbgF; Provisional	92.72
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	92.46
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	92.42
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	92.09
KOG3616		1636	consensus Selective LIM binding factor [Transcript	92.0
KOG0495		913	consensus HAT repeat protein [RNA processing and m	91.82
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	91.72
KOG3060		289	consensus Uncharacterized conserved protein [Funct	91.5
COG4783		484	Putative Zn-dependent protease, contains TPR repea	91.45
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	91.42
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	90.98
PRK04841		903	transcriptional regulator MalT; Provisional	90.89
KOG2047		835	consensus mRNA splicing factor [RNA processing and	90.85
KOG0547		606	consensus Translocase of outer mitochondrial membr	90.78
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	90.69
KOG1128		777	consensus Uncharacterized conserved protein, conta	90.67
KOG0495		913	consensus HAT repeat protein [RNA processing and m	90.08
PF13371		73	TPR_9: Tetratricopeptide repeat	90.07
PRK14720		906	transcript cleavage factor/unknown domain fusion p	89.82
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	89.69
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	89.58
PF07035		167	Mic1: Colon cancer-associated protein Mic1-like; I	89.24
KOG3616		1636	consensus Selective LIM binding factor [Transcript	88.43
KOG2376		652	consensus Signal recognition particle, subunit Srp	88.42
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	88.41
KOG2796		366	consensus Uncharacterized conserved protein [Funct	88.33
PF12688		120	TPR_5: Tetratrico peptide repeat	88.13
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	88.12
PRK04841		903	transcriptional regulator MalT; Provisional	88.09
smart00299		140	CLH Clathrin heavy chain repeat homology.	87.53
COG3629		280	DnrI DNA-binding transcriptional activator of the	87.36
PRK10803		263	tol-pal system protein YbgF; Provisional	87.19
COG3629		280	DnrI DNA-binding transcriptional activator of the	87.1
KOG3785		557	consensus Uncharacterized conserved protein [Funct	87.1
PRK14720		906	transcript cleavage factor/unknown domain fusion p	86.93
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	86.88
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	86.32
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	85.96
PF13929		292	mRNA_stabil: mRNA stabilisation	85.94
PLN02789		320	farnesyltranstransferase	85.41
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	85.4
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	85.39
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	84.76
KOG2796		366	consensus Uncharacterized conserved protein [Funct	84.58
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	84.47
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	84.4
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	84.25
PF14626		122	RNase_Zc3h12a_2: Zc3h12a-like Ribonuclease NYN dom	84.1
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	83.38
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	83.23
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	82.63
KOG4340		459	consensus Uncharacterized conserved protein [Funct	82.51
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	82.22
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	81.95
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	81.01
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	80.56
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	80.26
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	80.03

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

Probab=100.00  E-value=3.8e-36  Score=338.74  Aligned_cols=281  Identities=12%  Similarity=0.137  Sum_probs=238.4

Q ss_pred             CCCCH-hHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCCCCCCChhhHHHHHHHHHHHHhCCC
Q 010790           19 NPNPE-TNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNV   97 (501)
Q Consensus        19 ~~~p~-~~~n~lI~~~~k~g~~~~A~~lf~~m~~~gv~p~~~ty~~LL~~c~~~~~~~~~k~~~~~~a~~lf~~M~~~g~   97 (501)
                      ...|+ .+||+||.+|++.|++++|+++|++|.+.|+.||.+||++||.+|++.+        ++++|+++|++|.+.|+
T Consensus       467 Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G--------~~eeAl~lf~~M~~~Gv  538 (1060)
T PLN03218        467 GLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAG--------QVAKAFGAYGIMRSKNV  538 (1060)
T ss_pred             CCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCc--------CHHHHHHHHHHHHHcCC
Confidence            33444 5888888888888888888888888888888888888888888888887        89999999999999999


Q ss_pred             CCCHHHHHHHHHHHHhCCCHHHHHHHHHHhHhh--cCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHH
Q 010790           98 IPNEASVTSVARLAASKNDGDYAFVLIKRMNNE--FNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMGLSLEQQEI  175 (501)
Q Consensus        98 ~pd~~t~~~li~~~~~~g~~~~A~~l~~~M~~~--~gi~P~~~ty~~lI~~~~~~g~~~~A~~lf~~M~~~gv~pd~~t~  175 (501)
                      .||..|||+||.+|++.|++++|+++|++| ..  .|+.||.+||++||.+|++.|++++|.++|++|.+.|+.|+..+|
T Consensus       539 ~PD~vTYnsLI~a~~k~G~~deA~~lf~eM-~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~ty  617 (1060)
T PLN03218        539 KPDRVVFNALISACGQSGAVDRAFDVLAEM-KAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVY  617 (1060)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHH-HHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHH
Confidence            999999999999999999999999999999 65  678999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHhccCcCCCcccchhhHHHHHHhcCCcccCCccccCCceE
Q 010790          176 AALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSGQKVNGVSCDLGLVKNAVLKNGGGWHGLGWIGQGKWV  255 (501)
Q Consensus       176 ~~Li~~~~~~g~~~~a~~ll~~M~~~~~~p~~~t~~~i~~~f~~~~~~~~~~~~~~v~~~~~~~g~~~~g~g~~~~~~w~  255 (501)
                      |+||.+|++.|+.++|.++|++|...|+.||..|+.+++..|...+   ..-.+..+.+.+.+.|....         ..
T Consensus       618 nsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G---~~eeA~~l~~eM~k~G~~pd---------~~  685 (1060)
T PLN03218        618 TIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAG---DLDKAFEILQDARKQGIKLG---------TV  685 (1060)
T ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCC---CHHHHHHHHHHHHHcCCCCC---------HH
Confidence            9999999999999999999999999999999999999999885543   11234445555555443222         23


Q ss_pred             EEEeeecCCCCCCCCCCcccccC-CC----HHHHHHHHHHHHHHHHhhhHHhhHHHHHHHHHHcCCccEE
Q 010790          256 VKRGSVDESGKCCSCGDQLACVD-ID----DAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAI  320 (501)
Q Consensus       256 v~~~~v~~~gkCg~~~~al~~~~-l~----~~e~~~~~~~i~~~a~~g~~~~~l~~F~~~l~~~~~~D~v  320 (501)
                      +-+++|++|.+||....++.+|+ |.    ..+...|+.+|.+++..|+..++++.|++|.+.+..||.+
T Consensus       686 tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~  755 (1060)
T PLN03218        686 SYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTI  755 (1060)
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHH
Confidence            45689999999999999998875 31    2578899999999999999999999999999988777754

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PF11977 RNase_Zc3h12a: Zc3h12a-like Ribonuclease NYN domain; InterPro: IPR021869 This domain is found in the Zc3h12a protein which has shown to be a ribonuclease that controls the stability of a set of inflammatory genes []	Back alignment and domain information

>PF13041 PPR_2: PPR repeat family	Back alignment and domain information

>PF13041 PPR_2: PPR repeat family	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG4422 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG4422 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PF12854 PPR_1: PPR repeat	Back alignment and domain information

>PF12854 PPR_1: PPR repeat	Back alignment and domain information

>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG3777 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif)	Back alignment and domain information

>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif)	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PF13812 PPR_3: Pentatricopeptide repeat domain	Back alignment and domain information

>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification]	Back alignment and domain information

>PF13812 PPR_3: Pentatricopeptide repeat domain	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat	Back alignment and domain information

>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends	Back alignment and domain information

>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>smart00299 CLH Clathrin heavy chain repeat homology	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13170 DUF4003: Protein of unknown function (DUF4003)	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF05991 NYN_YacP: YacP-like NYN domain; InterPro: IPR010298 This family consists of several hypothetical bacterial proteins as well as some uncharacterised sequences from Arabidopsis thaliana	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF13170 DUF4003: Protein of unknown function (DUF4003)	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF13929 mRNA_stabil: mRNA stabilisation	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>smart00299 CLH Clathrin heavy chain repeat homology	Back alignment and domain information

>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms]	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF13929 mRNA_stabil: mRNA stabilisation	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF14626 RNase_Zc3h12a_2: Zc3h12a-like Ribonuclease NYN domain	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		501
4g24_A		501	Crystal Structure Of Proteinaceous Rnase P 1 (Prorp		1e-119
4g23_A		501	Crystal Structure Of Proteinaceous Rnase P 1 (Prorp		1e-113

>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501

Back alignment and structure

Iteration: 1

Score = 424 bits (1090), Expect = e-119, Method: Compositional matrix adjust. Identities = 222/471 (47%), Positives = 311/471 (66%), Gaps = 16/471 (3%) Query: 30 LQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCS--DSATDPSSKDSALRHGFR 87 L C+K D+ A+ LY+ A ++LS +H+N LLY+CS ++AT+ SS + L GF Sbjct: 33 LDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATE-SSPNPGLSRGFD 91 Query: 88 VFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCF 147 +F QM+ + V+PNEA+ T+ ARLA +K+D + AF ++K+M F + PRLR+Y PALF F Sbjct: 92 IFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMK-AFGIQPRLRSYGPALFGF 150 Query: 148 CENLEAEKAYEVEEHMGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNE 207 C +A+KAYEV+ HM + E+ E+AALLKVS +T +KVY+ LQ+LR VR V++ Sbjct: 151 CRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSK 210 Query: 208 ETGKIIEDWFSGQ---KVNGVSCDLGLVKNAVLKNXXXXXXXXXXXXXKWVVKRGSVDES 264 T +IE+WF + K D+ +++AV+ KW VKR +DE+ Sbjct: 211 STFDMIEEWFKSEVATKTGVKKWDVKKIRDAVVSGGGGWHGQGWLGTGKWNVKRTEMDEN 270 Query: 265 GKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEAIVDGA 324 G C C ++L C+DI+ ETE FA S+ LA EREVKANF++FQ+WLE++ ++A++DGA Sbjct: 271 GVCKCCKEKLVCIDINPVETETFAASLTRLACEREVKANFNQFQEWLERHGPFDAVIDGA 330 Query: 325 NIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNK-WPLVILHNKRLRSLWEN-PSHRNLVE 382 N+GL Q FS QL+ V++ + S +K PLVILH R+ P +R L+E Sbjct: 331 NMGLVNQR----SFSFFQLNNTVQRCQQISPSKRLPLVILHKSRVNGGPATYPKNRALLE 386 Query: 383 EWNEKGVLYMTPHGSNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQV 442 +W G LY TP GSNDDWYWLYAAV +CLLVTNDEMRDH+F+LLG++FF +WKE+HQV Sbjct: 387 KWKNAGALYATPPGSNDDWYWLYAAVSCKCLLVTNDEMRDHLFQLLGNSFFPRWKEKHQV 446 Query: 443 HYTFVKGN-LKLQMPPPYSSVIQESEKGSWHVPILVKGN--SSQTWLCITR 490 + + + LKL MPPPYS VIQESE G+WHVP+ V+ + +S+ WLC R Sbjct: 447 RISVTREDGLKLNMPPPYSIVIQESEDGTWHVPMSVEDDLQTSRQWLCAKR 497

PyMOL of 4g24

>pdb|4G23|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		501
3v32_B		185	Ribonuclease ZC3H12A; rossmann-like sandwich fold,	6e-28
3v33_A		223	Ribonuclease ZC3H12A; rossmann-like sandwich fold,	1e-24
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04

>3v32_B Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} PDB: 3v34_A Length = 185	Back alignment and structure

 Score =  109 bits (272), Expect = 6e-28
 Identities = 31/148 (20%), Positives = 61/148 (41%), Gaps = 17/148 (11%)

Query: 320 IVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSGNKWPLVILHNKRLRSLWENP-SHR 378
           ++DG+N+ +   N     FS   +   V    ER      + +   ++ +   + P + +
Sbjct: 28  VIDGSNVAMSHGNKEV--FSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQ 85

Query: 379 NLVEEWNEKGVLYMTPHG--------SNDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGS 430
           +++ E  +K +L  TP            DD + +  A +   ++V+ND  RD   E    
Sbjct: 86  HILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGE---R 142

Query: 431 NFFLKWKERHQVHYTFVKGNLKLQMPPP 458
             + ++ E   + Y+FV       MPP 
Sbjct: 143 QEWKRFIEERLLMYSFVNDKF---MPPD 167

PyMOL of 3v32

>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} Length = 223	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		501
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	100.0
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	99.95
3v33_A		223	Ribonuclease ZC3H12A; rossmann-like sandwich fold,	99.93
3v32_B		185	Ribonuclease ZC3H12A; rossmann-like sandwich fold,	99.93
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	99.81
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	99.8
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.61
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.54
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	98.99
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	98.97
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	98.89
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	98.89
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	98.87
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	98.87
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	98.85
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	98.85
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	98.83
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	98.83
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.75
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.72
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	98.72
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	98.7
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	98.69
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	98.68
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	98.67
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.64
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	98.62
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	98.61
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	98.56
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	98.56
2gw1_A		514	Mitochondrial precursor proteins import receptor;	98.55
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.53
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	98.53
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	98.52
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.52
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	98.52
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	98.52
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	98.47
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	98.46
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.45
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.44
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.4
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.38
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	98.36
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	98.34
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.34
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	98.33
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	98.32
2gw1_A		514	Mitochondrial precursor proteins import receptor;	98.31
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.3
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.28
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	98.25
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	98.23
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.16
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.15
3u4t_A		272	TPR repeat-containing protein; structural genomics	98.11
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.11
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	98.05
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.03
3u4t_A		272	TPR repeat-containing protein; structural genomics	98.03
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.02
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	98.01
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	97.97
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	97.94
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	97.94
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	97.91
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	97.87
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	97.76
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	97.75
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.73
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	97.72
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.71
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	97.71
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.67
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	97.66
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.66
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.63
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.59
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	97.59
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.55
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	97.54
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	97.51
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	97.5
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	97.49
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	97.49
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.48
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	97.47
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	97.46
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	97.46
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	97.44
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	97.44
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	97.44
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.42
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	97.42
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	97.4
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	97.39
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	97.35
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	97.33
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	97.32
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	97.32
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	97.3
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	97.29
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	97.28
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.26
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	97.2
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	97.19
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	97.17
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.15
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.15
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.13
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.09
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.04
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.03
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	97.03
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	97.01
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	97.0
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.96
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	96.94
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	96.93
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	96.93
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	96.93
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	96.92
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	96.88
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	96.83
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	96.77
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	96.77
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	96.76
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	96.76
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	96.76
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	96.76
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	96.75
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	96.71
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	96.7
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	96.69
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	96.68
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	96.66
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	96.66
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.65
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.64
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	96.64
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	96.64
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	96.62
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	96.62
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.48
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	96.45
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	96.42
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	96.41
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.4
3k9i_A		117	BH0479 protein; putative protein binding protein,	96.4
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.37
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	96.36
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	96.33
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	96.31
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.29
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	96.25
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	96.19
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	96.12
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	96.09
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	96.07
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	96.04
3k9i_A		117	BH0479 protein; putative protein binding protein,	95.99
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	95.97
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	95.93
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	95.93
4g1t_A		472	Interferon-induced protein with tetratricopeptide	95.92
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	95.9
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	95.85
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	95.83
4g1t_A		472	Interferon-induced protein with tetratricopeptide	95.79
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	95.72
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	95.68
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	95.64
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	95.42
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	95.34
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	95.3
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	95.14
1klx_A		138	Cysteine rich protein B; structural genomics, heli	95.05
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	94.96
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	94.94
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	94.79
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	94.79
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	94.67
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	94.66
2l6j_A		111	TPR repeat-containing protein associated with HSP;	94.63
1klx_A		138	Cysteine rich protein B; structural genomics, heli	94.54
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	94.4
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	94.32
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	94.3
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	94.16
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	94.08
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	93.9
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	93.79
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	93.63
2kat_A		115	Uncharacterized protein; NESG, structure, structur	93.59
2kat_A		115	Uncharacterized protein; NESG, structure, structur	93.56
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	93.45
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	93.42
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	92.25
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	91.97
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	91.92
2l6j_A		111	TPR repeat-containing protein associated with HSP;	91.45
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	91.34
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	91.22
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	90.97
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	90.08
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	89.84
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	89.81
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	89.77
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	89.73
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	89.55
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	87.6
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	87.54
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	87.38
1pc2_A		152	Mitochondria fission protein; unknown function; NM	86.85
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	84.48
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	84.22
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	83.64
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	83.61
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	82.37
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	81.94
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	80.42

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

Probab=100.00  E-value=2e-109  Score=881.42  Aligned_cols=485  Identities=49%  Similarity=0.891  Sum_probs=444.4

Q ss_pred             CCCCCCCCccccccCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCC-CCCCCChhhH
Q 010790            4 TTSTNPSKPNKKRKTNPNPETNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSA-TDPSSKDSAL   82 (501)
Q Consensus         4 ~~~~~~~~~~~~k~~~~~p~~~~n~lI~~~~k~g~~~~A~~lf~~m~~~gv~p~~~ty~~LL~~c~~~~-~~~~~k~~~~   82 (501)
                      .+.++..++.++|....+|+..++.+|++|+|.|++++|+++|++|.+.|++||.+|||+||++|++.+ .....+.+.+
T Consensus         7 s~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l   86 (501)
T 4g26_A            7 SPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGL   86 (501)
T ss_dssp             -----------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHH
T ss_pred             chHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchH
Confidence            456777788888888889999999999999999999999999999999999999999999999999876 3445677789


Q ss_pred             HHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHhHhhcCCCCChhhHHHHHHHHHHcCCHHHHHHHHHH
Q 010790           83 RHGFRVFDQMLSNNVIPNEASVTSVARLAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEH  162 (501)
Q Consensus        83 ~~a~~lf~~M~~~g~~pd~~t~~~li~~~~~~g~~~~A~~l~~~M~~~~gi~P~~~ty~~lI~~~~~~g~~~~A~~lf~~  162 (501)
                      ++|.++|++|...|+.||.+|||+||++|++.|++++|+++|++| ...|+.||.+|||+||.+||+.|++++|.++|++
T Consensus        87 ~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M-~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~  165 (501)
T 4g26_A           87 SRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQM-KAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAH  165 (501)
T ss_dssp             HHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHH-HHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHH-HHcCCCCccceehHHHHHHHHCCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999 9999999999999999999999999999999999


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhCCCCCCHHHHHHHHHHhcc---CcCCCcccchhhHHHHHHhc
Q 010790          163 MGLMGLSLEQQEIAALLKVSAETGRVEKVYQYLQKLRSTVRCVNEETGKIIEDWFSG---QKVNGVSCDLGLVKNAVLKN  239 (501)
Q Consensus       163 M~~~gv~pd~~t~~~Li~~~~~~g~~~~a~~ll~~M~~~~~~p~~~t~~~i~~~f~~---~~~~~~~~~~~~v~~~~~~~  239 (501)
                      |.+.|+.||..||++||++|++.|+.++|+++|++|++.++.|+..|+.+|+.||.+   ...+...|+...+.+++...
T Consensus       166 M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~~a~~~g~~~~d~~~~~~~~~~~  245 (501)
T 4g26_A          166 MVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSEVATKTGVKKWDVKKIRDAVVSG  245 (501)
T ss_dssp             HHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSHHHHTCCBSCCCHHHHHHHHHHH
T ss_pred             HHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcCcchhhhhhhhhhhhhhhhHhcc
Confidence            999999999999999999999999999999999999999999999999999999943   45667789999999999999


Q ss_pred             CCcccCCccccCCceEEEEeeecCCCCCCCCCCcccccCCCHHHHHHHHHHHHHHHHhhhHHhhHHHHHHHHHHcCCccE
Q 010790          240 GGGWHGLGWIGQGKWVVKRGSVDESGKCCSCGDQLACVDIDDAETERFAQSVAALAMEREVKANFSEFQDWLEKNANYEA  319 (501)
Q Consensus       240 g~~~~g~g~~~~~~w~v~~~~v~~~gkCg~~~~al~~~~l~~~e~~~~~~~i~~~a~~g~~~~~l~~F~~~l~~~~~~D~  319 (501)
                      |++|||+||++.+.|.|..+.|+..|+|++|+..|+.++++++|+..|.+.|.++++.++..++|+.|++|+++++|||+
T Consensus       246 g~~~~~~~~~~~~~w~v~~t~v~~~G~C~~c~~~L~~i~l~~~e~~~l~~~i~~~~~~~~~~~~~~~F~~~l~~~~p~d~  325 (501)
T 4g26_A          246 GGGWHGQGWLGTGKWNVKRTEMDENGVCKCCKEKLVCIDINPVETETFAASLTRLACEREVKANFNQFQEWLERHGPFDA  325 (501)
T ss_dssp             TSSCCCSCCCBCSCEEEEEECBCTTSBBTTTCCBCCCCCCCHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHTSCCCSE
T ss_pred             CcccccccccccCceeEEeeecccCCCccchhhhhccccCCHHHHHHHHHHHHHHHHccchHHHHHHHHHHHHhcCCchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCccccccccccCCCCcCchhHHHHHHHHHHhcC-CcceEEEecccccCC-CCCCcchHHHHHHHHhcCeEEeCCCCC
Q 010790          320 IVDGANIGLYQQNFTEGGFSVPQLDAVVKKLYERSG-NKWPLVILHNKRLRS-LWENPSHRNLVEEWNEKGVLYMTPHGS  397 (501)
Q Consensus       320 v~Dg~Nv~~~~~~~~~~~~~~~~i~~vv~~~~~~~~-~~~~l~~l~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~t~~~~  397 (501)
                      ||||+||||++|+    .|++.||+.|++.+++..+ ++.||||+|++|+.+ +...++++.+|++|++++.+|+||++|
T Consensus       326 vIDG~NV~~~~~~----~~~~~~l~~~~~~~~~~~~~~~~~lv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~s  401 (501)
T 4g26_A          326 VIDGANMGLVNQR----SFSFFQLNNTVQRCQQISPSKRLPLVILHKSRVNGGPATYPKNRALLEKWKNAGALYATPPGS  401 (501)
T ss_dssp             EEEHHHHHHTTCS----SCCHHHHHHHHHHHHHHSTTCCCCEEEEEHHHHTSGGGSSHHHHHHHHHHHHTTCEEEECTTC
T ss_pred             hhccchhhccccc----cccHHHHHHHHHHHHHHhhccCCcEEEeehhhhcccccCCHHHHHHHHHHHhcCeEEeCCCCC
Confidence            9999999999887    6899999999999988654 678999999999886 555678899999999999999999999


Q ss_pred             CCcHHHHHHHHhcCceEEeccchhhhHhhhcCchhHHHhhhccEEEEEEec-CeeeeeCCCCccccccccCCCceeeccc
Q 010790          398 NDDWYWLYAAVKLRCLLVTNDEMRDHIFELLGSNFFLKWKERHQVHYTFVK-GNLKLQMPPPYSSVIQESEKGSWHVPIL  476 (501)
Q Consensus       398 ~DD~~~l~aa~~~~~~~vsnD~~Rdh~~~~~~~~~f~rW~~~hq~~~~~~~-~~~~~~~p~~~~~~~q~~~~~~wh~P~~  476 (501)
                      +|||||||||++++|+|||||+||||+|+++++++|+|||++|||+|++.+ ++++|++|+||+++||++++++|||||.
T Consensus       402 ~DD~~~lyAal~~~~~~vsnD~mRdH~f~l~~~~~F~rW~~~hq~~~~~~~~~~~~~~~p~~~~~~~q~~~~~~WHiP~~  481 (501)
T 4g26_A          402 NDDWYWLYAAVSCKCLLVTNDEMRDHLFQLLGNSFFPRWKEKHQVRISVTREDGLKLNMPPPYSIVIQESEDGTWHVPMS  481 (501)
T ss_dssp             CHHHHHHHHHHHHTCEEECCCCCCSGGGGGGTTTHHHHHHHHHEEEEEEETTTEEEEECCCSSCCSCEECTTSCEEEEBC
T ss_pred             CchHHHHHHHHccCCEEEeccccccchhccCCcHHHHHHHhcCeEEEEecCCCCceeccCCCCceeeeecCCCceEeccc
Confidence            999999999999999999999999999999999999999999999999874 5899999999999999998889999998


Q ss_pred             cCCC--CCCceEEeecCCc
Q 010790          477 VKGN--SSQTWLCITRPNV  493 (501)
Q Consensus       477 ~~~~--~~~~wlC~~~~~~  493 (501)
                      ++++  .|++|||++|.+.
T Consensus       482 ~~~~~~~~~~WlC~~r~~~  500 (501)
T 4g26_A          482 VEDDLQTSRQWLCAKRSKT  500 (501)
T ss_dssp             CSCTTTSCCCEEEEEECC-
T ss_pred             CCCCCCCCCeeEeeccCCC
Confidence            7765  8999999998753

PyMOL of 4g26

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens}	Back alignment and structure

>3v32_B Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} PDB: 3v34_A	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		501
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.34
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	98.32
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.18
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.01
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	97.99
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.95
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	97.36
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.08
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	96.78
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	96.74
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	96.72
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	96.68
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	96.66
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	96.65
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.49
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	96.32
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.15
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	96.13
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	96.07
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	96.07
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	96.04
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	95.99
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	95.99
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	95.73
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	95.69
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	95.61
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	95.58
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	95.37
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	94.6
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	94.43
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	93.97
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	93.92
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	93.81
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	93.76
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	93.69
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	92.98
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	92.84
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	91.48
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	91.42
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	91.23
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	91.03
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	90.13
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	89.35
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	88.49
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	88.11
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	87.25
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	86.03

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.34  E-value=3.5e-05  Score=73.02  Aligned_cols=166  Identities=10%  Similarity=0.020  Sum_probs=118.4

Q ss_pred             hHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCCCCCCChhhHHHHHHHHHHHHhCCCCCCHHH
Q 010790           24 TNFLINLQSCTKSKDLTTAISLYESAHSQNLRLSLHHFNALLYLCSDSATDPSSKDSALRHGFRVFDQMLSNNVIPNEAS  103 (501)
Q Consensus        24 ~~~n~lI~~~~k~g~~~~A~~lf~~m~~~gv~p~~~ty~~LL~~c~~~~~~~~~k~~~~~~a~~lf~~M~~~g~~pd~~t  103 (501)
                      ..|...+..+-+.|+.+.|..+|+++...........|...+..+.+.+        ..+.|+++|+.....+.... ..
T Consensus       100 ~l~~~ya~~~~~~~~~~~a~~i~~~~l~~~~~~~~~~w~~~~~~~~~~~--------~~~~ar~i~~~al~~~~~~~-~~  170 (308)
T d2onda1         100 LLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAE--------GIKSGRMIFKKAREDARTRH-HV  170 (308)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHTSSSSCTHHHHHHHHHHHHHHH--------CHHHHHHHHHHHHTSTTCCT-HH
T ss_pred             HHHHHHHHHHHhcccHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHcC--------ChHHHHHHHHHHHHhCCCcH-HH
Confidence            3567777788888888899888888876543333456777777777666        68888888888877654332 23


Q ss_pred             HHHHHH-HHHhCCCHHHHHHHHHHhHhhcCCCCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHCC-CCCC--HHHHHHHH
Q 010790          104 VTSVAR-LAASKNDGDYAFVLIKRMNNEFNVVPRLRTYDPALFCFCENLEAEKAYEVEEHMGLMG-LSLE--QQEIAALL  179 (501)
Q Consensus       104 ~~~li~-~~~~~g~~~~A~~l~~~M~~~~gi~P~~~ty~~lI~~~~~~g~~~~A~~lf~~M~~~g-v~pd--~~t~~~Li  179 (501)
                      |-.... -+...|+.+.|..+|+.+ ... .+-+...|...+..+.+.|+++.|+.+|++..... ..|+  ...|...+
T Consensus       171 ~~~~a~~e~~~~~~~~~a~~i~e~~-l~~-~p~~~~~w~~y~~~~~~~g~~~~aR~~fe~ai~~~~~~~~~~~~iw~~~~  248 (308)
T d2onda1         171 YVTAALMEYYCSKDKSVAFKIFELG-LKK-YGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFL  248 (308)
T ss_dssp             HHHHHHHHHHTSCCHHHHHHHHHHH-HHH-HTTCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHSSSSCGGGCHHHHHHHH
T ss_pred             HHHHHHHHHHhccCHHHHHHHHHHH-HHh-hhhhHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCChHHHHHHHHHHH
Confidence            333333 234567888888888888 332 22355678888888888889988988888876653 4443  45788888


Q ss_pred             HHHHhcCChHHHHHHHHHHHh
Q 010790          180 KVSAETGRVEKVYQYLQKLRS  200 (501)
Q Consensus       180 ~~~~~~g~~~~a~~ll~~M~~  200 (501)
                      .--...|+.+.+..+++++.+
T Consensus       249 ~fE~~~G~~~~~~~~~~r~~~  269 (308)
T d2onda1         249 AFESNIGDLASILKVEKRRFT  269 (308)
T ss_dssp             HHHHHHSCHHHHHHHHHHHHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHH
Confidence            877788888888888887755

PyMOL of d2onda1

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure