Citrus Sinensis ID: 011015

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRRENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKISIY
cccccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHcEEEEEEcccccccccccccEEEEEEEEcccccccHHHHcccccccEEEEEEccccccccccccHHHHccccccEEEEccccccccccccccccccccccccccccccccccEEccHHHHccccccEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccEEEcccccccccHHHHHccccccEEEEccccccccHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHHHHHccccccccccccccccEEEc
cccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEEEEEEccccccccccccHcccccccEEEEcccccccccHHHHHHHHcccccEEEEEcccccccccHcccccccccccccEEEccccccHccccHHHcccccccEEEEcccHHHHHccHHHcccccccEEEEcccccHccccccccccccccEEEEEEccccccccccHHHHcccHHccEEEEccccccccHHHHHHccccccccccEEEEEcccccccccccccHHHHHHHccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccccccccccccEEEEcccHcHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHcccccccccccHccccEEEEc
maqgylnekenKEMQDIGEEYFNILAsssffqefktdgdgkvygckmHDLVHDVAQFICrnecltvkipggmssfEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVeggdyswsskvlpQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYnleclnvsgcwnlrelprgIGKLRKLMYLYNEGtsclrylpvgIGELISLREVTKFvvgggydracslgslkklnLLRKcsirglggvsdageVRRAELEKQKYLVELGLYfdqagrreneedEDERLLealgpppnlkkleiydyrgrrnvvpinWIMSLTNlrdlslskwrncehlpplgklpslEYLVIELMNSVKRVGNeflgvesdtdgssviafpklklLDFYIMKELeewdfgtaikgeiiimprlsslsidgcpklkalpdhllqkttlqklwiwgcpileercrketgedwplirhipkisiy
maqgylnekenKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIrglggvsdagevrRAELEKQKYLVELGLYFDQAGRRENEEDEDErllealgpppnlkkleiydyRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLgvesdtdgssviafpklKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEercrketgedwplirhipkisiy
MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGrreneedederlleALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKISIY
*****************GEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFD************************LKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKI***
MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKI***********VLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAG*******EDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCR*ETGEDWPLIRHIPKISIY
MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGR**********LLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKISIY
***********KEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRRENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKISIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRRENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILEERCRKETGEDWPLIRHIPKISIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query495 2.2.26 [Sep-21-2011]
Q7XBQ9970 Disease resistance protei N/A no 0.820 0.418 0.314 2e-37
Q9LRR5 1424 Putative disease resistan yes no 0.870 0.302 0.312 4e-36
Q7XA39 988 Putative disease resistan N/A no 0.737 0.369 0.323 1e-35
Q7XA42 979 Putative disease resistan N/A no 0.765 0.387 0.309 2e-34
Q7XA40 992 Putative disease resistan N/A no 0.824 0.411 0.322 7e-34
Q9LRR4 1054 Putative disease resistan no no 0.901 0.423 0.299 1e-33
Q9C8T9898 Putative disease resistan no no 0.769 0.424 0.242 5e-13
Q38834852 Disease resistance RPP13- no no 0.779 0.453 0.225 7e-12
Q8W3K3910 Putative disease resistan no no 0.856 0.465 0.244 7e-12
Q39214926 Disease resistance protei no no 0.886 0.474 0.259 1e-11
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 147/467 (31%), Positives = 219/467 (46%), Gaps = 61/467 (13%)

Query: 1   MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICR 60
           MA G+L  K N E++D+G+E +  L   SFFQE +   DGK Y  KMHDL+HD+A  +  
Sbjct: 429 MAHGFLLSKGNMELEDVGDEVWKELYLRSFFQEIEVK-DGKTY-FKMHDLIHDLATSLFS 486

Query: 61  NECLTVKIPGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWS 120
               +  I        +    H+M    +G +  +  +                      
Sbjct: 487 ANTSSSNI----REINKHSYTHMM---SIGFAEVVFFY---------------------- 517

Query: 121 SKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLC 180
              LP L +K   LR L L          K+P +I  L+HL+YLNL G + +  LP+ LC
Sbjct: 518 --TLPPL-EKFISLRVLNLGDST----FNKLPSSIGDLVHLRYLNLYG-SGMRSLPKQLC 569

Query: 181 ELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFV 240
           +L NL+ L++  C  L  LP+   KL  L  L  +G+  L  +P  IG L  L+ + +FV
Sbjct: 570 KLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFV 629

Query: 241 VGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGR 300
           V  G  +   LG L  LNL     I  L  V +  + + A L  +  L  L + ++  G 
Sbjct: 630 V--GRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGP 687

Query: 301 RENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEH 360
               E E+ ++LEAL P  NL  L+IY +RG      +N  + L N+  + +S +RNC  
Sbjct: 688 H-IYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSV-LKNIVSILISNFRNCSC 745

Query: 361 LPPLGKLPSLEYLVIELMNS-VKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEE 419
           LPP G LP LE L +   ++ V+ V  E + ++  +   + I FP L+ LD         
Sbjct: 746 LPPFGDLPCLESLELHWGSADVEYV--EEVDIDVHSGFPTRIRFPSLRKLDI-------- 795

Query: 420 WDFGTAIKGEII-----IMPRLSSLSIDGCPKLKALPDHLLQKTTLQ 461
           WDFG+ +KG +        P L  + I  CP L  L  +L   T+L+
Sbjct: 796 WDFGS-LKGLLKKEGEEQFPVLEEMIIHECPFL-TLSSNLRALTSLR 840
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth. Confers a broad resistance to all known races of P.infestans.
Solanum bulbocastanum (taxid: 147425)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
147825450 927 hypothetical protein VITISV_000086 [Viti 0.939 0.501 0.442 4e-93
359482788 903 PREDICTED: putative disease resistance p 0.939 0.514 0.441 3e-92
359482769 904 PREDICTED: putative disease resistance p 0.933 0.511 0.441 1e-91
359482792 922 PREDICTED: putative disease resistance p 0.927 0.497 0.446 5e-91
359482784 919 PREDICTED: putative disease resistance p 0.935 0.503 0.440 1e-90
255549784 786 leucine-rich repeat containing protein, 0.971 0.611 0.426 3e-90
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.943 0.484 0.441 3e-89
224115608 922 cc-nbs-lrr resistance protein [Populus t 0.963 0.517 0.416 6e-88
359482790 923 PREDICTED: putative disease resistance p 0.931 0.499 0.432 1e-87
359482794 880 PREDICTED: putative disease resistance p 0.886 0.498 0.439 1e-85
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  348 bits (893), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 221/500 (44%), Positives = 296/500 (59%), Gaps = 35/500 (7%)

Query: 1   MAQGYLNEKENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICR 60
           MAQ YLN   +KEM+ +G  YF  LA+ SFFQ+F+ D DG +  CKMHD+VHD AQF+ +
Sbjct: 450 MAQSYLNSDRSKEMEMVGRTYFEYLAARSFFQDFEKDDDGNIICCKMHDIVHDFAQFLTQ 509

Query: 61  NECLTVKI----PGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLV-EGG 115
           NEC  V++     G M  F QK + H  L V   T    +  N    M+ L +LL  E  
Sbjct: 510 NECFIVEVDNQKKGSMDLFFQK-IRHATLVVRESTPNFASTCN----MKNLHTLLAKEEF 564

Query: 116 DYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKL 175
           B S   + L  L   LTCLRAL L  +     I+++PK + KLIHL+YLNL     + +L
Sbjct: 565 BISXVLEALXNLLRHLTCLRALDLSRN---RLIEELPKEVGKLIHLRYLNLSLCYRLREL 621

Query: 176 PETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLRE 235
           PET+C+LYNL+ LN+ GC +L++LP+ +GKL  L +L N  T  L+ LP GIG L SL+ 
Sbjct: 622 PETICDLYNLQTLNIEGCSSLQKLPQAMGKLINLRHLENCNTGSLKGLPKGIGRLSSLQT 681

Query: 236 VTKFVVGGGYDRACSLGSLKKLNLLR-KCSIRGLGGVSDAGEVRRAELEKQKYLVELGLY 294
           +  F+V    +  C +G L+ LN LR   SI+ L  V DAGE  +AEL+ + +   L L 
Sbjct: 682 LDVFIVSSHGNDECQIGDLRNLNNLRGGLSIQRLDEVKDAGEAEKAELKNRVHFQYLTLE 741

Query: 295 FDQAGRRENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPINWIM--SLTNLRDLSL 352
           F   G++E  +     + EAL P PNLK L+I++Y  R    P NW+M  SL  L+ L +
Sbjct: 742 F---GKKEGTKG----VAEALQPHPNLKSLDIFNYGDRE--WP-NWMMGSSLAQLKILEI 791

Query: 353 SKWRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFY 412
              R C  LP LG+LP LE L I  M+ VK +G+EFL       GSS   FPKLK L+  
Sbjct: 792 GNCRRCPCLPLLGQLPVLEKLDIWGMDGVKYIGSEFL-------GSSSTVFPKLKELNIS 844

Query: 413 IMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPILE 472
            M EL++W+     K E  IMP L+ L  + CPKL+ LPDH+LQ+T LQKL+I   PILE
Sbjct: 845 RMDELKQWEIKG--KEERSIMPCLNHLRTEFCPKLEGLPDHVLQRTPLQKLYIIDSPILE 902

Query: 473 ERCRKETGEDWPLIRHIPKI 492
            R RK+ GED   I HIP++
Sbjct: 903 RRYRKDIGEDRHKISHIPEV 922

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115608|ref|XP_002332098.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874918|gb|EEF12049.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.876 0.304 0.303 6.4e-39
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.903 0.424 0.299 9.5e-37
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.575 0.158 0.265 3.1e-12
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.377 0.207 0.272 5.1e-12
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.393 0.217 0.276 5.3e-12
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.397 0.212 0.296 5.6e-12
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.656 0.381 0.237 1.3e-11
TAIR|locus:5049561841017 AT1G58807 "AT1G58807" [Arabido 0.169 0.082 0.397 3.3e-11
TAIR|locus:28270381017 AT1G59124 "AT1G59124" [Arabido 0.169 0.082 0.397 3.3e-11
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.169 0.080 0.365 5e-11
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 6.4e-39, Sum P(2) = 6.4e-39
 Identities = 145/477 (30%), Positives = 230/477 (48%)

Query:     9 KENKEMQDIGEEYFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECLTVKI 68
             + ++ ++DIG +Y   L + SFFQ      D  +    MHDL++D+A+ +  + C  ++ 
Sbjct:   453 RSSRRLEDIGNDYLGDLVAQSFFQRL----DITMTSFVMHDLMNDLAKAVSGDFCFRLE- 507

Query:    69 PGGMSSFEQKKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSS-----KV 123
                +         H   +        +A + ++     LR++L      S  S     KV
Sbjct:   508 DDNIPEIPST-TRHFSFSRSQ-CDASVA-FRSICGAEFLRTILPFNSPTSLESLQLTEKV 564

Query:   124 LPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELY 183
             L  L + L+ LR L+L +H  +  I  +PK+++ L  L+YL+L   T+I++LPE +C L 
Sbjct:   565 LNPLLNALSGLRILSL-SH--YQ-ITNLPKSLKGLKLLRYLDL-SSTKIKELPEFVCTLC 619

Query:   184 NLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGG 243
             NL+ L +S C +L  LP+ I +L  L  L   GT  +  +P GI +L SL++++ FV+G 
Sbjct:   620 NLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVE-MPPGIKKLRSLQKLSNFVIGR 678

Query:   244 GYDRACSLGSLKKLNLLR-KCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGXXX 302
                    L  LK+L+ LR    I  L  V+ A E + A L+++ +L  L L +   G   
Sbjct:   679 L--SGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGF 736

Query:   303 XXXXXXXXX------XXALGPPPNLKKLEIYDYRGRRNVVPINWI--MSLTNLRDLSLSK 354
                               L P P+LK   I  Y+G     P  W+   S   +  ++LS 
Sbjct:   737 VPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQG--GAFP-KWLGDSSFFGITSVTLSS 793

Query:   355 WRNCEHLPPLGKLPSLEYLVIELMNSVKRVGNEFLGVESDTDGSSVIAFPKLKLLDFYIM 414
                C  LPP+G+LPSL+YL IE  N +++VG +F   E+++ G   + F  L++L FY M
Sbjct:   794 CNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRG---VPFQSLQILKFYGM 850

Query:   415 KELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKL-KALPDHLLQKTTLQKLWIWGCPI 470
                +EW       G   I P L  L I  CP L K  P+ L   T   ++ I  CP+
Sbjct:   851 PRWDEWICPELEDG---IFPCLQKLIIQRCPSLRKKFPEGLPSST---EVTISDCPL 901
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003279001
SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (816 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 49.1 bits (117), Expect = 5e-06
 Identities = 83/328 (25%), Positives = 123/328 (37%), Gaps = 61/328 (18%)

Query: 78  KKVLHLMLTVDVGTSVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKV---LPQLFDKLTC- 133
           KKVL + L +D    + I   N  K MR L  L      +    +V   LP+ FD L   
Sbjct: 532 KKVLGITLDIDEIDELHIH-ENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPK 590

Query: 134 LRALTLET------------------HCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKL 175
           LR L  +                         ++K+   +  L  L+ ++L G   ++++
Sbjct: 591 LRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEI 650

Query: 176 PETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLRE 235
           P+ L    NLE L +S C +L ELP  I  L KL  L       L  LP GI        
Sbjct: 651 PD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-------- 701

Query: 236 VTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVS------DAGEVRRAELEKQ---K 286
                         +L SL +LNL     ++    +S      D  E    E       +
Sbjct: 702 --------------NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLE 747

Query: 287 YLVELGLYFDQAGRRENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPI-NWIMSLT 345
            L EL L   ++ +          L+  L   P+L +L + D     ++V + + I +L 
Sbjct: 748 NLDELILCEMKSEKLWERVQPLTPLMTML--SPSLTRLFLSDI---PSLVELPSSIQNLH 802

Query: 346 NLRDLSLSKWRNCEHLPPLGKLPSLEYL 373
            L  L +    N E LP    L SLE L
Sbjct: 803 KLEHLEIENCINLETLPTGINLESLESL 830

syringae 6; Provisional. Length = 1153
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 495
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
KOG4237498 consensus Extracellular matrix protein slit, conta 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.49
KOG4237498 consensus Extracellular matrix protein slit, conta 99.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.39
KOG4341483 consensus F-box protein containing LRR [General fu 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG4341483 consensus F-box protein containing LRR [General fu 98.85
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.68
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.66
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.64
PLN03150623 hypothetical protein; Provisional 98.6
PLN03150623 hypothetical protein; Provisional 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.0
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.86
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.84
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.66
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.52
PRK15386 426 type III secretion protein GogB; Provisional 97.51
PRK15386426 type III secretion protein GogB; Provisional 97.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.61
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.49
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.38
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.98
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.25
KOG4308 478 consensus LRR-containing protein [Function unknown 88.15
KOG4308478 consensus LRR-containing protein [Function unknown 87.15
smart0037026 LRR Leucine-rich repeats, outliers. 86.63
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.63
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.96  E-value=8.7e-29  Score=269.44  Aligned_cols=402  Identities=22%  Similarity=0.208  Sum_probs=235.2

Q ss_pred             HHHHHHhCCCcceeecCCCCCeeeEEeChhHHHHHHHHhccceE------EEecCC-------CCCCCCCCceEEEEEEe
Q 011015           21 YFNILASSSFFQEFKTDGDGKVYGCKMHDLVHDVAQFICRNECL------TVKIPG-------GMSSFEQKKVLHLMLTV   87 (495)
Q Consensus        21 ~~~~L~~~~ll~~~~~~~~~~~~~~~~hdl~~~~~~~~~~~~~~------~~~~~~-------~~~~~~~~~~~~l~l~~   87 (495)
                      .++.|+++||++...    +   .++|||++++||+++++.+..      +...+.       ......  +++.+.+..
T Consensus       471 ~l~~L~~ksLi~~~~----~---~~~MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~--~v~~i~l~~  541 (1153)
T PLN03210        471 GLKNLVDKSLIHVRE----D---IVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTK--KVLGITLDI  541 (1153)
T ss_pred             ChHHHHhcCCEEEcC----C---eEEhhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHHHhCcccc--eeeEEEecc
Confidence            478899999997632    2   479999999999999987641      010000       011122  567776665


Q ss_pred             ccCCCcchhhhcccccCCCccEEEEcCCccC---cccccchHHhhcC-CeeeEEEccCccCccccccccccccCcCCcce
Q 011015           88 DVGTSVPIAIWNNVKRMRRLRSLLVEGGDYS---WSSKVLPQLFDKL-TCLRALTLETHCCFDFIQKIPKNIEKLIHLKY  163 (495)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~---~~~~~l~~~~~~l-~~L~~L~l~~~~~~~~~~~l~~~~~~l~~L~~  163 (495)
                      ........ -..+|.+|++|+.|.+..+...   .....+|..|..+ ..||.|++. ++.   ...+|..+ ...+|+.
T Consensus       542 ~~~~~~~i-~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~-~~~---l~~lP~~f-~~~~L~~  615 (1153)
T PLN03210        542 DEIDELHI-HENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWD-KYP---LRCMPSNF-RPENLVK  615 (1153)
T ss_pred             Cccceeee-cHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEec-CCC---CCCCCCcC-CccCCcE
Confidence            54443111 1112334888888888665321   1122245555554 347777776 544   56666555 3567777


Q ss_pred             EecCCCCcccccchhhhccccCcEeecCCCcCCcccchhhccCCcccEEecCCccccccccccccCcccccccCeEEecC
Q 011015          164 LNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVVGG  243 (495)
Q Consensus       164 L~l~~~~~~~~lp~~~~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~~~~i~~l~~L~~L~l~~~~~  243 (495)
                      |+++++. +..+|..+..+++|+.|+|+++..+..+| .++.+++|+.|++++|.....+|..++++++|+.|++..|..
T Consensus       616 L~L~~s~-l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip-~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~  693 (1153)
T PLN03210        616 LQMQGSK-LEKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCEN  693 (1153)
T ss_pred             EECcCcc-ccccccccccCCCCCEEECCCCCCcCcCC-ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCC
Confidence            7777776 66666666667777777777665555565 356667777777777666666666677777777777665543


Q ss_pred             ccCCccCccchhcccccCCceeeccCCCCChhhhHhhccccccccceEEEEEecCCCCCCcc------------chhHHH
Q 011015          244 GYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRRENEE------------DEDERL  311 (495)
Q Consensus       244 ~~~~~~~~~~l~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~------------~~~~~~  311 (495)
                      ....+.    -..+++|+.|.+.++.......       ....+|+.|+++.+.+..-....            .....+
T Consensus       694 L~~Lp~----~i~l~sL~~L~Lsgc~~L~~~p-------~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l  762 (1153)
T PLN03210        694 LEILPT----GINLKSLYRLNLSGCSRLKSFP-------DISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKL  762 (1153)
T ss_pred             cCccCC----cCCCCCCCEEeCCCCCCccccc-------cccCCcCeeecCCCccccccccccccccccccccccchhhc
Confidence            321111    1145555555555543322111       01235555555555422100000            000000


Q ss_pred             --------hhcCCCCCCcceEEEeeecCcCCCCCCchhhhccccceeeecCccCCCCCCCCCCCCccceeeccccccceE
Q 011015          312 --------LEALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPPLGKLPSLEYLVIELMNSVKR  383 (495)
Q Consensus       312 --------~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~  383 (495)
                              ......+++|+.|++++|.... .+ |.++.++++|+.|++++|...+.+|....+++|++|++++|..++.
T Consensus       763 ~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~-~l-P~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~  840 (1153)
T PLN03210        763 WERVQPLTPLMTMLSPSLTRLFLSDIPSLV-EL-PSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRT  840 (1153)
T ss_pred             cccccccchhhhhccccchheeCCCCCCcc-cc-ChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCcccc
Confidence                    0001123456666666654332 14 5556666666666666666665565544566666666666654432


Q ss_pred             eCccccCCCCCCCCCccccCCccceeeecccccccccccccccccccccCcccceeeecCCcCccCCCcCCCCCCCccEE
Q 011015          384 VGNEFLGVESDTDGSSVIAFPKLKLLDFYIMKELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKL  463 (495)
Q Consensus       384 ~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~l~~~~~~~~~L~~L~l~~c~~~~~l~~~~~~l~~L~~L  463 (495)
                      ++.               ..++|+.|+++++. +      ..+|.++..+++|+.|++++|+.+..+|..+..+++|+.+
T Consensus       841 ~p~---------------~~~nL~~L~Ls~n~-i------~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L  898 (1153)
T PLN03210        841 FPD---------------ISTNISDLNLSRTG-I------EEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETV  898 (1153)
T ss_pred             ccc---------------cccccCEeECCCCC-C------ccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCee
Confidence            211               13456666655443 3      2456778899999999999999999999888899999999


Q ss_pred             EEeCCcchhHh
Q 011015          464 WIWGCPILEER  474 (495)
Q Consensus       464 ~l~~~~~l~~~  474 (495)
                      ++++|+.+...
T Consensus       899 ~l~~C~~L~~~  909 (1153)
T PLN03210        899 DFSDCGALTEA  909 (1153)
T ss_pred             ecCCCcccccc
Confidence            99999987643

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 95.4 bits (238), Expect = 6e-22
 Identities = 57/257 (22%), Positives = 89/257 (34%), Gaps = 42/257 (16%)

Query: 122 KVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCE 181
           K    L +  T    + LE       + + P    +L HL+++ +     + +LP+T+ +
Sbjct: 69  KATADLLEDATQPGRVALELRSVP--LPQFPDQAFRLSHLQHMTIDA-AGLMELPDTMQQ 125

Query: 182 LYNLECLNVSGCWNLRELPRGIGKLRKLMYLYNEGTSCLRYLPVGIGELISLREVTKFVV 241
              LE L ++    LR LP  I  L +L  L       L  LP  +    +  E      
Sbjct: 126 FAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG--- 181

Query: 242 GGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRR 301
                    L +L+ L  L    IR L           A +   + L  L +       R
Sbjct: 182 ---------LVNLQSLR-LEWTGIRSLP----------ASIANLQNLKSLKI-------R 214

Query: 302 ENEEDEDERLLEALGPPPNLKKLEIYDYRGRRNVVPI-NWIMSLTNLRDLSLSKWRNCEH 360
            +       L  A+    +L KLE  D RG   +            L+ L L    N   
Sbjct: 215 NS---PLSALGPAIH---HLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLT 268

Query: 361 LPP-LGKLPSLEYLVIE 376
           LP  + +L  LE L + 
Sbjct: 269 LPLDIHRLTQLEKLDLR 285
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.47
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.38
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.37
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.36
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.95
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.89
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.7
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.25
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.68
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.13
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.07
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 85.26
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.7e-33  Score=291.88  Aligned_cols=389  Identities=19%  Similarity=0.162  Sum_probs=260.9

Q ss_pred             ceEEEEEEeccCC-CcchhhhcccccCCCccEEEEcCCccCcccccchHHhhcCCeeeEEEccCccCcccccccccc-cc
Q 011015           79 KVLHLMLTVDVGT-SVPIAIWNNVKRMRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKN-IE  156 (495)
Q Consensus        79 ~~~~l~l~~~~~~-~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~l~~~-~~  156 (495)
                      +++++++.+|.+. .+|..+..   .+++|++|++++|.   +.+.+|..|..+++|++|+++ ++..  ...+|.. +.
T Consensus       270 ~L~~L~L~~n~l~~~ip~~~~~---~~~~L~~L~Ls~n~---l~~~~p~~~~~l~~L~~L~L~-~n~l--~~~ip~~~l~  340 (768)
T 3rgz_A          270 SLQYLSLAENKFTGEIPDFLSG---ACDTLTGLDLSGNH---FYGAVPPFFGSCSLLESLALS-SNNF--SGELPMDTLL  340 (768)
T ss_dssp             TCCEEECCSSEEEESCCCCSCT---TCTTCSEEECCSSE---EEECCCGGGGGCTTCCEEECC-SSEE--EEECCHHHHT
T ss_pred             CCCEEECcCCccCCccCHHHHh---hcCcCCEEECcCCc---CCCccchHHhcCCCccEEECC-CCcc--cCcCCHHHHh
Confidence            7888888888776 35555544   24889999999987   445577778889999999998 6551  3366655 88


Q ss_pred             CcCCcceEecCCCCcccccchhhhccc-cCcEeecCCCcCCcccchhhcc--CCcccEEecCCccccccccccccCcccc
Q 011015          157 KLIHLKYLNLCGQTEIEKLPETLCELY-NLECLNVSGCWNLRELPRGIGK--LRKLMYLYNEGTSCLRYLPVGIGELISL  233 (495)
Q Consensus       157 ~l~~L~~L~l~~~~~~~~lp~~~~~l~-~L~~L~L~~~~~~~~lp~~l~~--l~~L~~L~L~~~~~~~~~~~~i~~l~~L  233 (495)
                      .+++|++|++++|.+.+.+|..+..++ +|++|++++|...+.+|..+..  +++|++|++++|.+.+.+|..++.+++|
T Consensus       341 ~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L  420 (768)
T 3rgz_A          341 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL  420 (768)
T ss_dssp             TCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTC
T ss_pred             cCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCC
Confidence            889999999999986668888888887 8888888888865667777666  7788888888887777788888888888


Q ss_pred             cccCeEEecCccCCccCccchhcccccCCceeeccCCCCChhhhHhhccccccccceEEEEEecCCCCCCccchhHHHhh
Q 011015          234 REVTKFVVGGGYDRACSLGSLKKLNLLRKCSIRGLGGVSDAGEVRRAELEKQKYLVELGLYFDQAGRRENEEDEDERLLE  313 (495)
Q Consensus       234 ~~L~l~~~~~~~~~~~~~~~l~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~  313 (495)
                      +.|++..|....   .....+..+++|+.|.+........    .+..+..+++|+.|+++.|.+++         ..+.
T Consensus       421 ~~L~Ls~N~l~~---~~p~~l~~l~~L~~L~L~~n~l~~~----~p~~~~~l~~L~~L~L~~N~l~~---------~~p~  484 (768)
T 3rgz_A          421 VSLHLSFNYLSG---TIPSSLGSLSKLRDLKLWLNMLEGE----IPQELMYVKTLETLILDFNDLTG---------EIPS  484 (768)
T ss_dssp             CEEECCSSEEES---CCCGGGGGCTTCCEEECCSSCCCSC----CCGGGGGCTTCCEEECCSSCCCS---------CCCG
T ss_pred             CEEECcCCcccC---cccHHHhcCCCCCEEECCCCcccCc----CCHHHcCCCCceEEEecCCcccC---------cCCH
Confidence            888888776652   2334566677777777665433211    12345667788888888887532         2344


Q ss_pred             cCCCCCCcceEEEeeecCcCCCCCCchhhhccccceeeecCccCCCCCCC-CCCCCccceeeccccccceEeCccccCCC
Q 011015          314 ALGPPPNLKKLEIYDYRGRRNVVPINWIMSLTNLRDLSLSKWRNCEHLPP-LGKLPSLEYLVIELMNSVKRVGNEFLGVE  392 (495)
Q Consensus       314 ~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~-~~~l~~L~~L~l~~~~~l~~~~~~~~~~~  392 (495)
                      .+..+++|+.|++++|....  ..|.++..+++|+.|++++|.+.+.+|. ++.+++|++|++++|.....++..+....
T Consensus       485 ~l~~l~~L~~L~L~~N~l~~--~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~  562 (768)
T 3rgz_A          485 GLSNCTNLNWISLSNNRLTG--EIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS  562 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCS--CCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTT
T ss_pred             HHhcCCCCCEEEccCCccCC--cCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhccc
Confidence            56667788888888877664  3377788888888888888877776666 77788888888877653322221110000


Q ss_pred             C--------------------------------------C--------------------CCCCccccCCccceeeeccc
Q 011015          393 S--------------------------------------D--------------------TDGSSVIAFPKLKLLDFYIM  414 (495)
Q Consensus       393 ~--------------------------------------~--------------------~~~~~~~~~~~L~~L~l~~~  414 (495)
                      .                                      .                    ........+++|+.|+++++
T Consensus       563 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N  642 (768)
T 3rgz_A          563 GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN  642 (768)
T ss_dssp             TCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSS
T ss_pred             chhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCC
Confidence            0                                      0                    00001123444444444443


Q ss_pred             c------------------cccccccccccccccccCcccceeeecCCcCccCCCcCCCCCCCccEEEEeCCcch-----
Q 011015          415 K------------------ELEEWDFGTAIKGEIIIMPRLSSLSIDGCPKLKALPDHLLQKTTLQKLWIWGCPIL-----  471 (495)
Q Consensus       415 ~------------------~l~~~~~~~~l~~~~~~~~~L~~L~l~~c~~~~~l~~~~~~l~~L~~L~l~~~~~l-----  471 (495)
                      .                  .|..+.+++.+|..++.+++|++|++++|...+.+|..+..+++|++|++++|+..     
T Consensus       643 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          643 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            2                  03334467888999999999999999999988889999999999999999988541     


Q ss_pred             ----------------------hHhhhccCCCCCCCCCCCCcccc
Q 011015          472 ----------------------EERCRKETGEDWPLIRHIPKISI  494 (495)
Q Consensus       472 ----------------------~~~~~~~~~~~~~~~~~i~~~~~  494 (495)
                                            -..|....+++|++++|+|.++-
T Consensus       723 ~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~~  767 (768)
T 3rgz_A          723 MGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHHH  767 (768)
T ss_dssp             SSSGGGSCGGGGCSCTEEESTTSCCCCSCC---------------
T ss_pred             chhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccCC
Confidence                                  01477788889999999998753
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 495
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 38.7 bits (88), Expect = 0.001
 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 9/93 (9%)

Query: 142 HCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELYNLECLNVSGCWNLRELPR 201
           +       +I    +    L+ LN+    ++ +LP        LE L  S   +L E+P 
Sbjct: 267 YYLNASSNEIRSLCDLPPSLEELNVSN-NKLIELPALPP---RLERLIASFN-HLAEVPE 321

Query: 202 GIGKLRKLMYLYNEGTSCLRYLPVGIGELISLR 234
               L++L   YN     LR  P     +  LR
Sbjct: 322 LPQNLKQLHVEYNP----LREFPDIPESVEDLR 350

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.42
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.49
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=4.1e-21  Score=184.16  Aligned_cols=79  Identities=15%  Similarity=0.199  Sum_probs=46.0

Q ss_pred             CCCccEEEEcCCccCcccccchHHhhcCCeeeEEEccCccCccccccccccccCcCCcceEecCCCCcccccchhhhccc
Q 011015          104 MRRLRSLLVEGGDYSWSSKVLPQLFDKLTCLRALTLETHCCFDFIQKIPKNIEKLIHLKYLNLCGQTEIEKLPETLCELY  183 (495)
Q Consensus       104 ~~~L~~L~l~~~~~~~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~l~~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~  183 (495)
                      +.+|++|+++++.+..+++     +..+++|++|+++ ++.   +..++. ++++++|++|++++|. +..+++ ++.++
T Consensus        43 l~~l~~L~l~~~~I~~l~g-----l~~L~nL~~L~Ls-~N~---l~~l~~-l~~L~~L~~L~L~~n~-i~~i~~-l~~l~  110 (384)
T d2omza2          43 LDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFS-NNQ---LTDITP-LKNLTKLVDILMNNNQ-IADITP-LANLT  110 (384)
T ss_dssp             HTTCCEEECCSSCCCCCTT-----GGGCTTCCEEECC-SSC---CCCCGG-GTTCTTCCEEECCSSC-CCCCGG-GTTCT
T ss_pred             hCCCCEEECCCCCCCCccc-----cccCCCCCEEeCc-CCc---CCCCcc-ccCCcccccccccccc-cccccc-ccccc
Confidence            5556666666665433222     5566666666666 555   555542 6666666666666666 444433 55666


Q ss_pred             cCcEeecCCCc
Q 011015          184 NLECLNVSGCW  194 (495)
Q Consensus       184 ~L~~L~L~~~~  194 (495)
                      +|+.|+++++.
T Consensus       111 ~L~~L~~~~~~  121 (384)
T d2omza2         111 NLTGLTLFNNQ  121 (384)
T ss_dssp             TCCEEECCSSC
T ss_pred             ccccccccccc
Confidence            66666666655
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure