Citrus Sinensis ID: 010855
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 499 | ||||||
| 255571178 | 560 | conserved hypothetical protein [Ricinus | 0.967 | 0.862 | 0.683 | 0.0 | |
| 225466287 | 566 | PREDICTED: uncharacterized protein LOC10 | 0.979 | 0.863 | 0.644 | 0.0 | |
| 359480059 | 550 | PREDICTED: uncharacterized protein LOC10 | 0.943 | 0.856 | 0.669 | 0.0 | |
| 296088278 | 657 | unnamed protein product [Vitis vinifera] | 0.975 | 0.741 | 0.646 | 0.0 | |
| 118486577 | 618 | unknown [Populus trichocarpa] | 0.971 | 0.784 | 0.648 | 0.0 | |
| 224125750 | 577 | predicted protein [Populus trichocarpa] | 0.975 | 0.844 | 0.650 | 1e-180 | |
| 356576723 | 607 | PREDICTED: uncharacterized protein LOC10 | 0.975 | 0.802 | 0.616 | 1e-175 | |
| 356535194 | 604 | PREDICTED: uncharacterized protein LOC10 | 0.975 | 0.806 | 0.605 | 1e-170 | |
| 297744225 | 1374 | unnamed protein product [Vitis vinifera] | 0.887 | 0.322 | 0.664 | 1e-169 | |
| 224145849 | 541 | predicted protein [Populus trichocarpa] | 0.919 | 0.848 | 0.616 | 1e-166 |
| >gi|255571178|ref|XP_002526539.1| conserved hypothetical protein [Ricinus communis] gi|223534100|gb|EEF35817.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 681 bits (1756), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 330/483 (68%), Positives = 394/483 (81%)
Query: 16 KLAIRKLRKRVKQKLKTLDSLVREWGFELPEEIITDDATVKCTDFLLSTASGKVEGEKVL 75
K IRKLRKRVK LK S+VREWGFELP E AT+K T+FLL+TASGKVE EK
Sbjct: 77 KSLIRKLRKRVKANLKNYHSIVREWGFELPAENTPIIATIKYTEFLLATASGKVEAEKDP 136
Query: 76 GKIETPFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWIDYYCSQSFQ 135
GKI TPFE+IK+AAYTL A++PCMRL I KEI LL+PDD SH+Y+KW+D YCS+SF+
Sbjct: 137 GKIATPFERIKLAAYTLGAMAPCMRLHASICKEIHCLLDPDDSSHIYRKWVDNYCSKSFE 196
Query: 136 ESALQTEELLDKLSVLLTGEELEVIKKLYYKAIKLHVNFFAAQPVKQQTTVPLSWVKDPV 195
ESALQ EE+LD+LS+ LT EELEV++KLY +A+KL V+F QP+ QQT VPLS V+ PV
Sbjct: 197 ESALQIEEVLDRLSISLTSEELEVLEKLYLQAMKLKVDFHCTQPIVQQTIVPLSRVQSPV 256
Query: 196 EGHLTLFCDFDWTCTAFDSSSILAELAIVTAQKSDPDQSEGKLTWMSSADLRNTWDVLST 255
+ ++T+FCDFD TCTA DSS+ILAE+A++TA K D S+ KLT MSSADLR+TW VLS
Sbjct: 257 DSYITIFCDFDMTCTAVDSSAILAEIALLTAAKVDLTGSKTKLTRMSSADLRSTWGVLSA 316
Query: 256 KYTEEYEQCIESIMSSEAVAEFEYEGLCEALKQLAYFEKNENSRVVQSGVLKGLNLEDIK 315
+Y EE+++CIESIM SEAV +F Y GLCEAL+QL FEK NSRV+QS VLKGL+LEDIK
Sbjct: 317 QYVEEHDRCIESIMPSEAVEKFNYGGLCEALEQLTEFEKRANSRVIQSEVLKGLSLEDIK 376
Query: 316 WASQHLIFQDGCRRFFQNTIKSTNFKTDVHVLSYCWCGDLIRSAFASGDLNAFRVHSNEL 375
A Q ++FQ+GC+ FFQ I+ N KTDVHVLSYCWCGDLIRSAF+SGDLN +VHSNEL
Sbjct: 377 RAGQQIVFQEGCKGFFQKIIRDENLKTDVHVLSYCWCGDLIRSAFSSGDLNVLQVHSNEL 436
Query: 376 VYEESISTGEIVNKLESPLEKLQAFNDILKDHSNDEQNLTVYIGGSPGDLLCLLEADIGI 435
VYEE+ISTGEI+ +E P+EKLQAFND+LK+ + D Q LT+YIGGS GDLLCLL+ADIGI
Sbjct: 437 VYEENISTGEIIRMVECPMEKLQAFNDMLKEQNLDVQQLTIYIGGSVGDLLCLLKADIGI 496
Query: 436 VIGSSSSLRRLGDHFGVSFVPLFSSLVERQKELVDGSSYKWKRLPGTLYTVSSWAEIHAF 495
VIGSS SL+RLGDHFG+SFVPLFS +++RQKEL +G S WK PG LYTVSSWAEIHAF
Sbjct: 497 VIGSSPSLKRLGDHFGISFVPLFSGVLKRQKELGEGVSPNWKAPPGVLYTVSSWAEIHAF 556
Query: 496 ILG 498
ILG
Sbjct: 557 ILG 559
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225466287|ref|XP_002270291.1| PREDICTED: uncharacterized protein LOC100266835 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359480059|ref|XP_002269886.2| PREDICTED: uncharacterized protein LOC100249779 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296088278|emb|CBI36504.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118486577|gb|ABK95127.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224125750|ref|XP_002319666.1| predicted protein [Populus trichocarpa] gi|222858042|gb|EEE95589.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356576723|ref|XP_003556479.1| PREDICTED: uncharacterized protein LOC100813450 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535194|ref|XP_003536133.1| PREDICTED: uncharacterized protein LOC100788250 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297744225|emb|CBI37195.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224145849|ref|XP_002325785.1| predicted protein [Populus trichocarpa] gi|222862660|gb|EEF00167.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 499 | ||||||
| TAIR|locus:2145816 | 617 | AT5G32470 "AT5G32470" [Arabido | 0.971 | 0.786 | 0.570 | 3.9e-147 | |
| POMBASE|SPBC17G9.12c | 274 | SPBC17G9.12c "hydrolase (predi | 0.458 | 0.835 | 0.267 | 1.6e-07 | |
| UNIPROTKB|G4MTS1 | 304 | MGG_04762 "Uncharacterized pro | 0.539 | 0.884 | 0.247 | 5e-07 | |
| SGD|S000000608 | 317 | YCR015C "Putative protein of u | 0.462 | 0.728 | 0.230 | 0.00035 |
| TAIR|locus:2145816 AT5G32470 "AT5G32470" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1437 (510.9 bits), Expect = 3.9e-147, P = 3.9e-147
Identities = 280/491 (57%), Positives = 365/491 (74%)
Query: 12 DEEDKLAIXXXXXXXXXXXXXXDSLVREWGFELPEEIITDDATVKCTDFLLSTASGKVEG 71
D++DKLAI DS V++W ++ +E+ + AT++ T+FLL+TASGKVEG
Sbjct: 127 DDDDKLAISDLRKSVMEELKMHDSFVQDWDLDINKEVSVNSATLRYTEFLLATASGKVEG 186
Query: 72 EKVLGKIETPFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWIDYYCS 131
K G ++TPFEK KVAAYTL A++PCMRL+ + KE +LL+ D +H YKKWID Y S
Sbjct: 187 CKAPGMLDTPFEKTKVAAYTLGAVTPCMRLYAFLGKEFGSLLDLSDVNHPYKKWIDNYSS 246
Query: 132 QSFQESALQTEELLDKLSVLLTGEELEVIKKLYYKAIKLHVNFFAAQPVKQQTTVPLSWV 191
+FQ SA QTE+LL+KLSV +TGEEL++I+KLY +A+KL V FF AQP+ Q T VPL +
Sbjct: 247 DAFQASAKQTEDLLEKLSVSMTGEELDIIEKLYQQAMKLEVEFFHAQPLAQPTIVPL--L 304
Query: 192 KDPVEGHLTLFCDFDWTCTAFDSSSILAELAIVTAQKSDPDQSEGKLTWMSSADLRNTWD 251
K+ + L +F DFD TCT DSS+ILAE+AIVTA K + +S ++ M S+DL+NTW+
Sbjct: 305 KNHSKDDLVIFSDFDLTCTVVDSSAILAEIAIVTAPKDEQSRSGQQIHRMLSSDLKNTWN 364
Query: 252 VLSTKYTEEYEQCIESIMSSEAVAEFEYEGLCEALKQLAYFEKNENSRVVQSGVLKGLNL 311
+LS +YTE YE+CIESI++ + +F+YEGLC+AL+QL+ FEK N+RV++SGVLKGLNL
Sbjct: 365 LLSKQYTEHYEECIESILNKKKADKFDYEGLCKALEQLSDFEKEANNRVIESGVLKGLNL 424
Query: 312 EDIKWASQHLIFQDGCRRFFQNTIKSTNFKTDVHVLSYCWCGDLIRSAFASGDLNAFRVH 371
EDIK A + LI QDGC FQ +K+ N ++HVLSYCWCGDLIR+AF++G ++A VH
Sbjct: 425 EDIKRAGERLILQDGCINVFQKILKTENLNAELHVLSYCWCGDLIRAAFSAGGVDAVEVH 484
Query: 372 SNELVYEESISTGEIVNKLESPLEKLQAFNDILKDHSNDEQN---LTVYIGGSPGDLLCL 428
+NE +EESISTGEI K+ESP+ K Q F IL++ N+ L+VYIG S GDLLCL
Sbjct: 485 ANEFTFEESISTGEIERKVESPINKAQQFKSILQNRKNENNKKSFLSVYIGDSVGDLLCL 544
Query: 429 LEADIGIVIGSSSSLRRLGDHFGVSFVPLFSSLVERQKELVD-GSSYKWKRLPGTLYTVS 487
LEADIGIV+ SSSSLRR+G HFGVSFVPLFS +V++QK+ + SS WK L GTLYTVS
Sbjct: 545 LEADIGIVVSSSSSLRRVGSHFGVSFVPLFSGIVQKQKQHTEESSSSAWKGLSGTLYTVS 604
Query: 488 SWAEIHAFILG 498
SWAEIH+F LG
Sbjct: 605 SWAEIHSFALG 615
|
|
| POMBASE|SPBC17G9.12c SPBC17G9.12c "hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MTS1 MGG_04762 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000608 YCR015C "Putative protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 499 | |||
| COG0819 | 218 | COG0819, TenA, Putative transcription activator [T | 1e-13 | |
| TIGR04306 | 208 | TIGR04306, salvage_TenA, thiaminase II | 1e-08 | |
| PTZ00347 | 504 | PTZ00347, PTZ00347, phosphomethylpyrimidine kinase | 9e-07 | |
| pfam03070 | 210 | pfam03070, TENA_THI-4, TENA/THI-4/PQQC family | 3e-04 | |
| PRK14713 | 530 | PRK14713, PRK14713, multifunctional hydroxymethylp | 0.003 |
| >gnl|CDD|223889 COG0819, TenA, Putative transcription activator [Transcription] | Back alignment and domain information |
|---|
Score = 69.7 bits (171), Expect = 1e-13
Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 24/172 (13%)
Query: 8 SLSHDEEDKLAIRKLRKRVKQKLKTL-DSLVREWGFELPEEIITDD--ATVKCTDFLLST 64
S + D E + K+ + + + L + L E G L E + T+ A T +LL T
Sbjct: 60 SKAPDLELMEELAKIIQFLVEGEMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDT 119
Query: 65 A-SGKVEGEKVLGKIETPFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYK 123
A SG A L+A+ PC+ + I K ++A Y+
Sbjct: 120 AYSGSF-------------------AELLAALLPCLWGYAEIGKRLKAKPRASPN-PPYQ 159
Query: 124 KWIDYYCSQSFQESALQTEELLDKLSVLLTGEELEVIKKLYYKAIKLHVNFF 175
+WID Y S+ FQE+ + E LLD L+ + EELE +K+++ A + + F+
Sbjct: 160 EWIDTYASEEFQEAVEELEALLDSLAENSSEEELEKLKQIFLTASRFELAFW 211
|
Length = 218 |
| >gnl|CDD|213919 TIGR04306, salvage_TenA, thiaminase II | Back alignment and domain information |
|---|
| >gnl|CDD|240375 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217351 pfam03070, TENA_THI-4, TENA/THI-4/PQQC family | Back alignment and domain information |
|---|
| >gnl|CDD|237797 PRK14713, PRK14713, multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| COG0819 | 218 | TenA Putative transcription activator [Transcripti | 100.0 | |
| PRK14713 | 530 | multifunctional hydroxymethylpyrimidine phosphokin | 99.96 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 99.95 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 99.94 | |
| PF03070 | 210 | TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR0 | 99.94 | |
| PTZ00347 | 504 | phosphomethylpyrimidine kinase; Provisional | 99.94 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 99.93 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.92 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.9 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.88 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.88 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 99.85 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 99.84 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.84 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.83 | |
| PF05822 | 246 | UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter | 99.83 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.82 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.82 | |
| KOG3128 | 298 | consensus Uncharacterized conserved protein [Funct | 99.8 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 99.8 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 99.77 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.76 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.76 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.73 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 99.7 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.6 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 99.6 | |
| KOG2598 | 523 | consensus Phosphomethylpyrimidine kinase [Coenzyme | 99.59 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 99.45 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.24 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.07 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.04 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.98 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 98.97 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 98.95 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.94 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 98.93 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.92 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.9 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.89 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.86 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.86 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 98.82 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.82 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 98.79 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.78 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.77 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 98.77 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.74 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.74 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.73 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.73 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 98.7 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 98.69 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 98.68 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 98.65 | |
| PLN02940 | 382 | riboflavin kinase | 98.65 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 98.6 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.6 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 98.58 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 98.57 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 98.55 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 98.54 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 98.53 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 98.52 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 98.49 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 98.48 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 98.47 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 98.47 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.46 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.44 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 98.42 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 98.42 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 98.39 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 98.38 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 98.34 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 98.34 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 98.32 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 98.3 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 98.29 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 98.28 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.28 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 98.24 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 98.24 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.22 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 98.19 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.19 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 98.19 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 98.18 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.18 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 98.12 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 98.11 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 98.11 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.1 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.02 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 98.02 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 98.0 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 97.99 | |
| PLN02811 | 220 | hydrolase | 97.93 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.88 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 97.84 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 97.84 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.83 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 97.83 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 97.82 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 97.81 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 97.8 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.8 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 97.75 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 97.75 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 97.68 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 97.64 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.63 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 97.57 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 97.56 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 97.54 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 97.49 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.43 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.39 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.38 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 97.36 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.34 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 97.32 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 97.28 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 97.26 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 97.26 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.24 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 97.24 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 97.22 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.2 | |
| PRK06769 | 173 | hypothetical protein; Validated | 97.19 | |
| PLN02887 | 580 | hydrolase family protein | 97.18 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 97.15 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.14 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.11 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 97.03 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 97.0 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 96.96 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 96.91 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 96.84 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 96.8 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 96.75 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 96.73 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.71 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 96.68 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 96.63 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 96.51 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 96.5 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 96.34 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 96.24 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 96.21 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 96.18 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.07 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 95.96 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 95.95 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 95.94 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 95.85 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 95.84 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 95.72 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 95.72 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 95.56 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 95.31 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 95.28 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 94.99 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 94.83 | |
| PLN02423 | 245 | phosphomannomutase | 94.57 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 94.47 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 93.14 | |
| PLN02580 | 384 | trehalose-phosphatase | 92.85 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 92.47 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 91.97 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 91.75 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 91.49 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 90.94 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 90.61 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 89.94 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 88.93 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 88.0 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 87.14 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 87.0 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 86.69 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 86.58 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 86.21 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 84.67 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 83.33 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 81.65 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 81.47 | |
| PRK05157 | 246 | pyrroloquinoline quinone biosynthesis protein PqqC | 81.13 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 81.04 | |
| TIGR02111 | 239 | PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C. | 80.53 |
| >COG0819 TenA Putative transcription activator [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.9e-33 Score=264.72 Aligned_cols=155 Identities=30% Similarity=0.426 Sum_probs=143.6
Q ss_pred cCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHhCCCCCC--CCCCChhhHHHHHHHHHHh-cCCcccccccccccchh
Q 010855 7 PSLSHDEEDKLAIRKLRKRVK-QKLKTLDSLVREWGFELPE--EIITDDATVKCTDFLLSTA-SGKVEGEKVLGKIETPF 82 (499)
Q Consensus 7 ~~~a~d~~~~~~~~~~~~~i~-~E~~~h~~~~~~~g~~~~~--~~~~~~~~~~Yt~~l~~~a-~~~~~~~~~~~~~~~~~ 82 (499)
++||+|.+.+..+.+.+..+. .|+.+|+.+++++||+.++ +..++|+|.+||+||++++ .|++
T Consensus 59 ~~ka~~~~~~~~~~~~~~~~~~~E~~~h~~~~~~lgis~~~~~~~~~~~~~~aYt~ym~~~~~~g~~------------- 125 (218)
T COG0819 59 ASKAPDLELMEELAKIIQFLVEGEMELHERLAEELGISLDELLKTEPSPANKAYTRYLLDTAYSGSF------------- 125 (218)
T ss_pred HhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHhcCCCchHHHHHHHHHHHHhcCCH-------------
Confidence 899999999999999888777 6999999999999999843 6789999999999999999 6887
Q ss_pred hhhhhHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCcchhcccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHHHH
Q 010855 83 EKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWIDYYCSQSFQESALQTEELLDKLSVLLTGEELEVIKK 162 (499)
Q Consensus 83 ~~~~~~~~~l~Al~PC~~~Y~~ig~~~~~~~~~~~~~~~Y~~WI~~y~s~~f~~~~~~~~~~ld~l~~~~~~~e~~~~~~ 162 (499)
+++++||+||+|+|++||+++.+..... ++++|++||++|+|++|++.|++++++||+++...+++++++|++
T Consensus 126 ------~~~~aAl~PC~~~Y~eig~~~~~~~~~~-~~~~Y~~Wi~~Y~s~ef~~~v~~~~~~ld~~~~~~~~~~~~~l~~ 198 (218)
T COG0819 126 ------AELLAALLPCLWGYAEIGKRLKAKPRAS-PNPPYQEWIDTYASEEFQEAVEELEALLDSLAENSSEEELEKLKQ 198 (218)
T ss_pred ------HHHHHHHHHHHHHHHHHHHHHHhccccC-CCCcHHHHHHHcCCHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHH
Confidence 6799999999999999999998754323 789999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcCCCCCC
Q 010855 163 LYYKAIKLHVNFFAAQPVK 181 (499)
Q Consensus 163 ~F~~a~~lE~~Fw~~a~~~ 181 (499)
+|.+|+++|++||+|||..
T Consensus 199 iF~~ss~~E~~Fwd~a~~~ 217 (218)
T COG0819 199 IFLTASRFELAFWDMAYRL 217 (218)
T ss_pred HHHHHHHHHHHHHHHHhcc
Confidence 9999999999999999874
|
|
| >PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PF03070 TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR004305 Proteins containing this domain are found in all the three major phyla of life: archaebacteria, eubacteria, and eukaryotes | Back alignment and domain information |
|---|
| >PTZ00347 phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >KOG3128 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05157 pyrroloquinoline quinone biosynthesis protein PqqC; Provisional | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR02111 PQQ_syn_pqqC coenzyme PQQ biosynthesis protein C | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 499 | |||
| 2qcx_A | 263 | Transcriptional activator TENA; UP-DOWN bundle, hy | 1e-10 | |
| 2f2g_A | 221 | SEED maturation protein PM36 homolog; TENA_THI-4 d | 1e-10 | |
| 2a2m_A | 258 | Hypothetical protein BT3146; putative TENA family | 2e-10 | |
| 3ibx_A | 221 | TENA, HP1287, putative thiaminase II; vitamin B1, | 3e-10 | |
| 3rm5_A | 550 | Hydroxymethylpyrimidine/phosphomethylpyrimidine K | 7e-10 | |
| 3no6_A | 248 | Transcriptional activator TENA; structural genomic | 5e-09 | |
| 1udd_A | 226 | Transcriptional regulator; helix-bundle, lipid bin | 8e-09 | |
| 1rtw_A | 220 | Transcriptional activator, putative; PF1337, TENA, | 8e-09 | |
| 2gm8_A | 221 | TENA homolog/THI-4 thiaminase; transcription, tran | 7e-08 | |
| 3mvu_A | 226 | TENA family transcriptional regulator; TENA/THI-4/ | 8e-08 | |
| 2qzc_A | 214 | Transcriptional activator TENA-1; heme oxygenase-l | 2e-07 | |
| 1z72_A | 225 | Transcriptional regulator, putative; structu genom | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 4e-05 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 2e-04 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 3e-04 |
| >2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A Length = 263 | Back alignment and structure |
|---|
Score = 61.4 bits (148), Expect = 1e-10
Identities = 24/170 (14%), Positives = 48/170 (28%), Gaps = 23/170 (13%)
Query: 10 SHDEEDKLAIRKLRKRVKQKLKTLDSLVREWGFELPEEIITD--DATVKCTDFLLSTASG 67
+ + ++ E T + +
Sbjct: 90 KDLYTTGRMASHAQGTYEAEMALHREFAELLEISEEERKAFKPSPTAYSFTSHMYRSVLS 149
Query: 68 KVEGEKVLGKIETPFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWID 127
E L+A+ PC L+ + + LL+ D G +Y+KWI
Sbjct: 150 GNFAEI------------------LAALLPCYWLYYEVGE---KLLHCDPGHPIYQKWIG 188
Query: 128 YYCSQSFQESALQTEELLDKLSVLLTGEELEVIKKLYYKAIKLHVNFFAA 177
Y F++ + D+L+ T E +K+ + + F+
Sbjct: 189 TYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWGM 238
|
| >2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* Length = 221 | Back alignment and structure |
|---|
| >2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A Length = 258 | Back alignment and structure |
|---|
| >3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A Length = 221 | Back alignment and structure |
|---|
| >3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Length = 550 | Back alignment and structure |
|---|
| >3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} Length = 248 | Back alignment and structure |
|---|
| >1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 Length = 226 | Back alignment and structure |
|---|
| >1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 Length = 220 | Back alignment and structure |
|---|
| >2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* Length = 221 | Back alignment and structure |
|---|
| >3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Length = 226 | Back alignment and structure |
|---|
| >2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} Length = 214 | Back alignment and structure |
|---|
| >1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A Length = 225 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| 3no6_A | 248 | Transcriptional activator TENA; structural genomic | 99.97 | |
| 3ibx_A | 221 | TENA, HP1287, putative thiaminase II; vitamin B1, | 99.97 | |
| 4fn6_A | 229 | Thiaminase-2, thiaminase II; alpha-helix, vitamin | 99.97 | |
| 3mvu_A | 226 | TENA family transcriptional regulator; TENA/THI-4/ | 99.97 | |
| 2qcx_A | 263 | Transcriptional activator TENA; UP-DOWN bundle, hy | 99.96 | |
| 1z72_A | 225 | Transcriptional regulator, putative; structu genom | 99.96 | |
| 1rtw_A | 220 | Transcriptional activator, putative; PF1337, TENA, | 99.96 | |
| 3rm5_A | 550 | Hydroxymethylpyrimidine/phosphomethylpyrimidine K | 99.96 | |
| 2f2g_A | 221 | SEED maturation protein PM36 homolog; TENA_THI-4 d | 99.96 | |
| 2gm8_A | 221 | TENA homolog/THI-4 thiaminase; transcription, tran | 99.96 | |
| 1wwm_A | 190 | Hypothetical protein TT2028; TENA/THI-4 family, pu | 99.96 | |
| 2qzc_A | 214 | Transcriptional activator TENA-1; heme oxygenase-l | 99.95 | |
| 1udd_A | 226 | Transcriptional regulator; helix-bundle, lipid bin | 99.95 | |
| 2a2m_A | 258 | Hypothetical protein BT3146; putative TENA family | 99.94 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.87 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.86 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.78 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.77 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 99.74 | |
| 3oql_A | 262 | TENA homolog; transcriptional activator, structura | 99.74 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.72 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.68 | |
| 1rcw_A | 231 | CT610, CADD; iron, DI-iron, redox enzyme, metallo | 99.63 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.62 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.59 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.56 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 99.46 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.44 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.35 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.31 | |
| 3hlx_A | 258 | Pyrroloquinoline-quinone synthase; PQQC, PQQ biosy | 99.23 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.2 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.19 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.19 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.17 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.14 | |
| 3dde_A | 239 | TENA/THI-4 protein, domain of unknown function WI | 99.14 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.12 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.09 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.08 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.07 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.07 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.06 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.05 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.05 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.05 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.04 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.04 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.04 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.02 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.98 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.97 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.97 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 98.96 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.95 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.95 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.94 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.93 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 98.92 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.91 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.91 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 98.91 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.9 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.9 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 98.89 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.87 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.87 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.86 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.85 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.84 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 98.82 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 98.82 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 98.81 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 98.79 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.79 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.79 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 98.77 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.77 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.76 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.75 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.75 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 98.71 | |
| 3bjd_A | 332 | Putative 3-oxoacyl-(acyl-carrier-protein) synthas; | 98.71 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 98.69 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.67 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.67 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 98.1 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 98.65 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 98.64 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.6 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 98.56 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 98.56 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.49 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.47 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 98.47 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 98.47 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 98.46 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.45 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 98.4 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 98.38 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.38 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.36 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 98.35 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.35 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 98.3 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.3 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 98.26 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 98.23 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.21 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 98.21 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 98.2 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.2 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.2 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 98.19 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 98.19 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.18 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 98.18 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.17 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.17 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 98.15 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 98.15 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.14 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 98.14 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.13 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.1 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.07 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 98.06 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 98.05 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 98.01 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.0 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.97 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.96 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.94 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 97.86 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.85 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 97.79 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 97.68 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 97.51 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.48 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 97.47 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 97.43 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 97.43 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.2 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.16 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 97.13 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.09 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 96.86 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 96.85 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 96.83 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.83 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 96.82 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 96.81 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 96.79 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 96.75 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 96.67 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 96.6 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.54 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.45 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 96.29 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 95.64 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 95.6 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 95.01 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.72 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 94.72 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 94.7 | |
| 3b5o_A | 244 | CADD-like protein of unknown function; structural | 93.59 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 92.32 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 92.28 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 91.23 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 88.87 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 88.14 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 87.32 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 86.1 |
| >3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} SCOP: a.132.1.0 | Back alignment and structure |
|---|
Probab=99.97 E-value=6.1e-32 Score=264.64 Aligned_cols=154 Identities=16% Similarity=0.229 Sum_probs=141.4
Q ss_pred cCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHhCCCCC---CCCCCChhhHHHHHHHHHHh-c-CCcccccccccccc
Q 010855 7 PSLSHDEEDKLAIRKLRKRVK-QKLKTLDSLVREWGFELP---EEIITDDATVKCTDFLLSTA-S-GKVEGEKVLGKIET 80 (499)
Q Consensus 7 ~~~a~d~~~~~~~~~~~~~i~-~E~~~h~~~~~~~g~~~~---~~~~~~~~~~~Yt~~l~~~a-~-~~~~~~~~~~~~~~ 80 (499)
++||+|.+++..+...+..+. +|+++|+.++++||++.+ +..+++|+|.+||+||++++ . |++
T Consensus 78 ~aka~~~~~~~~~~~~~~~~~~~E~~lh~~~~~~~gi~~~~~~~~~~~~p~~~aYt~~ll~~a~~~g~~----------- 146 (248)
T 3no6_A 78 IPKMSSMEDVKFLVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFNAFARENA----------- 146 (248)
T ss_dssp GGGCSCHHHHHHHHHHHHHHHTCCCHHHHHHHHHTTSCHHHHCCSCCCCHHHHHHHHHHHHHHHHCSST-----------
T ss_pred HHhCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHhhhcCCCHHHHHHHHHHHHHHhcCCCH-----------
Confidence 899999999999999998876 799999999999999865 35688999999999999999 6 776
Q ss_pred hhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCcchhcccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHH
Q 010855 81 PFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWIDYYCSQSFQESALQTEELLDKLSVLLTGEELEVI 160 (499)
Q Consensus 81 ~~~~~~~~~~~l~Al~PC~~~Y~~ig~~~~~~~~~~~~~~~Y~~WI~~y~s~~f~~~~~~~~~~ld~l~~~~~~~e~~~~ 160 (499)
+++++||+||+|+|++||+++.+..... ++++|++||++|+ ++|.+.|.+++++||++++.++++++++|
T Consensus 147 --------~~~laAl~PC~w~Y~eig~~l~~~~~~~-~~~~Y~~WI~~Y~-~ef~~~v~~~~~~ld~~~~~~s~~~~~~l 216 (248)
T 3no6_A 147 --------AFTIAAMAPCPYVYAVIGKRAMEDPKLN-KESVTSKWFQFYS-TEMDELVDVFDQLMDRLTKHCSETEKKEI 216 (248)
T ss_dssp --------HHHHHHHTHHHHHHHHHHHHHHHCTTCC-TTSTTHHHHHHHH-HHTHHHHHHHHHHHHHHTTTCCHHHHHHH
T ss_pred --------HHHHHHHHHHHHHHHHHHHHHHhcCCCC-CCchHHHHHHHHH-HHHHHHHHHHHHHHHHHhhhCCHHHHHHH
Confidence 6899999999999999999998753322 5799999999999 99999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhcCCCCCC
Q 010855 161 KKLYYKAIKLHVNFFAAQPVK 181 (499)
Q Consensus 161 ~~~F~~a~~lE~~Fw~~a~~~ 181 (499)
+++|.++|+||++||+|||..
T Consensus 217 ~~~F~~a~~lE~~Fwd~ay~~ 237 (248)
T 3no6_A 217 KENFLQSTIHERHFFNMAYIN 237 (248)
T ss_dssp HHHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHHHhhh
Confidence 999999999999999999874
|
| >3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A | Back alignment and structure |
|---|
| >4fn6_A Thiaminase-2, thiaminase II; alpha-helix, vitamin B1, BI-functional enzyme, C of thiamine INTO HMP and THZ; HET: CME; 2.69A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} SCOP: a.132.1.0 | Back alignment and structure |
|---|
| >2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A | Back alignment and structure |
|---|
| >1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A | Back alignment and structure |
|---|
| >1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* | Back alignment and structure |
|---|
| >2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* | Back alignment and structure |
|---|
| >1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 | Back alignment and structure |
|---|
| >2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3hlx_A Pyrroloquinoline-quinone synthase; PQQC, PQQ biosynthesis, oxidase, complex, all helical, oxido; HET: PQQ; 1.30A {Klebsiella pneumoniae subsp} SCOP: a.132.1.4 PDB: 3hml_A* 1otv_A 3hnh_A* 1otw_A* | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3dde_A TENA/THI-4 protein, domain of unknown function WI oxygenase-like fold; structural genomics, joint center for structural genomics; HET: MSE PGE; 2.30A {Shewanella denitrificans OS217} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bjd_A Putative 3-oxoacyl-(acyl-carrier-protein) synthas; structural genomics, APC5632, 3-oxoacyl-(acyl-carrier-protei synthase, PSI-2; HET: MSE; 1.85A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5o_A CADD-like protein of unknown function; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; HET: MSE; 1.35A {Nostoc punctiforme} PDB: 3b5p_A* | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 499 | ||||
| d2f2ga1 | 215 | a.132.1.3 (A:5-219) Seed maturation protein-relate | 6e-11 | |
| d2a2ma1 | 231 | a.132.1.3 (A:10-240) Hypothetical protein BT3146 { | 7e-11 | |
| d1udda_ | 215 | a.132.1.3 (A:) Hypothetical transcriptional regula | 8e-11 | |
| d1wwma1 | 180 | a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 | 1e-09 | |
| d2gm8a1 | 211 | a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon | 2e-09 | |
| d1rtwa_ | 206 | a.132.1.3 (A:) Putative transcriptional activator | 3e-09 | |
| d1to9a_ | 225 | a.132.1.3 (A:) Transcriptional activator TenA {Bac | 2e-07 | |
| d1z72a1 | 217 | a.132.1.3 (A:4-220) Putative transcriptional regul | 3e-07 |
| >d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 215 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme oxygenase-like superfamily: Heme oxygenase-like family: TENA/THI-4 domain: Seed maturation protein-related At3g16990 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 59.8 bits (144), Expect = 6e-11
Identities = 16/169 (9%), Positives = 51/169 (30%), Gaps = 20/169 (11%)
Query: 7 PSLSHDEEDKLAIRKLRKRVKQKLKTLDSLVREWGFELPEEIITDDATVKCTDFLLSTAS 66
S + D + + +++ +W + ++ A + FL S
Sbjct: 62 CKDSGESSDMEVVLGGIASLNDEIEWFKREGSKWDVDF-STVVPQRANQEYGRFLEDLMS 120
Query: 67 GKVEGEKVLGKIETPFEKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWI 126
+V+ ++A +++ + +
Sbjct: 121 SEVK-----------------YPVIMTAFWAIEAVYQESFAHCLE--DGNKTPVELTGAC 161
Query: 127 DYYCSQSFQESALQTEELLDKLSVLLTGEELEVIKKLYYKAIKLHVNFF 175
+ + F++ + + ++ +GE L + + + ++L V F+
Sbjct: 162 HRWGNDGFKQYCSSVKNIAERCLENASGEVLGEAEDVLVRVLELEVAFW 210
|
| >d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 231 | Back information, alignment and structure |
|---|
| >d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} Length = 215 | Back information, alignment and structure |
|---|
| >d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 211 | Back information, alignment and structure |
|---|
| >d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 206 | Back information, alignment and structure |
|---|
| >d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} Length = 225 | Back information, alignment and structure |
|---|
| >d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} Length = 217 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 499 | |||
| d1to9a_ | 225 | Transcriptional activator TenA {Bacillus subtilis | 99.95 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 99.94 | |
| d1wwma1 | 180 | Hypothetical protein TTHA0169 (TT2028) {Thermus th | 99.94 | |
| d1rtwa_ | 206 | Putative transcriptional activator PF1337 {Archaeo | 99.94 | |
| d1udda_ | 215 | Hypothetical transcriptional regulator PH1161 {Pyr | 99.94 | |
| d2a2ma1 | 231 | Hypothetical protein BT3146 {Bacteroides thetaiota | 99.94 | |
| d2gm8a1 | 211 | TenA homolog PAE0170 {Archaeon Pyrobaculum aerophi | 99.93 | |
| d1z72a1 | 217 | Putative transcriptional regulator SP0716 (SPr0628 | 99.93 | |
| d2f2ga1 | 215 | Seed maturation protein-related At3g16990 {Thale c | 99.92 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.89 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.86 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.71 | |
| d1rcwa_ | 213 | Hypothetical protein CT610 {Chlamydia trachomatis | 99.43 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.42 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.98 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.94 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.92 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.92 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 98.89 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 98.87 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.82 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.76 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.74 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 98.74 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.67 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 98.63 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 98.58 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 98.58 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 98.54 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 98.53 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 98.52 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 98.49 | |
| d1otva_ | 254 | Coenzyme PQQ synthesis protein C, PqqC {Klebsiella | 98.44 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 98.39 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 98.38 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 98.36 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 98.27 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.03 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.0 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 97.94 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 97.92 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 97.75 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.72 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.67 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.65 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 97.63 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 97.6 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.56 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 97.47 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 97.39 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.38 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 97.38 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.38 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.09 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 97.07 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 96.96 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 96.39 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.38 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 95.47 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 88.21 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 85.81 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 85.1 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 84.06 | |
| d1wzda1 | 207 | Heme oxygenase HmuO {Corynebacterium diphtheriae [ | 82.65 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 82.49 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 81.21 |
| >d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme oxygenase-like superfamily: Heme oxygenase-like family: TENA/THI-4 domain: Transcriptional activator TenA species: Bacillus subtilis [TaxId: 1423]
Probab=99.95 E-value=9.2e-29 Score=236.27 Aligned_cols=153 Identities=16% Similarity=0.230 Sum_probs=139.2
Q ss_pred cCCCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHhCCCCCC--CCCCChhhHHHHHHHHHHh-cCCcccccccccccchh
Q 010855 7 PSLSHDEEDKLAIRKLRKR-VKQKLKTLDSLVREWGFELPE--EIITDDATVKCTDFLLSTA-SGKVEGEKVLGKIETPF 82 (499)
Q Consensus 7 ~~~a~d~~~~~~~~~~~~~-i~~E~~~h~~~~~~~g~~~~~--~~~~~~~~~~Yt~~l~~~a-~~~~~~~~~~~~~~~~~ 82 (499)
++++++.+++..+...+.. +..|+++|+.+++.+|++.++ ..+++|+|.+|++||++++ +|++
T Consensus 58 ~~ka~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~gi~~~~~~~~~~~p~~~~y~~~l~~~a~~~~~------------- 124 (225)
T d1to9a_ 58 AAYAKDLYTTGRMASHAQGTYEAEMALHREFAELLEISEEERKAFKPSPTAYSYTSHMYRSVLSGNF------------- 124 (225)
T ss_dssp HHHCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHTCCCCHHHHHHHHHHHHHHTTCCH-------------
T ss_pred HhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhhcCcccccchHHHHHHHHHhcCCH-------------
Confidence 7899999888888777655 458999999999999999864 6789999999999999999 5765
Q ss_pred hhhhhHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCcchhcccccccCChhHHHHHHHHHHHHHHHhccCCHHHHHHHHH
Q 010855 83 EKIKVAAYTLSAISPCMRLFEVIAKEIQALLNPDDGSHLYKKWIDYYCSQSFQESALQTEELLDKLSVLLTGEELEVIKK 162 (499)
Q Consensus 83 ~~~~~~~~~l~Al~PC~~~Y~~ig~~~~~~~~~~~~~~~Y~~WI~~y~s~~f~~~~~~~~~~ld~l~~~~~~~e~~~~~~ 162 (499)
+++++||+||+|+|.++|+++..... .+++|++||++|++++|.+.+.++++++|++++.+++++++++++
T Consensus 125 ------~~~l~Al~~ce~~Y~~~~~~~~~~~~---~~~~y~~wi~~~~~~~f~~~~~~~~~~ld~~~~~~~~~~~~~~~~ 195 (225)
T d1to9a_ 125 ------AEILAALLPCYWLYYEVGEKLLHCDP---GHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKE 195 (225)
T ss_dssp ------HHHHHHHHHHHHHHHHHHHHTTTCCC---SSHHHHHHHHHHHSTTTTTHHHHHHHHHHHHHHTSCHHHHHHHHH
T ss_pred ------HHHHHHHHHHHHHHHHHHHHHHhccc---CCchHHHHHHcccCchhHHHHHHHHHHHHHHHHhCCHHHHHHHHH
Confidence 68999999999999999999876432 678999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcCCCCCC
Q 010855 163 LYYKAIKLHVNFFAAQPVK 181 (499)
Q Consensus 163 ~F~~a~~lE~~Fw~~a~~~ 181 (499)
+|.++|+||++||||||..
T Consensus 196 ~f~~~~~lE~~Fwd~ay~~ 214 (225)
T d1to9a_ 196 NFVISSYYEYQFWGMAYRK 214 (225)
T ss_dssp HHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHhhc
Confidence 9999999999999999874
|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1wzda1 a.132.1.1 (A:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|