Citrus Sinensis ID: 011060

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----

MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSMDRRGFRSSRSWGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLIGGSRSSRSSSRDSSRSFGGACFNCGKSGHRASECPN

ccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEcccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHccccccccccEEEEEcccccEEEEEccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

HHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEEEEccEEEcccEEEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHccccEEEEEEcHHHccccccccEEEEEcccccccccEEEEccccccccccEEEEEEEcHHHHHHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEEcccEEEEEEEEccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccEEcccccccccccccc

MLAVGFEEDVELILenlppkrqsmLFSATMPSWVKKLSRkyldnplnidlvgnqDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEAlhgdisqhqrertlngfrqgkFTVLVATDVaargldipnvdliihyelpndpetfvhrsgrtgragkegTAILMFTSSQRRTVRslerdvgckfefvsppvveDVLESSAEQVVATLngvhpesvefftPTAQRLIEEKGTDALAAALAQLsgfsrppssrslinheqgWVTLQLTRDSAFSRGFMSARSVMGflsdvyptaadeigKIHIiaddrvqgavfDLPEEIAKELLnkqippgntiskitklpalqddgpssdnygrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddedgfsssrggrsfrsgnnrgsrfstssdddwliggsrssrsssrdssrsfggacfncgksghrasecpn

MLAVGFEEDVELILEnlppkrqsmLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAisttatskrtiLSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRsgrtgragkegtailmftssqrrtvrslerdvgckfefvSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKEllnkqippgntISKItklpalqddgpssdnygrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddedgfsssrggrsfrsgnnrgsrfstssdddwliggsrssrsssrdssrsfggacfncgksghrasecpn

MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYgrfssrdrfsrgggsrfsrggarggargggsmdrrgfrssrswgsddEDgfsssrggrsfrsgnnrgsrfstssDDDWLIGGsrssrsssrdssrsFGGACFNCGKSGHRASECPN

*********VELILEN*******MLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVH************TAILMFTS**RRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALA*************LINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNK***********************************************************************************************************************************************

MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAAL*******************************AFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISK***********************************************************************************************************************NCGKSGH*******

MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPALQDDGPSSDNYGRFSSRD******************************************************SGNNRGSRFSTSSDDDWLI*****************GGACFNCGK**********

*LAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPESVEFFTPTAQRLIEEKGTDALAAALAQLSGFS*************GWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTISKITKLPA*******************************************************************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		494	2.2.26 [Sep-21-2011]
Q8L7S8		748	DEAD-box ATP-dependent RN	no	no	0.783	0.517	0.850	0.0
Q0DM51		758	DEAD-box ATP-dependent RN	yes	no	0.779	0.507	0.815	0.0
Q0D8N0		602	DEAD-box ATP-dependent RN	no	no	0.451	0.370	0.64	3e-81
Q9LUW5		616	DEAD-box ATP-dependent RN	no	no	0.443	0.355	0.643	2e-80
Q0ILZ4		628	DEAD-box ATP-dependent RN	no	no	0.425	0.334	0.638	4e-79
Q9LUW6		610	DEAD-box ATP-dependent RN	no	no	0.443	0.359	0.616	3e-78
Q650T9		696	DEAD-box ATP-dependent RN	no	no	0.724	0.514	0.402	8e-62
Q41382		685	DEAD-box ATP-dependent RN	N/A	no	0.728	0.525	0.384	3e-59
Q9JIK5		851	Nucleolar RNA helicase 2	yes	no	0.809	0.470	0.354	2e-58
Q9BQ39		737	ATP-dependent RNA helicas	no	no	0.744	0.499	0.379	2e-57

>sp\|Q8L7S8\|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2	Back alignment and function desciption

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/387 (85%), Positives = 362/387 (93%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           MLAVGFEE VE ILENLP KRQSMLFSATMP+WVKKL+RKYLDNPLNIDLVG+QDEKLAE
Sbjct: 264 MLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNIDLVGDQDEKLAE 323

Query: 61  GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
           GIKLYAI+TT+TSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLAL++ IA+EALHGD
Sbjct: 324 GIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALSNSIATEALHGD 383

Query: 121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
           ISQHQRERTLN FRQGKFTVLVATDVA+RGLDIPNVDL+IHYELPNDPETFVHRSGRTGR
Sbjct: 384 ISQHQRERTLNAFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPETFVHRSGRTGR 443

Query: 181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
           AGKEG+AILM TSSQ+RTVRSLERDVGC FEF+SPP V D+LESSA+QVVATLNGVHP+S
Sbjct: 444 AGKEGSAILMHTSSQKRTVRSLERDVGCHFEFISPPTVGDLLESSADQVVATLNGVHPDS 503

Query: 241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
           ++FF+ TAQ+L EEKGTDALAAALA LSGFS+PPSSRSL++HE+GWVTLQL RD   +RG
Sbjct: 504 IKFFSATAQKLYEEKGTDALAAALAHLSGFSQPPSSRSLLSHEKGWVTLQLIRDPTNARG 563

Query: 301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
           F+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL K +P GN++S
Sbjct: 564 FLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLEKDVPEGNSLS 623

Query: 361 KITKLPALQDDGPSSDNYGRFSSRDRF 387
            ITKLP LQDDGPSSDNYGRFSSRDR 
Sbjct: 624 MITKLPPLQDDGPSSDNYGRFSSRDRM 650

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q0DM51\|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2	Back alignment and function description

>sp\|Q0D8N0\|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2	Back alignment and function description

>sp\|Q9LUW5\|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1	Back alignment and function description

>sp\|Q0ILZ4\|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1	Back alignment and function description

>sp\|Q9LUW6\|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1	Back alignment and function description

>sp\|Q650T9\|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Oryza sativa subsp. japonica GN=Os09g0520700 PE=2 SV=1	Back alignment and function description

>sp\|Q41382\|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1	Back alignment and function description

>sp\|Q9JIK5\|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3	Back alignment and function description

>sp\|Q9BQ39\|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		494
225450401		764	PREDICTED: DEAD-box ATP-dependent RNA he	0.973	0.629	0.802	0.0
224124522		775	predicted protein [Populus trichocarpa]	0.965	0.615	0.793	0.0
118489724		481	unknown [Populus trichocarpa x Populus d	0.965	0.991	0.795	0.0
224124506		735	predicted protein [Populus trichocarpa]	0.967	0.650	0.803	0.0
356505715		771	PREDICTED: DEAD-box ATP-dependent RNA he	0.987	0.632	0.791	0.0
255543078		772	dead box ATP-dependent RNA helicase, put	0.957	0.612	0.760	0.0
357511641		753	DEAD-box ATP-dependent RNA helicase [Med	0.963	0.632	0.789	0.0
356534927		736	PREDICTED: DEAD-box ATP-dependent RNA he	0.957	0.642	0.765	0.0
356574052		736	PREDICTED: DEAD-box ATP-dependent RNA he	0.953	0.639	0.761	0.0
343172316		782	DEAD-box ATP-dependent RNA helicase, par	0.963	0.608	0.745	0.0

>gi\|225450401\|ref\|XP_002278318.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Vitis vinifera] gi\|296089875\|emb\|CBI39694.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/496 (80%), Positives = 428/496 (86%), Gaps = 15/496 (3%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           MLAVGFEEDVE+ILE LP +RQSMLFSATMP+WVKKL+RKYLDNPL IDLVG+ DEKLAE
Sbjct: 278 MLAVGFEEDVEVILEKLPSERQSMLFSATMPAWVKKLARKYLDNPLTIDLVGDHDEKLAE 337

Query: 61  GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
           GIKLYAI TTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVS+ALT+ IASEALHGD
Sbjct: 338 GIKLYAIPTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSMALTNSIASEALHGD 397

Query: 121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
           ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR
Sbjct: 398 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 457

Query: 181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
           AGKEGTAILMFTSSQRRTV+SLERDVGCKFEF+SPP +E+VLESSAEQVVATLNGVHPES
Sbjct: 458 AGKEGTAILMFTSSQRRTVKSLERDVGCKFEFISPPAIEEVLESSAEQVVATLNGVHPES 517

Query: 241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
           VEFFTPTAQ+LIEEKGT ALAAALA LSGFS+PPS RSLI+HEQGWVTLQLTRDS +SRG
Sbjct: 518 VEFFTPTAQKLIEEKGTGALAAALAHLSGFSQPPSFRSLISHEQGWVTLQLTRDSGYSRG 577

Query: 301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
           F+SARSV GFLSDVYPTAADE+GKI+++AD+RVQGAVFDLPEEIAKELLNKQ+PPGNTIS
Sbjct: 578 FLSARSVTGFLSDVYPTAADELGKIYLVADERVQGAVFDLPEEIAKELLNKQMPPGNTIS 637

Query: 361 KITKLPALQDDGPSSDNYGRFSSRDRFSRGGGSRFSRGGARGGARGGGSMDRRGFRSSRS 420
           KITKLPALQDDGP+ D YGRFS+RDR S            RGG+R          R S  
Sbjct: 638 KITKLPALQDDGPAGDYYGRFSNRDRSS------------RGGSRERRGSRISRGRGSSW 685

Query: 421 WGSDDEDGFSSSRGGRSFRSGNNRGSRFSTSSDDDWLI--GGSRSSRSSSRDSSRSFGGA 478
              DD     + RGGRSFRS NN  SR   +S+DDWLI    S  S SS     RSFGG+
Sbjct: 686 GSDDDGGDDLNRRGGRSFRSNNN-WSRNLRTSEDDWLIGGRRSNRSSSSFGSRERSFGGS 744

Query: 479 CFNCGKSGHRASECPN 494
           CF CG+SGHRASECPN
Sbjct: 745 CFTCGRSGHRASECPN 760

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224124522\|ref\|XP_002330044.1\| predicted protein [Populus trichocarpa] gi\|222871469\|gb\|EEF08600.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118489724\|gb\|ABK96663.1\| unknown [Populus trichocarpa x Populus deltoides]	Back alignment and taxonomy information

>gi\|224124506\|ref\|XP_002330040.1\| predicted protein [Populus trichocarpa] gi\|222871465\|gb\|EEF08596.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356505715\|ref\|XP_003521635.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|255543078\|ref\|XP_002512602.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223548563\|gb\|EEF50054.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357511641\|ref\|XP_003626109.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi\|87240993\|gb\|ABD32851.1\| Helicase, C-terminal; Zinc finger, CCHC-type; GUCT [Medicago truncatula] gi\|355501124\|gb\|AES82327.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356534927\|ref\|XP_003536002.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356574052\|ref\|XP_003555166.1\| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|343172316\|gb\|AEL98862.1\| DEAD-box ATP-dependent RNA helicase, partial [Silene latifolia]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		494
TAIR\|locus:504955106		748	emb1138 "embryo defective 1138	0.765	0.505	0.849	8.9e-182
TAIR\|locus:2087852		616	PMH2 "putative mitochondrial R	0.443	0.355	0.643	9.6e-73
TAIR\|locus:2087832		610	PMH1 "putative mitochondrial R	0.475	0.385	0.595	4.8e-71
ZFIN\|ZDB-GENE-031113-10		759	ddx21 "DEAD (Asp-Glu-Ala-Asp)	0.744	0.484	0.396	1e-59
UNIPROTKB\|F1MMK3		737	DDX50 "Uncharacterized protein	0.751	0.503	0.379	3.2e-58
UNIPROTKB\|E2QTT0		738	DDX50 "Uncharacterized protein	0.751	0.502	0.377	5.1e-58
UNIPROTKB\|E2RPT4		687	DDX50 "Uncharacterized protein	0.751	0.540	0.377	5.1e-58
UNIPROTKB\|Q9BQ39		737	DDX50 "ATP-dependent RNA helic	0.751	0.503	0.377	1.1e-57
MGI\|MGI:2182303		734	Ddx50 "DEAD (Asp-Glu-Ala-Asp)	0.751	0.505	0.372	1.1e-57
TAIR\|locus:2167903		671	PRH75 [Arabidopsis thaliana (t	0.732	0.539	0.390	5.9e-57

TAIR\|locus:504955106 emb1138 "embryo defective 1138" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1652 (586.6 bits), Expect = 8.9e-182, Sum P(2) = 8.9e-182
 Identities = 321/378 (84%), Positives = 354/378 (93%)

Query:     1 MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
             MLAVGFEE VE ILENLP KRQSMLFSATMP+WVKKL+RKYLDNPLNIDLVG+QDEKLAE
Sbjct:   264 MLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNIDLVGDQDEKLAE 323

Query:    61 GIKLYAISTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSIIASEALHGD 120
             GIKLYAI+TT+TSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLAL++ IA+EALHGD
Sbjct:   324 GIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALSNSIATEALHGD 383

Query:   121 ISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRTGR 180
             ISQHQRERTLN FRQGKFTVLVATDVA+RGLDIPNVDL+IHYELPNDPETFVHRSGRTGR
Sbjct:   384 ISQHQRERTLNAFRQGKFTVLVATDVASRGLDIPNVDLVIHYELPNDPETFVHRSGRTGR 443

Query:   181 AGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVHPES 240
             AGKEG+AILM TSSQ+RTVRSLERDVGC FEF+SPP V D+LESSA+QVVATLNGVHP+S
Sbjct:   444 AGKEGSAILMHTSSQKRTVRSLERDVGCHFEFISPPTVGDLLESSADQVVATLNGVHPDS 503

Query:   241 VEFFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRSLINHEQGWVTLQLTRDSAFSRG 300
             ++FF+ TAQ+L EEKGTDALAAALA LSGFS+PPSSRSL++HE+GWVTLQL RD   +RG
Sbjct:   504 IKFFSATAQKLYEEKGTDALAAALAHLSGFSQPPSSRSLLSHEKGWVTLQLIRDPTNARG 563

Query:   301 FMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIPPGNTIS 360
             F+SARSV GFLSD+Y TAADE+GKI +IADDR+QGAVFDLPEEIAKELL K +P GN++S
Sbjct:   564 FLSARSVTGFLSDLYRTAADEVGKIFLIADDRIQGAVFDLPEEIAKELLEKDVPEGNSLS 623

Query:   361 KITKLPALQDDGPSSDNY 378
              ITKLP LQDDGPSSDNY
Sbjct:   624 MITKLPPLQDDGPSSDNY 641

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003723 "RNA binding" evidence=IEA

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=IEA

GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS

GO:0008270 "zinc ion binding" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0009793 "embryo development ending in seed dormancy" evidence=NAS

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0009941 "chloroplast envelope" evidence=IDA

TAIR\|locus:2087852 PMH2 "putative mitochondrial RNA helicase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2087832 PMH1 "putative mitochondrial RNA helicase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-031113-10 ddx21 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 21" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MMK3 DDX50 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QTT0 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RPT4 DDX50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BQ39 DDX50 "ATP-dependent RNA helicase DDX50" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2182303 Ddx50 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 50" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

TAIR\|locus:2167903 PRH75 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0DM51	RH3_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.8155	0.7793	0.5079	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	0.946
3rd Layer	3.6.4	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00022481001	SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (762 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00000559001	SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (169 aa)	•	0.499

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		494
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	6e-64
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	3e-49
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	4e-40
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	5e-39
PTZ00110		545	PTZ00110, PTZ00110, helicase; Provisional	1e-38
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	1e-37
PTZ00424		401	PTZ00424, PTZ00424, helicase 45; Provisional	3e-35
PRK11192		434	PRK11192, PRK11192, ATP-dependent RNA helicase Srm	2e-34
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	4e-33
pfam08152		97	pfam08152, GUCT, GUCT (NUC152) domain	1e-28
PRK04837		423	PRK04837, PRK04837, ATP-dependent RNA helicase Rhl	2e-28
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	2e-27
PRK04537		572	PRK04537, PRK04537, ATP-dependent RNA helicase Rhl	1e-26
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	2e-25
PLN00206		518	PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel	2e-19
cd12938		74	cd12938, GUCT_Hera, RNA-binding GUCT-like domain f	5e-19
COG1111		542	COG1111, MPH1, ERCC4-like helicases [DNA replicati	1e-15
PRK13766		773	PRK13766, PRK13766, Hef nuclease; Provisional	6e-15
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	3e-14
cd00268		203	cd00268, DEADc, DEAD-box helicases	1e-13
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	1e-12
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	6e-11
TIGR00614		470	TIGR00614, recQ_fam, ATP-dependent DNA helicase, R	1e-09
cd12937		86	cd12937, GUCT_RH7_like, RNA-binding GUCT domain fo	6e-09
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	8e-09
TIGR01587		358	TIGR01587, cas3_core, CRISPR-associated helicase C	1e-08
TIGR00631		655	TIGR00631, uvrb, excinuclease ABC, B subunit	6e-08
COG0556		663	COG0556, UvrB, Helicase subunit of the DNA excisio	8e-08
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	1e-07
TIGR00580		926	TIGR00580, mfd, transcription-repair coupling fact	2e-07
COG1197		1139	COG1197, Mfd, Transcription-repair coupling factor	7e-07
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	9e-07
pfam00098		18	pfam00098, zf-CCHC, Zinc knuckle	1e-06
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	1e-06
TIGR00643		630	TIGR00643, recG, ATP-dependent DNA helicase RecG	2e-06
cd09639		353	cd09639, Cas3_I, CRISPR/Cas system-associated prot	2e-06
smart00343		17	smart00343, ZnF_C2HC, zinc finger	3e-06
COG1205		851	COG1205, COG1205, Distinct helicase family with a	6e-06
COG1200		677	COG1200, RecG, RecG-like helicase [DNA replication	8e-06
PRK10689		1147	PRK10689, PRK10689, transcription-repair coupling	1e-05
PRK11057		607	PRK11057, PRK11057, ATP-dependent DNA helicase Rec	2e-05
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	2e-04
PTZ00368		148	PTZ00368, PTZ00368, universal minicircle sequence	2e-04
PRK05580		679	PRK05580, PRK05580, primosome assembly protein Pri	6e-04
COG4098		441	COG4098, comFA, Superfamily II DNA/RNA helicase re	6e-04
PRK05298		652	PRK05298, PRK05298, excinuclease ABC subunit B; Pr	9e-04
pfam06682		317	pfam06682, DUF1183, Protein of unknown function (D	0.001
PRK10917		681	PRK10917, PRK10917, ATP-dependent DNA helicase Rec	0.001
TIGR03817		742	TIGR03817, DECH_helic, helicase/secretion neighbor	0.001
PLN03137		1195	PLN03137, PLN03137, ATP-dependent DNA helicase; Q4	0.002
PTZ00473		420	PTZ00473, PTZ00473, Plasmodium Vir superfamily; Pr	0.003
TIGR04121		803	TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA	0.004
PRK00254		720	PRK00254, PRK00254, ski2-like helicase; Provisiona	0.004

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

 Score =  215 bits (550), Expect = 6e-64
 Identities = 100/289 (34%), Positives = 157/289 (54%), Gaps = 12/289 (4%)

Query: 1   MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAE 60
           ML +GF +D+E IL+ LPP RQ++LFSATMP  +++L+R+YL++P+ I++   + E+  +
Sbjct: 186 MLDMGFIDDIEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLK 245

Query: 61  GIKLYAIST-TATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALTSI-IASEALH 118
            IK + +   +   K  +L  L+    +G + IVF +TKR  +E++ +L        ALH
Sbjct: 246 KIKQFYLEVESEEEKLELLLKLLKDEDEG-RVIVFVRTKRLVEELAESLRKRGFKVAALH 304

Query: 119 GDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLIIHYELPNDPETFVHRSGRT 178
           GD+ Q +R+R L  F+ G+  VLVATDVAARGLDIP+V  +I+Y+LP DPE +VHR GRT
Sbjct: 305 GDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRT 364

Query: 179 GRAGKEGTAILMFTSS-QRRTVRSLERDVGCKFE-FVSPPVVEDVLESSAEQVVATLNGV 236
           GRAG++G AI   T   + + ++ +E+ +  K    V  P+ E       +     L   
Sbjct: 365 GRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLKTTRPGLEEE 424

Query: 237 HPESVE-------FFTPTAQRLIEEKGTDALAAALAQLSGFSRPPSSRS 278
              S E                +    +  LA    ++ G     +   
Sbjct: 425 SDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGDAVTIDP 473

Length = 513

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|240273 PTZ00110, PTZ00110, helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|185609 PTZ00424, PTZ00424, helicase 45; Provisional	Back alignment and domain information

>gnl\|CDD\|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|203861 pfam08152, GUCT, GUCT (NUC152) domain	Back alignment and domain information

>gnl\|CDD\|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|240595 cd12938, GUCT_Hera, RNA-binding GUCT-like domain found in Thermus thermophilus heat resistant RNA-dependent ATPase (Hera) and similar proteins	Back alignment and domain information

>gnl\|CDD\|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237496 PRK13766, PRK13766, Hef nuclease; Provisional	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

>gnl\|CDD\|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>gnl\|CDD\|240594 cd12937, GUCT_RH7_like, RNA-binding GUCT domain found in plant DEAD-box ATP-dependent RNA helicase 7 (RH7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3	Back alignment and domain information

>gnl\|CDD\|233063 TIGR00631, uvrb, excinuclease ABC, B subunit	Back alignment and domain information

>gnl\|CDD\|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd)	Back alignment and domain information

>gnl\|CDD\|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|189387 pfam00098, zf-CCHC, Zinc knuckle	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG	Back alignment and domain information

>gnl\|CDD\|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3	Back alignment and domain information

>gnl\|CDD\|197667 smart00343, ZnF_C2HC, zinc finger	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>gnl\|CDD\|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional	Back alignment and domain information

>gnl\|CDD\|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional	Back alignment and domain information

>gnl\|CDD\|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated	Back alignment and domain information

>gnl\|CDD\|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional	Back alignment and domain information

>gnl\|CDD\|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183)	Back alignment and domain information

>gnl\|CDD\|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>gnl\|CDD\|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>gnl\|CDD\|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>gnl\|CDD\|240430 PTZ00473, PTZ00473, Plasmodium Vir superfamily; Provisional	Back alignment and domain information

>gnl\|CDD\|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated	Back alignment and domain information

>gnl\|CDD\|234702 PRK00254, PRK00254, ski2-like helicase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		494
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
PTZ00110		545	helicase; Provisional	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	99.98
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	99.97
PTZ00424		401	helicase 45; Provisional	99.97
KOG0347		731	consensus RNA helicase [RNA processing and modific	99.97
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.97
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	99.97
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.96
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.96
KOG4284		980	consensus DEAD box protein [Transcription]	99.96
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.95
PHA02653		675	RNA helicase NPH-II; Provisional	99.95
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	99.95
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.95
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.94
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.94
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.93
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.92
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.92
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.92
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.92
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.91
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.91
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.9
PRK13767		876	ATP-dependent helicase; Provisional	99.9
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.9
PRK10689		1147	transcription-repair coupling factor; Provisional	99.9
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.89
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.88
PRK02362		737	ski2-like helicase; Provisional	99.88
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.87
PRK00254		720	ski2-like helicase; Provisional	99.87
PRK04914		956	ATP-dependent helicase HepA; Validated	99.86
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.86
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.86
PRK01172		674	ski2-like helicase; Provisional	99.83
PRK05298		652	excinuclease ABC subunit B; Provisional	99.82
PRK09401		1176	reverse gyrase; Reviewed	99.82
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.82
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.81
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.8
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.8
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.79
PRK14701		1638	reverse gyrase; Provisional	99.79
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.78
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.78
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.78
PHA02558		501	uvsW UvsW helicase; Provisional	99.78
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.78
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.78
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.77
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.77
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.74
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.74
COG1202		830	Superfamily II helicase, archaea-specific [General	99.72
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	99.72
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.71
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.7
PRK09694		878	helicase Cas3; Provisional	99.7
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.69
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.69
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.69
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.68
PRK13766		773	Hef nuclease; Provisional	99.67
KOG0354		746	consensus DEAD-box like helicase [General function	99.66
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.65
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.65
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.63
COG1204		766	Superfamily II helicase [General function predicti	99.62
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.6
PRK05580		679	primosome assembly protein PriA; Validated	99.59
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.59
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.58
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.58
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.56
COG1205		851	Distinct helicase family with a unique C-terminal	99.52
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.49
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.45
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.45
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.43
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.42
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.42
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.42
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.4
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.38
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.35
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.31
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.24
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.21
PF08152		97	GUCT: GUCT (NUC152) domain; InterPro: IPR012562 Th	99.2
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.17
COG1198		730	PriA Primosomal protein N' (replication factor Y)	98.97
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	98.92
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	98.91
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	98.88
PRK12326		764	preprotein translocase subunit SecA; Reviewed	98.87
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	98.75
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	98.73
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	98.73
PF00098		18	zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi	98.72
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.64
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	98.64
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	98.63
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	98.61
PF03880		74	DbpA: DbpA RNA binding domain ; InterPro: IPR00558	98.6
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	98.55
CHL00122		870	secA preprotein translocase subunit SecA; Validate	98.45
KOG0387		923	consensus Transcription-coupled repair protein CSB	98.44
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.42
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	98.3
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	98.25
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	98.23
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	98.21
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.15
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	98.13
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	98.12
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	98.09
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	98.08
KOG1123		776	consensus RNA polymerase II transcription initiati	98.07
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	98.06
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	98.05
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	97.99
COG4096		875	HsdR Type I site-specific restriction-modification	97.96
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	97.95
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	97.94
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	97.88
PTZ00368		148	universal minicircle sequence binding protein (UMS	97.82
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	97.8
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.79
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.77
PTZ00368		148	universal minicircle sequence binding protein (UMS	97.74
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	97.71
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	97.69
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	97.67
COG5082		190	AIR1 Arginine methyltransferase-interacting protei	97.62
KOG3973		465	consensus Uncharacterized conserved glycine-rich p	97.61
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	97.57
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	97.51
PF13696		32	zf-CCHC_2: Zinc knuckle	97.5
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	97.48
PRK14873		665	primosome assembly protein PriA; Provisional	97.44
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	97.34
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	97.28
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	97.14
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	97.1
PF13917		42	zf-CCHC_3: Zinc knuckle	96.99
COG4889		1518	Predicted helicase [General function prediction on	96.92
PF14787		36	zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB:	96.91
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	96.89
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	96.84
smart00343		26	ZnF_C2HC zinc finger.	96.83
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	96.72
PF13871		278	Helicase_C_4: Helicase_C-like	96.64
KOG4400		261	consensus E3 ubiquitin ligase interacting with arg	96.61
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.56
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	96.45
PRK05580		679	primosome assembly protein PriA; Validated	96.43
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	96.39
TIGR00595		505	priA primosomal protein N'. All proteins in this f	96.36
KOG4439		901	consensus RNA polymerase II transcription terminat	96.3
PRK14873		665	primosome assembly protein PriA; Provisional	96.23
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	95.96
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	95.87
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	95.81
KOG3973		465	consensus Uncharacterized conserved glycine-rich p	95.61
KOG4400		261	consensus E3 ubiquitin ligase interacting with arg	95.42
KOG2340		698	consensus Uncharacterized conserved protein [Funct	95.41
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	95.14
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	94.98
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	94.75
PRK10689		1147	transcription-repair coupling factor; Provisional	94.74
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	94.58
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	94.51
COG5082		190	AIR1 Arginine methyltransferase-interacting protei	94.37
KOG0701		1606	consensus dsRNA-specific nuclease Dicer and relate	93.97
COG1198		730	PriA Primosomal protein N' (replication factor Y)	93.9
KOG1016		1387	consensus Predicted DNA helicase, DEAD-box superfa	93.86
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	93.74
PRK14701		1638	reverse gyrase; Provisional	92.9
PF14392		49	zf-CCHC_4: Zinc knuckle	92.88
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	92.32
KOG0347		731	consensus RNA helicase [RNA processing and modific	92.21
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	92.15
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	91.74
PF15288		40	zf-CCHC_6: Zinc knuckle	91.17
COG5222		427	Uncharacterized conserved protein, contains RING Z	90.56
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	90.43
KOG0119		554	consensus Splicing factor 1/branch point binding p	90.22
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	90.19
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	89.9
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	89.36
KOG0334		997	consensus RNA helicase [RNA processing and modific	89.26
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	89.18
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	88.53
PTZ00110		545	helicase; Provisional	87.75
PRK13766		773	Hef nuclease; Provisional	87.6
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	87.51
PRK09401		1176	reverse gyrase; Reviewed	87.49
KOG1001		674	consensus Helicase-like transcription factor HLTF/	87.15
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	87.06
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	86.96
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	85.88
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	85.58
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	85.22
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	84.09
PF10593		239	Z1: Z1 domain; InterPro: IPR018310 This entry repr	83.17
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	82.65
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	81.97
COG4907		595	Predicted membrane protein [Function unknown]	81.89
smart00487		201	DEXDc DEAD-like helicases superfamily.	80.97
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	80.34

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.5e-52  Score=449.79  Aligned_cols=344  Identities=29%  Similarity=0.470  Sum_probs=298.9

Q ss_pred             CCcCCHHHHHHHHHHhCCCCCcEEEEeecCChHHHHHHHHHcCCCcEEEeccccccccccceEEEEEEcCCccHHHHHHH
Q 011060            1 MLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVGNQDEKLAEGIKLYAISTTATSKRTILSD   80 (494)
Q Consensus         1 mL~~GF~~~l~~Il~~~~~~~q~il~SAT~~~~v~~~~~~~~~~~~~v~~~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~   80 (494)
                      ||+|||.++|+.|++.+|+..|+++||||+|+.+..++++|+.+|..|.+..  .......+.+.++.+....|.+.|..
T Consensus       161 ml~~gf~~di~~Il~~lp~~~q~llfSAT~p~~i~~i~~~~l~~~~~i~i~~--~~~~~~~i~q~~~~v~~~~k~~~L~~  238 (629)
T PRK11634        161 MLRMGFIEDVETIMAQIPEGHQTALFSATMPEAIRRITRRFMKEPQEVRIQS--SVTTRPDISQSYWTVWGMRKNEALVR  238 (629)
T ss_pred             HhhcccHHHHHHHHHhCCCCCeEEEEEccCChhHHHHHHHHcCCCeEEEccC--ccccCCceEEEEEEechhhHHHHHHH
Confidence            7899999999999999999999999999999999999999999998887653  23345567777777777788888888


Q ss_pred             HHHHHccCCeEEEEeCChHHHHHHHHHHHc-cCcEEEEeCCCCHHHHHHHHhhccCCcEEEEEecccccccCCCCCccEE
Q 011060           81 LITVYAKGGKTIVFTQTKRDADEVSLALTS-IIASEALHGDISQHQRERTLNGFRQGKFTVLVATDVAARGLDIPNVDLI  159 (494)
Q Consensus        81 ll~~~~~~~~~iVF~~t~~~~~~l~~~l~~-~~~~~~lhg~~~~~~R~~~~~~F~~g~~~iLVaTd~~~~Gidip~v~~V  159 (494)
                      ++... ...++||||+|+..++.|++.|.. ++.+..+|++|++.+|++++++|++|+++||||||++++|||+|+|++|
T Consensus       239 ~L~~~-~~~~~IVF~~tk~~a~~l~~~L~~~g~~~~~lhgd~~q~~R~~il~~Fr~G~~~ILVATdv~arGIDip~V~~V  317 (629)
T PRK11634        239 FLEAE-DFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLV  317 (629)
T ss_pred             HHHhc-CCCCEEEEeccHHHHHHHHHHHHhCCCCEEEeeCCCCHHHHHHHHHHHhCCCCCEEEEcchHhcCCCcccCCEE
Confidence            88754 457899999999999999999985 7899999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCCHhHHHHHhhccCcCCCCceEEEecChhhHHHHHHHHHHhcCCccccCCCChHHHHHHHHHHHHHHhccCC-c
Q 011060          160 IHYELPNDPETFVHRSGRTGRAGKEGTAILMFTSSQRRTVRSLERDVGCKFEFVSPPVVEDVLESSAEQVVATLNGVH-P  238 (494)
Q Consensus       160 I~~~~P~~~~~y~qr~GR~gR~g~~g~~i~l~~~~e~~~~~~l~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~l~~~~-~  238 (494)
                      ||||+|.++++|+||+|||||+|+.|.+++|+++.|...++.|++.++..++++.+|..+++.+.....+...+.... .
T Consensus       318 I~~d~P~~~e~yvqRiGRtGRaGr~G~ai~~v~~~e~~~l~~ie~~~~~~i~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  397 (629)
T PRK11634        318 VNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNIERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLES  397 (629)
T ss_pred             EEeCCCCCHHHHHHHhccccCCCCcceEEEEechHHHHHHHHHHHHhCCCcceecCCcHHHHHHHHHHHHHHHHHHHhhh
Confidence            999999999999999999999999999999999999999999999999999999999999888888888777765433 3


Q ss_pred             cchhhhHHHHHHHHhh-----hCHHHHHHHHHHHcCCCCC------C-----C---Ccc-----------------c--c
Q 011060          239 ESVEFFTPTAQRLIEE-----KGTDALAAALAQLSGFSRP------P-----S---SRS-----------------L--I  280 (494)
Q Consensus       239 ~~~~~~~~~~~~l~~~-----~~~~~l~~al~~l~~~~~~------~-----~---~r~-----------------l--~  280 (494)
                      +.++.|...++++++.     .+++.++++|+.+..-..+      +     .   .+.                 .  .
T Consensus       398 ~~~~~~~~~~~~l~~~~~~~~~~~~~~a~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (629)
T PRK11634        398 SDLDQYRALLAKIQPTAEGEELDLETLAAALLKMAQGERPLILPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPR  477 (629)
T ss_pred             hhHHHHHHHHHHHHhhhccccCCHHHHHHHHHHHHcCCCccccccccccccccccccccccccccccccccccccccccc
Confidence            4577788888888864     6789999999998632211      0     0   000                 0  0


Q ss_pred             c---CCCCceEEEeecCcccccCCCChhHHHHHhhhhcCCCcCccccEEEeecCceeeEEeecCHHHHHHHHhhcCC
Q 011060          281 N---HEQGWVTLQLTRDSAFSRGFMSARSVMGFLSDVYPTAADEIGKIHIIADDRVQGAVFDLPEEIAKELLNKQIP  354 (494)
Q Consensus       281 ~---~~~~~~~~~~~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~ig~i~i~~~~~~~gs~fdvp~~~a~~~~~~~~~  354 (494)
                      .   ...+|++++++.|+   ++++.|++|+++|++..++...+||+|+|+++|    ++||||++.+++++..+..
T Consensus       478 ~~~~~~~~~~~~~~~~g~---~~~~~~~~~~~~i~~~~~~~~~~ig~i~i~~~~----s~v~~~~~~~~~~~~~~~~  547 (629)
T PRK11634        478 RERRDVGDMQLYRIEVGR---DDGVEVRHIVGAIANEGDISSRYIGNIKLFASH----STIELPKGMPGEVLQHFTR  547 (629)
T ss_pred             cccccCCCCEEEEEeccc---ccCCCHHHHHHHHHhhcCCChhhCCcEEEeCCc----eEEEcChhhHHHHHHHhcc
Confidence            0   12268999999999   899999999999999999999999999999998    6999999999999987654

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PF08152 GUCT: GUCT (NUC152) domain; InterPro: IPR012562 This is the C-terminal domain found in the RNA helicase II / Gu protein family []	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins []	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PF13696 zf-CCHC_2: Zinc knuckle	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF13917 zf-CCHC_3: Zinc knuckle	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>smart00343 ZnF_C2HC zinc finger	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]	Back alignment and domain information

>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PF14392 zf-CCHC_4: Zinc knuckle	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PF15288 zf-CCHC_6: Zinc knuckle	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>COG4907 Predicted membrane protein [Function unknown]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		494
3i32_A		300	Dimeric Structure Of A Hera Helicase Fragment Inclu		7e-38
3eaq_A		212	Novel Dimerization Motif In The Dead Box Rna Helica		5e-34
2i4i_A		417	Crystal Structure Of Human Dead-Box Rna Helicase Dd		3e-33
2hxy_A		391	Crystal Structure Of Human Apo-Eif4aiii Length = 39		5e-32
2hyi_C		413	Structure Of The Human Exon Junction Complex With A		6e-32
2j0u_B		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		1e-31
2j0q_A		410	The Crystal Structure Of The Exon Junction Complex		1e-31
2xb2_A		411	Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar		1e-31
2j0u_A		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		2e-31
1hv8_A		367	Crystal Structure Of A Dead Box Protein From The Hy		7e-31
2db3_A		434	Structural Basis For Rna Unwinding By The Dead-Box		2e-29
1s2m_A		400	Crystal Structure Of The Dead Box Protein Dhh1p Len		3e-26
3pew_A		395	S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3		1e-24
3pey_A		395	S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length		2e-24
2vso_A		395	Crystal Structure Of A Translation Initiation Compl		3e-24
3eiq_A		414	Crystal Structure Of Pdcd4-eif4a Length = 414		6e-24
2zu6_A		388	Crystal Structure Of The Eif4a-Pdcd4 Complex Length		7e-24
2jgn_A		185	Ddx3 Helicase Domain Length = 185		1e-23
2z0m_A		337	Crystal Structure Of Hypothetical Atp-Dependent Rna		3e-23
2hjv_A		163	Structure Of The Second Domain (Residues 207-368) O		3e-22
1fuu_A		394	Yeast Initiation Factor 4a Length = 394		1e-21
3fho_B		508	Structure Of S. Pombe Dbp5 Length = 508		3e-21
1xti_A		391	Structure Of Wildtype Human Uap56 Length = 391		2e-20
1xtj_A		386	Structure Of Human Uap56 In Complex With Adp Length		2e-20
1xtk_A		390	Structure Of Decd To Dead Mutation Of Human Uap56 L		3e-20
3fht_A		412	Crystal Structure Of Human Dbp5 In Complex With Amp		7e-20
3ews_A		445	Human Dead-Box Rna-Helicase Ddx19 In Complex With A		8e-20
3g0h_A		424	Human Dead-box Rna Helicase Ddx19, In Complex With		8e-20
2kbf_A		187	Solution Structure Of Carboxyl-Terminal Domain Of D		9e-20
3fmp_B		479	Crystal Structure Of The Nucleoporin Nup214 In Comp		9e-20
3peu_A		188	S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To		2e-19
3gfp_A		189	Structure Of The C-Terminal Domain Of The Dead-Box		3e-19
3i5x_A		563	Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len		5e-18
3sqw_A		579	Structure Of Mss116p (Nte Deletion) Bound To Ssrna		5e-18
3sqx_A		512	Structure Of Mss116p (Nte And C-Tail Double Deletio		7e-18
2p6n_A		191	Human Dead-box Rna Helicase Ddx41, Helicase Domain		3e-17
2wax_A		193	Structure Of The Human Ddx6 C-Terminal Domain In Co		4e-16
2yjt_D		170	Crystal Structure Of E. Coli Dead-Box Protein Srmb		1e-15
2rb4_A		175	Crystal Structure Of The Helicase Domain Of Human D		4e-15
4db2_A		257	Mss116p Dead-Box Helicase Domain 2 Bound To An Rna		5e-15
4db4_A		256	Mss116p Dead-Box Helicase Domain 2 Bound To A Chima		5e-15
4db2_C		257	Mss116p Dead-Box Helicase Domain 2 Bound To An Rna		5e-15
1fuk_A		165	Crystal Structure Of The Carboxy Terminal Domain Of		7e-13
2gxq_A		207	Hera N-Terminal Domain In Complex With Amp, Crystal		2e-12
3mwj_A		207	Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap		2e-12
1t5i_A		172	Crystal Structure Of The C-Terminal Domain Of Uap56		9e-12
1wp9_A		494	Crystal Structure Of Pyrococcus Furiosus Hef Helica		5e-09
2v1x_A		591	Crystal Structure Of Human Recq-Like Dna Helicase L		2e-08
1oyy_A		523	Structure Of The Recq Catalytic Core Bound To Atp-G		3e-08
1oyw_A		523	Structure Of The Recq Catalytic Core Length = 523		6e-08
1gm5_A		780	Structure Of Recg Bound To Three-Way Dna Junction L		1e-06
4gl2_A		699	Structural Basis For Dsrna Duplex Backbone Recognit		3e-06
2eyq_A		1151	Crystal Structure Of Escherichia Coli Transcription		5e-06
2fwr_A		472	Structure Of Archaeoglobus Fulgidis Xpb Length = 47		9e-06
2pl3_A		236	Human Dead-Box Rna Helicase Ddx10, Dead Domain In C		1e-05
2fzl_A		219	Structure Of C-Terminal Domain Of Archaeoglobus Ful		2e-05
1qva_A		223	Yeast Initiation Factor 4a N-Terminal Domain Length		4e-05
1qde_A		224	Crystal Structure Of The Atpase Domain Of Translati		5e-05
3v4r_A		667	Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt		8e-05
2d7d_A		661	Structural Insights Into The Cryptic Dna Dependent		8e-05
1d9z_A		657	Crystal Structure Of The Dna Repair Protein Uvrb In		1e-04
2fdc_A		658	Structural Basis Of Dna Damage Recognition And Proc		1e-04
1t5l_A		658	Crystal Structure Of The Dna Repair Protein Uvrb Po		1e-04
1d9x_A		658	Crystal Structure Of The Dna Repair Protein Uvrb Le		1e-04
3uwx_B		683	Crystal Structure Of Uvra-Uvrb Complex Length = 683		1e-04
4i1s_A		243	Melanoma Differentiation Associated Protein-5 Helic		1e-04
1c4o_A		664	Crystal Structure Of The Dna Nucleotide Excision Re		3e-04
1d2m_A		665	Uvrb Protein Of Thermus Thermophilus Hb8; A Nucleot		3e-04
3ber_A		249	Human Dead-Box Rna-Helicase Ddx47, Conserved Domain		3e-04
4a4d_A		253	Crystal Structure Of The N-Terminal Domain Of The H		4e-04
3fe2_A		242	Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D		4e-04
3ly5_A		262	Ddx18 Dead-Domain Length = 262		5e-04
2p6r_A		702	Crystal Structure Of Superfamily 2 Helicase Hel308		8e-04

>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300