Citrus Sinensis ID: 011076

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE

cHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccHHHHcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccHHHHHHcccHHHHHHccccccHHHHHHHccccccccccccccc

cHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEHHHcHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccEEEccHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEccEcHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHccccccccccccccc

mvlaqlggSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVnlddlaaghnKRRIIQQAIFNELCkmldpgkpsftpkkgkpsvIMFVglqgsgktttctKYAYYhqkkgwkpalvcADTFRAGAFDQLKQNatkakipfygsytesdpvrIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKmdghakgggALSAVaatkspvifigtgehmdefevfdvkpFVSRllgmgdwsgfmdkihevvpmdqqpELLQKLSEGNFTLRIMYEQFQNILkmgpigqvfsmlpgfsselmpkgreKESQAKIKRYMTMMDSMtneeldssnpklmndsrIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMkglkipkkgemsALSRNMNAQHMSkvlpqgmlkqiggvggLQNLMKQMGSTKdmmgmfggge

mvlaqlggSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKivnlddlaaghNKRRIIQQAIFNELCKMLDPGKPsftpkkgkpSVIMFVglqgsgktTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKakipfygsytesdpVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFsselmpkgreKESQAKIKRYMTMMDSMTneeldssnpklmndsRIMRiargsgrqvrEVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGqaafdqaqafkqSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE

*************I*QMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLD*************SVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRH***AALFE*******ATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPG***********************************************************VMEMLEEYKRLAKIWSKMK*************************************************************

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHE*************LSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPG*******************RYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKR**********************************************************************

MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELM********QAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQMGSTKDMMGMFGGGE

*VLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVSVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLEEYKRLAKIWSKMK************************VLPQGMLK*****************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		494	2.2.26 [Sep-21-2011]
P49972		499	Signal recognition partic	N/A	no	0.981	0.971	0.950	0.0
P49967		495	Signal recognition partic	yes	no	1.0	0.997	0.888	0.0
P49971		496	Signal recognition partic	N/A	no	0.979	0.975	0.895	0.0
P49969		497	Signal recognition partic	N/A	no	0.981	0.975	0.837	0.0
P49968		497	Signal recognition partic	N/A	no	0.981	0.975	0.835	0.0
P49966		497	Signal recognition partic	no	no	0.995	0.989	0.787	0.0
P37106		479	Signal recognition partic	no	no	0.949	0.979	0.791	0.0
P49970		493	Signal recognition partic	N/A	no	0.985	0.987	0.726	0.0
P14576		504	Signal recognition partic	yes	no	0.991	0.972	0.582	1e-168
Q5R4R6		504	Signal recognition partic	yes	no	0.991	0.972	0.580	1e-168

>sp\|P49972\|SR542_SOLLC Signal recognition particle 54 kDa protein 2 OS=Solanum lycopersicum PE=2 SV=1	Back alignment and function desciption

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/485 (95%), Positives = 477/485 (98%)

Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLA+LGGSISRA+QQMSNATIIDEKVLNECLNEITRALLQADVQFKLVR+M TNIKKIV
Sbjct: 1   MVLAELGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIV 60

Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           NLDDLAAGHNKRRIIQQA+FNELCK+LDPGKPSFTPKKGKPS++MFVGLQGSGKTTTCTK
Sbjct: 61  NLDDLAAGHNKRRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFVGLQGSGKTTTCTK 120

Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
           YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPV+IAV+GVETFK
Sbjct: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVDGVETFK 180

Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV 240
           KENCDLIIVDTSGRHKQEAALFEEMRQV+EAT PDLVIFVMDSSIGQAAFDQAQAFKQSV
Sbjct: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
           +VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct: 241 AVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSEL 360
           SGFMDKIHEVVPMDQQPELLQKLSEG+FTLRIMYEQFQNILKMGPIGQVFSMLPGFS+EL
Sbjct: 301 SGFMDKIHEVVPMDQQPELLQKLSEGHFTLRIMYEQFQNILKMGPIGQVFSMLPGFSAEL 360

Query: 361 MPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLE 420
           MPKGRE ESQAKIKRYMTMMDSMTNEELDSSNPKLM DSRIMRIARGSGRQV EVM+M+E
Sbjct: 361 MPKGRENESQAKIKRYMTMMDSMTNEELDSSNPKLMTDSRIMRIARGSGRQVHEVMDMME 420

Query: 421 EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQM 480
           EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLP  MLKQIGG+GGLQNLMKQM
Sbjct: 421 EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQM 480

Query: 481 GSTKD 485
           GS KD
Sbjct: 481 GSAKD 485

Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
Solanum lycopersicum (taxid: 4081)

>sp\|P49967\|SR543_ARATH Signal recognition particle 54 kDa protein 3 OS=Arabidopsis thaliana GN=SRP-54C PE=2 SV=2	Back alignment and function description

>sp\|P49971\|SR541_SOLLC Signal recognition particle 54 kDa protein 1 OS=Solanum lycopersicum PE=3 SV=1	Back alignment and function description

>sp\|P49969\|SR542_HORVU Signal recognition particle 54 kDa protein 2 OS=Hordeum vulgare GN=SRP54-2 PE=2 SV=1	Back alignment and function description

>sp\|P49968\|SR541_HORVU Signal recognition particle 54 kDa protein 1 OS=Hordeum vulgare GN=SRP54-1 PE=2 SV=1	Back alignment and function description

>sp\|P49966\|SR542_ARATH Signal recognition particle 54 kDa protein 2 OS=Arabidopsis thaliana GN=SRP-54B PE=3 SV=2	Back alignment and function description

>sp\|P37106\|SR541_ARATH Signal recognition particle 54 kDa protein 1 OS=Arabidopsis thaliana GN=SRP-54A PE=2 SV=1	Back alignment and function description

>sp\|P49970\|SR543_HORVU Signal recognition particle 54 kDa protein 3 OS=Hordeum vulgare GN=SRP54-3 PE=2 SV=1	Back alignment and function description

>sp\|P14576\|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2	Back alignment and function description

>sp\|Q5R4R6\|SRP54_PONAB Signal recognition particle 54 kDa protein OS=Pongo abelii GN=SRP54 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		494
255553241		497	signal recognition particle 54 kD protei	1.0	0.993	0.963	0.0
225442910		495	PREDICTED: signal recognition particle 5	1.0	0.997	0.937	0.0
356526231		495	PREDICTED: signal recognition particle 5	1.0	0.997	0.939	0.0
224059270		493	predicted protein [Populus trichocarpa]	0.997	1.0	0.937	0.0
350535032		499	signal recognition particle 54 kDa prote	0.981	0.971	0.950	0.0
224139052		491	predicted protein [Populus trichocarpa]	0.993	1.0	0.945	0.0
118487996		495	unknown [Populus trichocarpa]	1.0	0.997	0.933	0.0
449468938		495	PREDICTED: signal recognition particle 5	1.0	0.997	0.921	0.0
356554903		499	PREDICTED: signal recognition particle 5	0.981	0.971	0.940	0.0
356550626		500	PREDICTED: signal recognition particle 5	0.981	0.97	0.938	0.0

>gi\|255553241\|ref\|XP_002517663.1\| signal recognition particle 54 kD protein, putative [Ricinus communis] gi\|223543295\|gb\|EEF44827.1\| signal recognition particle 54 kD protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/494 (96%), Positives = 485/494 (98%)

Query: 1   MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
           MVLAQLGGSISRAIQQMSNATIIDEK LN+CLNEITRALLQ+DVQFKLVR+MQTNIKKIV
Sbjct: 1   MVLAQLGGSISRAIQQMSNATIIDEKALNDCLNEITRALLQSDVQFKLVRDMQTNIKKIV 60

Query: 61  NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
           NLDDLAAGHNKR+IIQQAIFNELCKMLDPGKPSFTPKKGK SV+MFVGLQGSGKTTTCTK
Sbjct: 61  NLDDLAAGHNKRKIIQQAIFNELCKMLDPGKPSFTPKKGKTSVVMFVGLQGSGKTTTCTK 120

Query: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
           YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSY ESDPV+IAVEGVE FK
Sbjct: 121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYMESDPVKIAVEGVERFK 180

Query: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSV 240
           KENCDLIIVDTSGRHKQEAALFEEMRQVSEAT PDLVIFVMDSSIGQAAFDQAQAFKQSV
Sbjct: 181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query: 241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
           +VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct: 241 AVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSEL 360
           SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFS+EL
Sbjct: 301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSAEL 360

Query: 361 MPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLE 420
           MPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEM E
Sbjct: 361 MPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMFE 420

Query: 421 EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQM 480
           EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLP  MLKQIGG+GGLQNLMKQM
Sbjct: 421 EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPPQMLKQIGGMGGLQNLMKQM 480

Query: 481 GSTKDMMGMFGGGE 494
           GS KDMMGMFGGGE
Sbjct: 481 GSAKDMMGMFGGGE 494

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225442910\|ref\|XP_002264159.1\| PREDICTED: signal recognition particle 54 kDa protein 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356526231\|ref\|XP_003531722.1\| PREDICTED: signal recognition particle 54 kDa protein 2-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|224059270\|ref\|XP_002299799.1\| predicted protein [Populus trichocarpa] gi\|222847057\|gb\|EEE84604.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|350535032\|ref\|NP_001234428.1\| signal recognition particle 54 kDa protein 2 [Solanum lycopersicum] gi\|1711512\|sp\|P49972.1\|SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa protein 2; Short=SRP54 gi\|556902\|emb\|CAA84288.1\| 54-kD signal recognition particle (SRP) specific protein [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|224139052\|ref\|XP_002322968.1\| predicted protein [Populus trichocarpa] gi\|222867598\|gb\|EEF04729.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118487996\|gb\|ABK95819.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449468938\|ref\|XP_004152178.1\| PREDICTED: signal recognition particle 54 kDa protein 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356554903\|ref\|XP_003545781.1\| PREDICTED: signal recognition particle 54 kDa protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356550626\|ref\|XP_003543686.1\| PREDICTED: signal recognition particle 54 kDa protein 2-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		494
TAIR\|locus:2028563		495	AT1G48900 [Arabidopsis thalian	1.0	0.997	0.864	1.2e-230
TAIR\|locus:2157809		497	AT5G49500 "AT5G49500" [Arabido	0.995	0.989	0.769	9.4e-201
TAIR\|locus:2037803		479	ATHSRP54A "signal recognition	0.965	0.995	0.776	4.1e-200
ZFIN\|ZDB-GENE-040426-818		504	srp54 "signal recognition part	0.991	0.972	0.572	1.8e-149
UNIPROTKB\|Q2T9U1		504	SRP54 "Signal recognition part	0.991	0.972	0.566	1e-148
UNIPROTKB\|P61010		504	SRP54 "Signal recognition part	0.991	0.972	0.566	1e-148
UNIPROTKB\|P61011		504	SRP54 "Signal recognition part	0.991	0.972	0.566	1e-148
UNIPROTKB\|F2Z5M9		504	SRP54 "Uncharacterized protein	0.991	0.972	0.566	1e-148
UNIPROTKB\|Q4R965		504	SRP54 "Signal recognition part	0.991	0.972	0.566	1e-148
UNIPROTKB\|Q5R4R6		504	SRP54 "Signal recognition part	0.991	0.972	0.566	1e-148

TAIR\|locus:2028563 AT1G48900 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2225 (788.3 bits), Expect = 1.2e-230, P = 1.2e-230
 Identities = 427/494 (86%), Positives = 462/494 (93%)

Query:     1 MVLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIV 60
             MVLA+LGG I+RAIQQMSN TIIDEK LNECLNEITRALLQ+DV F LV+EMQ+NIKKIV
Sbjct:     1 MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIV 60

Query:    61 NLDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTK 120
             NL+DLAAGHNKRRII+QAIF+ELCKMLDPGKP+F PKK K SV+MFVGLQG+GKTTTCTK
Sbjct:    61 NLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFVGLQGAGKTTTCTK 120

Query:   121 YAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFK 180
             YAYYHQKKG+KPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPV+IAVEGV+TFK
Sbjct:   121 YAYYHQKKGYKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDTFK 180

Query:   181 KENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGXXXXXXXXXXXXSV 240
             KENCDLIIVDTSGRHKQEA+LFEEMRQV+EAT PDLVIFVMDSSIG            SV
Sbjct:   181 KENCDLIIVDTSGRHKQEASLFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV 240

Query:   241 SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300
             +VGAVI+TKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW
Sbjct:   241 AVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDW 300

Query:   301 SGFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSEL 360
             SGF+DK+ EVVP DQQPELL+KLS+GNFTLRIMY+QFQNIL MGP+ +VFSMLPG S+E+
Sbjct:   301 SGFVDKLQEVVPKDQQPELLEKLSQGNFTLRIMYDQFQNILNMGPLKEVFSMLPGISAEM 360

Query:   361 MPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRIMRIARGSGRQVREVMEMLE 420
             MPKG EKESQAKIKRYMTMMDSMTN+ELDSSNPK+ N+SR+MRIARGSGRQVREVMEMLE
Sbjct:   361 MPKGHEKESQAKIKRYMTMMDSMTNDELDSSNPKVFNESRMMRIARGSGRQVREVMEMLE 420

Query:   421 EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNAQHMSKVLPQGMLKQIGGVGGLQNLMKQM 480
             EYKRLAKIWSKMKGLKIPK G+MSALSRNMNAQHMSKVLP  MLKQIGG+GGLQ+LMKQM
Sbjct:   421 EYKRLAKIWSKMKGLKIPKNGDMSALSRNMNAQHMSKVLPPQMLKQIGGMGGLQSLMKQM 480

Query:   481 GSTKDMMGMFGGGE 494
             GS KDMMGMFGGG+
Sbjct:   481 GSGKDMMGMFGGGD 494

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003729 "mRNA binding" evidence=ISS

GO:0005525 "GTP binding" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0005786 "signal recognition particle, endoplasmic reticulum targeting" evidence=ISS

GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA

GO:0006617 "SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition" evidence=ISS

GO:0008312 "7S RNA binding" evidence=IEA;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0048500 "signal recognition particle" evidence=IEA

GO:0005829 "cytosol" evidence=IDA

GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA

GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA

GO:0051607 "defense response to virus" evidence=RCA

TAIR\|locus:2157809 AT5G49500 "AT5G49500" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037803 ATHSRP54A "signal recognition particle 54 kDa subunit" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-818 srp54 "signal recognition particle 54" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2T9U1 SRP54 "Signal recognition particle 54 kDa protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P61010 SRP54 "Signal recognition particle 54 kDa protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P61011 SRP54 "Signal recognition particle 54 kDa protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F2Z5M9 SRP54 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4R965 SRP54 "Signal recognition particle 54 kDa protein" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R4R6 SRP54 "Signal recognition particle 54 kDa protein" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O27376	SRP54_METTH	No assigned EC number	0.425	0.8704	0.9728	yes	no
Q8PXF3	SRP54_METMA	No assigned EC number	0.4247	0.8522	0.9503	yes	no
A6VHE0	SRP54_METM7	No assigned EC number	0.4238	0.8947	0.9822	yes	no
P37106	SR541_ARATH	No assigned EC number	0.7917	0.9493	0.9791	no	no
Q9V1E8	SRP54_PYRAB	No assigned EC number	0.4470	0.8643	0.9638	yes	no
Q12ZG8	SRP54_METBU	No assigned EC number	0.4337	0.8542	0.9612	yes	no
A0B638	SRP54_METTP	No assigned EC number	0.4324	0.8542	0.9504	yes	no
Q0W2G1	SRP54_UNCMA	No assigned EC number	0.4289	0.8421	0.9369	yes	no
Q75K18	SRP54_DICDI	No assigned EC number	0.488	0.9473	0.8634	yes	no
A1RS43	SRP54_PYRIL	No assigned EC number	0.4109	0.8623	0.9838	yes	no
C3NDW4	SRP54_SULIY	No assigned EC number	0.4018	0.8522	0.9418	yes	no
Q00179	SRP54_ASPNG	No assigned EC number	0.4920	0.8805	0.8146	yes	no
B6YSS1	SRP54_THEON	No assigned EC number	0.4326	0.8906	0.9821	yes	no
Q971S9	SRP54_SULTO	No assigned EC number	0.4333	0.8259	0.9168	yes	no
Q5R4R6	SRP54_PONAB	No assigned EC number	0.5808	0.9919	0.9722	yes	no
P21565	SRP54_SCHPO	No assigned EC number	0.5057	0.8724	0.8256	yes	no
P14576	SRP54_MOUSE	No assigned EC number	0.5828	0.9919	0.9722	yes	no
A6UWG4	SRP54_META3	No assigned EC number	0.4234	0.8744	0.96	yes	no
Q46E01	SRP54_METBF	No assigned EC number	0.4314	0.8522	0.9503	yes	no
A9A9B0	SRP54_METM6	No assigned EC number	0.4238	0.8947	0.9822	yes	no
A4FVX4	SRP54_METM5	No assigned EC number	0.4216	0.8947	0.9822	yes	no
Q8THD0	SRP54_METAC	No assigned EC number	0.4253	0.8522	0.9568	yes	no
P49971	SR541_SOLLC	No assigned EC number	0.8950	0.9797	0.9758	N/A	no
P49970	SR543_HORVU	No assigned EC number	0.7261	0.9858	0.9878	N/A	no
P49972	SR542_SOLLC	No assigned EC number	0.9505	0.9817	0.9719	N/A	no
Q6LX03	SRP54_METMP	No assigned EC number	0.4238	0.8947	0.9822	yes	no
Q8MZJ6	SRP54_GEOCY	No assigned EC number	0.5856	0.9878	0.9779	N/A	no
O59307	SRP54_PYRHO	No assigned EC number	0.4429	0.8805	0.9819	yes	no
O07853	SRP54_SULAC	No assigned EC number	0.4261	0.8259	0.9189	yes	no
A6UQJ8	SRP54_METVS	No assigned EC number	0.4471	0.8724	0.9577	yes	no
A5UMY7	SRP54_METS3	No assigned EC number	0.4109	0.8967	0.9955	yes	no
Q2T9U1	SRP54_BOVIN	No assigned EC number	0.5808	0.9919	0.9722	yes	no
P61010	SRP54_CANFA	No assigned EC number	0.5808	0.9919	0.9722	yes	no
P61011	SRP54_HUMAN	No assigned EC number	0.5808	0.9919	0.9722	yes	no
Q57565	SRP54_METJA	No assigned EC number	0.4518	0.8582	0.9401	yes	no
Q99150	SRP54_YARLI	No assigned EC number	0.4978	0.8927	0.8227	yes	no
Q6AYB5	SRP54_RAT	No assigned EC number	0.5808	0.9919	0.9722	yes	no
Q4R965	SRP54_MACFA	No assigned EC number	0.5808	0.9919	0.9722	N/A	no
C5A233	SRP54_THEGJ	No assigned EC number	0.4444	0.8785	0.9687	yes	no
A2BNB5	SRP54_HYPBU	No assigned EC number	0.4133	0.8441	0.9328	yes	no
Q8U070	SRP54_PYRFU	No assigned EC number	0.4301	0.8866	0.9887	yes	no
Q5JJC8	SRP54_PYRKO	No assigned EC number	0.4603	0.8785	0.9687	yes	no
P49968	SR541_HORVU	No assigned EC number	0.8353	0.9817	0.9758	N/A	no
P49969	SR542_HORVU	No assigned EC number	0.8374	0.9817	0.9758	N/A	no
C3MYM8	SRP54_SULIM	No assigned EC number	0.4018	0.8522	0.9418	yes	no
P49966	SR542_ARATH	No assigned EC number	0.7874	0.9959	0.9899	no	no
P49967	SR543_ARATH	No assigned EC number	0.8886	1.0	0.9979	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		494
TIGR01425		429	TIGR01425, SRP54_euk, signal recognition particle	0.0
PRK00771		437	PRK00771, PRK00771, signal recognition particle pr	1e-172
COG0541		451	COG0541, Ffh, Signal recognition particle GTPase [	1e-171
PRK10867		433	PRK10867, PRK10867, signal recognition particle pr	1e-113
TIGR00959		428	TIGR00959, ffh, signal recognition particle protei	1e-109
pfam00448		196	pfam00448, SRP54, SRP54-type protein, GTPase domai	1e-106
smart00962		197	smart00962, SRP54, SRP54-type protein, GTPase doma	3e-91
cd03115		173	cd03115, SRP, The signal recognition particle (SRP	2e-72
PRK14974		336	PRK14974, PRK14974, cell division protein FtsY; Pr	1e-65
COG0552		340	COG0552, FtsY, Signal recognition particle GTPase	3e-65
PRK10416		318	PRK10416, PRK10416, signal recognition particle-do	3e-63
TIGR00064		272	TIGR00064, ftsY, signal recognition particle-docki	3e-63
pfam02978		101	pfam02978, SRP_SPB, Signal peptide binding domain	5e-33
PRK05703		424	PRK05703, flhF, flagellar biosynthesis regulator F	3e-25
COG1419		407	COG1419, FlhF, Flagellar GTP-binding protein [Cell	4e-23
TIGR03499		283	TIGR03499, FlhF, flagellar biosynthetic protein Fl	1e-17
PRK12726		407	PRK12726, PRK12726, flagellar biosynthesis regulat	6e-13
PRK12724		432	PRK12724, PRK12724, flagellar biosynthesis regulat	2e-10
PRK12723		388	PRK12723, PRK12723, flagellar biosynthesis regulat	2e-10
pfam02881		77	pfam02881, SRP54_N, SRP54-type protein, helical bu	3e-10
smart00963		77	smart00963, SRP54_N, SRP54-type protein, helical b	5e-10
PRK06731		270	PRK06731, flhF, flagellar biosynthesis regulator F	3e-09
PRK11889		436	PRK11889, flhF, flagellar biosynthesis regulator F	1e-08
smart00382		148	smart00382, AAA, ATPases associated with a variety	3e-08
PRK14722		374	PRK14722, flhF, flagellar biosynthesis regulator F	1e-07
PRK14723		767	PRK14723, flhF, flagellar biosynthesis regulator F	3e-06
PRK12727		559	PRK12727, PRK12727, flagellar biosynthesis regulat	1e-05
cd01983		99	cd01983, Fer4_NifH, The Fer4_NifH superfamily cont	2e-04
pfam13671		143	pfam13671, AAA_33, AAA domain	4e-04
COG1341		398	COG1341, COG1341, Predicted GTPase or GTP-binding	4e-04
PRK14721		420	PRK14721, flhF, flagellar biosynthesis regulator F	0.001
pfam03205		126	pfam03205, MobB, Molybdopterin guanine dinucleotid	0.001
COG1703		323	COG1703, ArgK, Putative periplasmic protein kinase	0.003

>gnl\|CDD\|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54	Back alignment and domain information

 Score =  712 bits (1840), Expect = 0.0
 Identities = 292/429 (68%), Positives = 363/429 (84%), Gaps = 2/429 (0%)

Query: 2   VLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVN 61
           VLA LG SI+ A++ MSNAT+IDE+VLN  L EI  ALL++DV  KLVR+++ NIKK +N
Sbjct: 1   VLADLGSSITSALRSMSNATVIDEEVLNAMLKEICTALLESDVNIKLVRQLRENIKKAIN 60

Query: 62  LDDLAAGHNKRRIIQQAIFNELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKY 121
           L+++A+G NKR++IQ A+F ELC ++DPG  +FTPKKGK +VIMFVGLQGSGKTTTCTK 
Sbjct: 61  LEEMASGLNKRKMIQHAVFKELCNLVDPGVEAFTPKKGKQNVIMFVGLQGSGKTTTCTKL 120

Query: 122 AYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVRIAVEGVETFKK 181
           AYY+Q+KG+KP LVCADTFRAGAFDQLKQNATKA+IPFYGSYTESDPV+IA EGVE FKK
Sbjct: 121 AYYYQRKGFKPCLVCADTFRAGAFDQLKQNATKARIPFYGSYTESDPVKIASEGVEKFKK 180

Query: 182 ENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVS 241
           EN D+IIVDTSGRHKQE +LFEEM QV+EA  PD +IFVMD SIGQAA  QA+AFK SV 
Sbjct: 181 ENFDIIIVDTSGRHKQEDSLFEEMLQVAEAIQPDNIIFVMDGSIGQAAEAQAKAFKDSVD 240

Query: 242 VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWS 301
           VG+VI+TK+DGHAKGGGALSAVAATKSP+IFIGTGEH+D+FE+F  +PF+S+LLGMGD  
Sbjct: 241 VGSVIITKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEIFKTQPFISKLLGMGDIE 300

Query: 302 GFMDKIHEVVPMDQQPELLQKLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELM 361
           G +DK+ ++   D +  L++KL EG FTLR MYEQFQN+LKMGP+GQ+ SM+PGFS++ M
Sbjct: 301 GLIDKVQDLKLDDNEKALIEKLKEGTFTLRDMYEQFQNLLKMGPLGQILSMIPGFSTDFM 360

Query: 362 PKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLM--NDSRIMRIARGSGRQVREVMEML 419
            KG E+ES AKIK+ MT+MDSMT++ELDS++ K+     SRI R+ARGSGR +R+V E+L
Sbjct: 361 SKGNEEESMAKIKKLMTIMDSMTDQELDSTDGKVFSKQPSRIQRVARGSGRSIRDVQELL 420

Query: 420 EEYKRLAKI 428
           E+YK+ A++
Sbjct: 421 EQYKKFAQM 429

This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model. Length = 429

>gnl\|CDD\|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>gnl\|CDD\|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|236780 PRK10867, PRK10867, signal recognition particle protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233210 TIGR00959, ffh, signal recognition particle protein	Back alignment and domain information

>gnl\|CDD\|215925 pfam00448, SRP54, SRP54-type protein, GTPase domain	Back alignment and domain information

>gnl\|CDD\|214940 smart00962, SRP54, SRP54-type protein, GTPase domain	Back alignment and domain information

>gnl\|CDD\|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>gnl\|CDD\|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional	Back alignment and domain information

>gnl\|CDD\|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>gnl\|CDD\|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY	Back alignment and domain information

>gnl\|CDD\|202493 pfam02978, SRP_SPB, Signal peptide binding domain	Back alignment and domain information

>gnl\|CDD\|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>gnl\|CDD\|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>gnl\|CDD\|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF	Back alignment and domain information

>gnl\|CDD\|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain	Back alignment and domain information

>gnl\|CDD\|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain	Back alignment and domain information

>gnl\|CDD\|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>gnl\|CDD\|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>gnl\|CDD\|222307 pfam13671, AAA_33, AAA domain	Back alignment and domain information

>gnl\|CDD\|224260 COG1341, COG1341, Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|217424 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B	Back alignment and domain information

>gnl\|CDD\|224617 COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		494
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	100.0
KOG0780		483	consensus Signal recognition particle, subunit Srp	100.0
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	100.0
PRK10867		433	signal recognition particle protein; Provisional	100.0
PRK00771		437	signal recognition particle protein Srp54; Provisi	100.0
TIGR00959		428	ffh signal recognition particle protein. This mode	100.0
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	100.0
PRK14974		336	cell division protein FtsY; Provisional	100.0
PRK10416		318	signal recognition particle-docking protein FtsY;	100.0
TIGR00064		272	ftsY signal recognition particle-docking protein F	100.0
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	100.0
KOG0781		587	consensus Signal recognition particle receptor, al	100.0
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	100.0
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	100.0
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	100.0
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	100.0
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	100.0
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	100.0
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	100.0
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	100.0
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	99.98
PF02978		104	SRP_SPB: Signal peptide binding domain; InterPro:	99.97
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	99.97
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	99.97
COG1159		298	Era GTPase [General function prediction only]	99.97
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	99.95
cd03115		173	SRP The signal recognition particle (SRP) mediates	99.94
TIGR00436		270	era GTP-binding protein Era. Era is an essential G	99.91
PRK00089		292	era GTPase Era; Reviewed	99.91
PRK15494		339	era GTPase Era; Provisional	99.9
COG0486		454	ThdF Predicted GTPase [General function prediction	99.83
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	99.8
PRK09435		332	membrane ATPase/protein kinase; Provisional	99.72
KOG1423		379	consensus Ras-like GTPase ERA [Cell cycle control,	99.7
COG1160		444	Predicted GTPases [General function prediction onl	99.68
PRK05291		449	trmE tRNA modification GTPase TrmE; Reviewed	99.64
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	99.63
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	99.62
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	99.6
COG1160		444	Predicted GTPases [General function prediction onl	99.58
KOG1191		531	consensus Mitochondrial GTPase [Translation, ribos	99.57
TIGR03156		351	GTP_HflX GTP-binding protein HflX. This protein fa	99.56
PRK13768		253	GTPase; Provisional	99.55
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	99.55
PF02421		156	FeoB_N: Ferrous iron transport protein B; InterPro	99.55
TIGR00450		442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	99.54
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	99.52
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	99.48
PRK12298		390	obgE GTPase CgtA; Reviewed	99.48
cd03114		148	ArgK-like The function of this protein family is u	99.44
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.39
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	99.39
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	99.38
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	99.35
cd01894		157	EngA1 EngA1 subfamily. This CD represents the firs	99.34
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	99.33
PHA02518		211	ParA-like protein; Provisional	99.33
PRK03003		472	GTP-binding protein Der; Reviewed	99.32
PRK11058		426	GTPase HflX; Provisional	99.32
cd02117		212	NifH_like This family contains the NifH (iron prot	99.31
cd01895		174	EngA2 EngA2 subfamily. This CD represents the seco	99.31
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	99.3
PRK03003		472	GTP-binding protein Der; Reviewed	99.3
TIGR00101		199	ureG urease accessory protein UreG. This model rep	99.29
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.28
PRK13849		231	putative crown gall tumor protein VirC1; Provision	99.28
PRK00093		435	GTP-binding protein Der; Reviewed	99.28
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	99.27
TIGR03594		429	GTPase_EngA ribosome-associated GTPase EngA. EngA	99.27
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	99.26
cd00881		189	GTP_translation_factor GTP translation factor fami	99.26
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	99.26
TIGR01007		204	eps_fam capsular exopolysaccharide family. This mo	99.25
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	99.25
PRK00093		435	GTP-binding protein Der; Reviewed	99.24
smart00053		240	DYNc Dynamin, GTPase. Large GTPases that mediate v	99.24
PRK15467		158	ethanolamine utilization protein EutP; Provisional	99.24
cd01898		170	Obg Obg subfamily. The Obg nucleotide binding prot	99.23
TIGR01969		251	minD_arch cell division ATPase MinD, archaeal. Thi	99.22
cd03110		179	Fer4_NifH_child This protein family's function is	99.21
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	99.21
PF00009		188	GTP_EFTU: Elongation factor Tu GTP binding domain;	99.2
cd02040		270	NifH NifH gene encodes component II (iron protein)	99.2
COG1084		346	Predicted GTPase [General function prediction only	99.2
PRK09866		741	hypothetical protein; Provisional	99.19
PRK11670		369	antiporter inner membrane protein; Provisional	99.18
cd01887		168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	99.17
CHL00175		281	minD septum-site determining protein; Validated	99.17
PRK09554		772	feoB ferrous iron transport protein B; Reviewed	99.16
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	99.16
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	99.15
PRK13235		274	nifH nitrogenase reductase; Reviewed	99.15
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	99.15
CHL00072		290	chlL photochlorophyllide reductase subunit L	99.15
cd02036		179	MinD Bacterial cell division requires the formatio	99.15
TIGR03371		246	cellulose_yhjQ cellulose synthase operon protein Y	99.14
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	99.14
cd02032		267	Bchl_like This family of proteins contains bchL an	99.14
TIGR03018		207	pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t	99.14
PRK12299		335	obgE GTPase CgtA; Reviewed	99.14
cd03112		158	CobW_like The function of this protein family is u	99.13
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	99.13
cd01890		179	LepA LepA subfamily. LepA belongs to the GTPase fa	99.12
TIGR01281		268	DPOR_bchL light-independent protochlorophyllide re	99.11
PF07015		231	VirC1: VirC1 protein; InterPro: IPR009744 This fam	99.11
PRK12296		500	obgE GTPase CgtA; Reviewed	99.1
TIGR03029		274	EpsG chain length determinant protein tyrosine kin	99.1
cd04171		164	SelB SelB subfamily. SelB is an elongation factor	99.09
PRK13230		279	nitrogenase reductase-like protein; Reviewed	99.09
TIGR03598		179	GTPase_YsxC ribosome biogenesis GTP-binding protei	99.09
PRK04213		201	GTP-binding protein; Provisional	99.09
cd01879		158	FeoB Ferrous iron transport protein B (FeoB) subfa	99.09
PRK13232		273	nifH nitrogenase reductase; Reviewed	99.09
PRK11519		719	tyrosine kinase; Provisional	99.08
cd00550		254	ArsA_ATPase Oxyanion-translocating ATPase (ArsA).	99.08
TIGR02528		142	EutP ethanolamine utilization protein, EutP. This	99.08
cd02033		329	BchX Chlorophyllide reductase converts chlorophyll	99.07
cd04168		237	TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T	99.07
COG2262		411	HflX GTPases [General function prediction only]	99.07
cd01897		168	NOG NOG1 is a nucleolar GTP-binding protein presen	99.07
cd01884		195	EF_Tu EF-Tu subfamily. This subfamily includes ort	99.07
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	99.06
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	99.06
cd04170		268	EF-G_bact Elongation factor G (EF-G) subfamily. Tr	99.06
cd01886		270	EF-G Elongation factor G (EF-G) subfamily. Translo	99.05
cd01881		176	Obg_like The Obg-like subfamily consists of five w	99.05
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	99.05
cd04166		208	CysN_ATPS CysN_ATPS subfamily. CysN, together with	99.04
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	99.04
PRK12297		424	obgE GTPase CgtA; Reviewed	99.04
COG0489		265	Mrp ATPases involved in chromosome partitioning [C	99.03
PRK10818		270	cell division inhibitor MinD; Provisional	99.03
COG0370		653	FeoB Fe2+ transport system protein B [Inorganic io	99.01
cd01891		194	TypA_BipA TypA (tyrosine phosphorylated protein A)	99.01
PRK13869		405	plasmid-partitioning protein RepA; Provisional	99.01
PRK13233		275	nifH nitrogenase reductase; Reviewed	99.0
TIGR02729		329	Obg_CgtA Obg family GTPase CgtA. This model descri	99.0
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	99.0
TIGR01287		275	nifH nitrogenase iron protein. This model describe	99.0
PRK10037		250	cell division protein; Provisional	99.0
PRK00454		196	engB GTP-binding protein YsxC; Reviewed	99.0
PRK13234		295	nifH nitrogenase reductase; Reviewed	98.99
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	98.99
COG0218		200	Predicted GTPase [General function prediction only	98.99
TIGR01968		261	minD_bact septum site-determining protein MinD. Th	98.99
smart00178		184	SAR Sar1p-like members of the Ras-family of small	98.98
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	98.98
PRK13705		388	plasmid-partitioning protein SopA; Provisional	98.97
cd04165		224	GTPBP1_like GTPBP1-like. Mammalian GTP binding pro	98.97
cd02038		139	FleN-like FleN is a member of the Fer4_NifH superf	98.96
cd01889		192	SelB_euk SelB subfamily. SelB is an elongation fac	98.96
cd04157		162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	98.96
cd01864		165	Rab19 Rab19 subfamily. Rab19 proteins are associat	98.95
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	98.95
cd04154		173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	98.95
TIGR03453		387	partition_RepA plasmid partitioning protein RepA.	98.95
cd04145		164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	98.94
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	98.94
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	98.94
PF06564		243	YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p	98.94
TIGR03815		322	CpaE_hom_Actino helicase/secretion neighborhood Cp	98.94
PRK13236		296	nitrogenase reductase; Reviewed	98.93
cd02042		104	ParA ParA and ParB of Caulobacter crescentus belon	98.93
cd04142		198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	98.93
cd03111		106	CpaE_like This protein family consists of proteins	98.92
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	98.92
cd00878		158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	98.92
cd04169		267	RF3 RF3 subfamily. Peptide chain release factor 3	98.91
cd01861		161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	98.91
cd04153		174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	98.91
PHA02519		387	plasmid partition protein SopA; Reviewed	98.91
cd01896		233	DRG The developmentally regulated GTP-binding prot	98.9
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	98.9
cd04104		197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	98.9
cd01888		203	eIF2_gamma eIF2-gamma (gamma subunit of initiation	98.9
PRK13231		264	nitrogenase reductase-like protein; Reviewed	98.89
cd00879		190	Sar1 Sar1 subfamily. Sar1 is an essential componen	98.89
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	98.89
COG1192		259	Soj ATPases involved in chromosome partitioning [C	98.89
cd04158		169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	98.88
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	98.88
PF09140		261	MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi	98.88
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	98.88
cd01860		163	Rab5_related Rab5-related subfamily. This subfamil	98.88
cd01869		166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	98.88
cd04151		158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	98.87
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	98.87
COG2894		272	MinD Septum formation inhibitor-activating ATPase	98.86
TIGR00991		313	3a0901s02IAP34 GTP-binding protein (Chloroplast En	98.86
PLN03127		447	Elongation factor Tu; Provisional	98.86
cd01863		161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	98.86
cd04113		161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	98.86
cd04137		180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	98.86
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	98.85
COG1341		398	Predicted GTPase or GTP-binding protein [General f	98.85
smart00177		175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	98.85
cd04161		167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	98.85
cd01866		168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	98.84
cd04136		163	Rap_like Rap-like subfamily. The Rap subfamily con	98.84
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	98.84
CHL00071		409	tufA elongation factor Tu	98.84
TIGR00437		591	feoB ferrous iron transporter FeoB. FeoB (773 amin	98.83
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	98.83
PRK00049		396	elongation factor Tu; Reviewed	98.83
cd02034		116	CooC The accessory protein CooC, which contains a	98.83
cd01883		219	EF1_alpha Eukaryotic elongation factor 1 (EF1) alp	98.82
cd01868		165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	98.82
cd01867		167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	98.82
PRK12735		396	elongation factor Tu; Reviewed	98.82
cd04149		168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	98.82
TIGR00491		590	aIF-2 translation initiation factor aIF-2/yIF-2. T	98.82
PLN03118		211	Rab family protein; Provisional	98.82
PRK12736		394	elongation factor Tu; Reviewed	98.82
COG0523		323	Putative GTPases (G3E family) [General function pr	98.81
cd04114		169	Rab30 Rab30 subfamily. Rab30 appears to be associa	98.81
cd04147		198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	98.81
cd04135		174	Tc10 TC10 subfamily. TC10 is a Rho family protein	98.8
cd01865		165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	98.8
cd04101		164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	98.8
cd01893		166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	98.79
cd00157		171	Rho Rho (Ras homology) family. Members of the Rho	98.78
PRK12317		425	elongation factor 1-alpha; Reviewed	98.78
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	98.78
cd04152		183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	98.77
cd04110		199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	98.76
cd04150		159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	98.76
cd04106		162	Rab23_lke Rab23-like subfamily. Rab23 is a member	98.76
cd04107		201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	98.76
TIGR00484		689	EF-G translation elongation factor EF-G. After pep	98.75
cd04124		161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	98.74
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	98.73
cd01870		175	RhoA_like RhoA-like subfamily. The RhoA subfamily	98.73
cd04140		165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	98.73
TIGR00485		394	EF-Tu translation elongation factor TU. This align	98.73
TIGR00487		587	IF-2 translation initiation factor IF-2. This mode	98.73
COG1163		365	DRG Predicted GTPase [General function prediction	98.72
PRK04004		586	translation initiation factor IF-2; Validated	98.72
TIGR01394		594	TypA_BipA GTP-binding protein TypA/BipA. This bact	98.72
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	98.72
cd04144		190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	98.72
smart00174		174	RHO Rho (Ras homology) subfamily of Ras-like small	98.72
PRK11537		318	putative GTP-binding protein YjiA; Provisional	98.72
PRK05124		474	cysN sulfate adenylyltransferase subunit 1; Provis	98.71
TIGR01393		595	lepA GTP-binding protein LepA. LepA (GUF1 in Sacca	98.71
PTZ00133		182	ADP-ribosylation factor; Provisional	98.71
CHL00189		742	infB translation initiation factor 2; Provisional	98.7
PRK00741		526	prfC peptide chain release factor 3; Provisional	98.7
PLN00223		181	ADP-ribosylation factor; Provisional	98.7
cd04175		164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	98.69
PRK05433		600	GTP-binding protein LepA; Provisional	98.69
PRK10218		607	GTP-binding protein; Provisional	98.68
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	98.68
PRK00007		693	elongation factor G; Reviewed	98.68
cd04127		180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	98.68
PRK05306		787	infB translation initiation factor IF-2; Validated	98.68
TIGR02034		406	CysN sulfate adenylyltransferase, large subunit. H	98.68
COG0455		262	flhG Antiactivator of flagellar biosynthesis FleN,	98.67
cd04112		191	Rab26 Rab26 subfamily. First identified in rat pan	98.67
cd01892		169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	98.67
TIGR00475		581	selB selenocysteine-specific elongation factor Sel	98.66
cd04148		221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	98.66
PTZ00369		189	Ras-like protein; Provisional	98.66
cd04122		166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	98.65
cd00877		166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	98.65
TIGR00993		763	3a0901s04IAP86 chloroplast protein import componen	98.65
cd04109		215	Rab28 Rab28 subfamily. First identified in maize,	98.64
cd04116		170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	98.64
KOG1489		366	consensus Predicted GTP-binding protein (ODN super	98.64
TIGR00503		527	prfC peptide chain release factor 3. This translat	98.64
cd04176		163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	98.64
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	98.64
cd04125		188	RabA_like RabA-like subfamily. RabA was first iden	98.63
cd04118		193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	98.63
PRK10512		614	selenocysteinyl-tRNA-specific translation factor;	98.62
cd04177		168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	98.62
TIGR03680		406	eif2g_arch translation initiation factor 2 subunit	98.6
cd04132		187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	98.59
cd04146		165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	98.59
cd04130		173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	98.59
PRK12739		691	elongation factor G; Reviewed	98.58
cd04167		213	Snu114p Snu114p subfamily. Snu114p is one of sever	98.58
cd04162		164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	98.58
cd04115		170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	98.58
PF13614		157	AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ	98.58
cd01882		225	BMS1 Bms1. Bms1 is an essential, evolutionarily co	98.58
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	98.57
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	98.56
cd04111		211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	98.56
PF02881		75	SRP54_N: SRP54-type protein, helical bundle domain	98.56
cd04126		220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	98.56
PTZ00141		446	elongation factor 1- alpha; Provisional	98.55
TIGR00483		426	EF-1_alpha translation elongation factor EF-1 alph	98.53
KOG1533		290	consensus Predicted GTPase [General function predi	98.52
PLN03110		216	Rab GTPase; Provisional	98.52
TIGR02475		341	CobW cobalamin biosynthesis protein CobW. A broade	98.51
cd01850		276	CDC_Septin CDC/Septin. Septins are a conserved fam	98.5
PLN03108		210	Rab family protein; Provisional	98.49
cd01885		222	EF2 EF2 (for archaea and eukarya). Translocation r	98.49
PRK04000		411	translation initiation factor IF-2 subunit gamma;	98.48
cd04134		189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	98.48
KOG3022		300	consensus Predicted ATPase, nucleotide-binding [Ce	98.48
COG0536		369	Obg Predicted GTPase [General function prediction	98.47
PF00350		168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	98.47
smart00382		148	AAA ATPases associated with a variety of cellular	98.47
cd04105		203	SR_beta Signal recognition particle receptor, beta	98.46
cd04141		172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	98.46
PRK12740		668	elongation factor G; Reviewed	98.45
cd04143		247	Rhes_like Rhes_like subfamily. This subfamily incl	98.44
cd04117		161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	98.44
PF04548		212	AIG1: AIG1 family; InterPro: IPR006703 This entry	98.43
COG3596		296	Predicted GTPase [General function prediction only	98.43
cd04120		202	Rab12 Rab12 subfamily. Rab12 was first identified	98.42
cd01899		318	Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg	98.42
cd04108		170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	98.42
TIGR00347		166	bioD dethiobiotin synthase. Dethiobiotin synthase	98.41
PRK09602		396	translation-associated GTPase; Reviewed	98.41
KOG0462		650	consensus Elongation factor-type GTP-binding prote	98.41
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	98.4
PLN03071		219	GTP-binding nuclear protein Ran; Provisional	98.4
PRK13351		687	elongation factor G; Reviewed	98.39
cd01871		174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	98.39
PLN00043		447	elongation factor 1-alpha; Provisional	98.39
cd01874		175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	98.39
TIGR02836		492	spore_IV_A stage IV sporulation protein A. A compa	98.39
PF09439		181	SRPRB: Signal recognition particle receptor beta s	98.37
cd04173		222	Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb	98.37
PF00142		273	Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot	98.35
KOG0410		410	consensus Predicted GTP binding protein [General f	98.35
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	98.35
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	98.35
KOG1490		620	consensus GTP-binding protein CRFG/NOG1 (ODN super	98.34
cd04128		182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	98.33
cd04131		178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	98.33
PLN03126		478	Elongation factor Tu; Provisional	98.32
COG1217		603	TypA Predicted membrane GTPase involved in stress	98.31
cd04174		232	Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb	98.3
cd04172		182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	98.29
cd04121		189	Rab40 Rab40 subfamily. This subfamily contains Rab	98.28
cd01900		274	YchF YchF subfamily. YchF is a member of the Obg f	98.27
PTZ00327		460	eukaryotic translation initiation factor 2 gamma s	98.27
cd04129		187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	98.26
cd01875		191	RhoG RhoG subfamily. RhoG is a GTPase with high se	98.26
COG1149		284	MinD superfamily P-loop ATPase containing an inser	98.25
PF05049		376	IIGP: Interferon-inducible GTPase (IIGP); InterPro	98.25
PTZ00258		390	GTP-binding protein; Provisional	98.24
PRK12337		475	2-phosphoglycerate kinase; Provisional	98.24
PRK13886		241	conjugal transfer protein TraL; Provisional	98.21
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	98.21
PRK09601		364	GTP-binding protein YchF; Reviewed	98.21
PRK04220		301	2-phosphoglycerate kinase; Provisional	98.21
COG4917		148	EutP Ethanolamine utilization protein [Amino acid	98.19
TIGR00490		720	aEF-2 translation elongation factor aEF-2. This mo	98.18
COG1100		219	GTPase SAR1 and related small G proteins [General	98.18
KOG2743		391	consensus Cobalamin synthesis protein [Coenzyme tr	98.16
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	98.16
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	98.15
COG2229		187	Predicted GTPase [General function prediction only	98.15
PRK04296		190	thymidine kinase; Provisional	98.15
PRK07560		731	elongation factor EF-2; Reviewed	98.12
PRK00090		222	bioD dithiobiotin synthetase; Reviewed	98.11
cd04178		172	Nucleostemin_like Nucleostemin-like. Nucleostemin	98.1
COG1348		278	NifH Nitrogenase subunit NifH (ATPase) [Inorganic	98.1
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	98.09
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	98.08
COG0480		697	FusA Translation elongation factors (GTPases) [Tra	98.08
PTZ00416		836	elongation factor 2; Provisional	98.06
TIGR02237		209	recomb_radB DNA repair and recombination protein R	98.05
PRK06067		234	flagellar accessory protein FlaH; Validated	98.05
smart00176		200	RAN Ran (Ras-related nuclear proteins) /TC4 subfam	98.05
KOG1145		683	consensus Mitochondrial translation initiation fac	98.0
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	98.0
PLN00116		843	translation elongation factor EF-2 subunit; Provis	98.0
PRK00889		175	adenylylsulfate kinase; Provisional	97.99
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	97.98
PF00071		162	Ras: Ras family; InterPro: IPR001806 Small GTPases	97.98
cd04133		176	Rop_like Rop subfamily. The Rop (Rho-related prote	97.97
PRK08533		230	flagellar accessory protein FlaH; Reviewed	97.96
cd01851		224	GBP Guanylate-binding protein (GBP), N-terminal do	97.96
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	97.95
COG5256		428	TEF1 Translation elongation factor EF-1alpha (GTPa	97.95
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	97.95
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	97.94
cd01855		190	YqeH YqeH. YqeH is an essential GTP-binding protei	97.94
cd03109		134	DTBS Dethiobiotin synthetase (DTBS) is the penulti	97.93
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.92
cd01394		218	radB RadB. The archaeal protein radB shares simila	97.92
KOG1534		273	consensus Putative transcription factor FET5 [Tran	97.92
PRK06762		166	hypothetical protein; Provisional	97.91
cd01857		141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	97.9
cd01849		155	YlqF_related_GTPase YlqF-related GTPases. These pr	97.89
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	97.88
PRK06526		254	transposase; Provisional	97.88
cd04103		158	Centaurin_gamma Centaurin gamma. The centaurins (a	97.88
PRK05541		176	adenylylsulfate kinase; Provisional	97.86
PRK09563		287	rbgA GTPase YlqF; Reviewed	97.85
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	97.85
PRK04328		249	hypothetical protein; Provisional	97.85
TIGR03596		276	GTPase_YlqF ribosome biogenesis GTP-binding protei	97.84
PF13500		199	AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R	97.83
PHA02542		473	41 41 helicase; Provisional	97.82
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	97.82
TIGR00313		475	cobQ cobyric acid synthase CobQ.	97.82
COG0532		509	InfB Translation initiation factor 2 (IF-2; GTPase	97.8
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	97.8
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	97.8
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	97.8
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	97.79
PRK06696		223	uridine kinase; Validated	97.79
COG1161		322	Predicted GTPases [General function prediction onl	97.79
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	97.79
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	97.78
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	97.78
COG0481		603	LepA Membrane GTPase LepA [Cell envelope biogenesi	97.78
COG5019		373	CDC3 Septin family protein [Cell division and chro	97.78
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.77
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	97.76
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	97.75
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	97.74
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	97.74
COG4108		528	PrfC Peptide chain release factor RF-3 [Translatio	97.74
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	97.72
PRK07667		193	uridine kinase; Provisional	97.71
cd01873		195	RhoBTB RhoBTB subfamily. Members of the RhoBTB sub	97.7
PF00735		281	Septin: Septin; InterPro: IPR000038 Septins consti	97.7
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	97.7
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	97.69
KOG0094		221	consensus GTPase Rab6/YPT6/Ryh1, small G protein s	97.68
COG4240		300	Predicted kinase [General function prediction only	97.68
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	97.68
PRK07952		244	DNA replication protein DnaC; Validated	97.67
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	97.67
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	97.65
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	97.65
PRK12289		352	GTPase RsgA; Reviewed	97.64
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	97.64
PRK11823		446	DNA repair protein RadA; Provisional	97.62
PRK08233		182	hypothetical protein; Provisional	97.62
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.62
PRK08760		476	replicative DNA helicase; Provisional	97.61
KOG2749		415	consensus mRNA cleavage and polyadenylation factor	97.61
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	97.61
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	97.6
PRK05632		684	phosphate acetyltransferase; Reviewed	97.6
cd00983		325	recA RecA is a bacterial enzyme which has roles in	97.6
PRK15453		290	phosphoribulokinase; Provisional	97.6
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	97.59
PRK05439		311	pantothenate kinase; Provisional	97.59
PF13245		76	AAA_19: Part of AAA domain	97.59
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	97.59
TIGR00665		434	DnaB replicative DNA helicase. This model describe	97.59
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	97.58
PRK04040		188	adenylate kinase; Provisional	97.57
PRK12288		347	GTPase RsgA; Reviewed	97.56
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	97.56
cd03116		159	MobB Molybdenum is an essential trace element in t	97.56
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	97.56
PHA00729		226	NTP-binding motif containing protein	97.55
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	97.55
PRK13796		365	GTPase YqeH; Provisional	97.54
PLN02796		347	D-glycerate 3-kinase	97.54
cd01856		171	YlqF YlqF. Proteins of the YlqF family contain all	97.53
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	97.53
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	97.52
PRK05973		237	replicative DNA helicase; Provisional	97.51
cd04102		202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	97.51
PRK05480		209	uridine/cytidine kinase; Provisional	97.51
PRK00411		394	cdc6 cell division control protein 6; Reviewed	97.51
KOG2825		323	consensus Putative arsenite-translocating ATPase [	97.5
PRK06893		229	DNA replication initiation factor; Validated	97.5
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	97.49
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	97.49
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.48
PRK05595		444	replicative DNA helicase; Provisional	97.48
TIGR00157		245	ribosome small subunit-dependent GTPase A. The Aqu	97.48
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	97.47
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	97.46
PRK12374		231	putative dithiobiotin synthetase; Provisional	97.45
COG0050		394	TufB GTPases - translation elongation factors [Tra	97.45
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	97.44
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	97.44
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	97.44
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	97.43
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	97.41
COG1162		301	Predicted GTPases [General function prediction onl	97.41
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	97.41
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	97.4
cd01859		156	MJ1464 MJ1464. This family represents archaeal GTP	97.4
PRK08506		472	replicative DNA helicase; Provisional	97.4
PRK13695		174	putative NTPase; Provisional	97.4
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	97.39
PRK08181		269	transposase; Validated	97.39
KOG2485		335	consensus Conserved ATP/GTP binding protein [Gener	97.38
PRK05748		448	replicative DNA helicase; Provisional	97.37
PF00004		132	AAA: ATPase family associated with various cellula	97.37
PRK08727		233	hypothetical protein; Validated	97.36
PTZ00035		337	Rad51 protein; Provisional	97.36
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	97.36
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	97.36
PHA02530		300	pseT polynucleotide kinase; Provisional	97.36
PRK06835		329	DNA replication protein DnaC; Validated	97.36

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

Probab=100.00  E-value=1.9e-117  Score=905.84  Aligned_cols=430  Identities=41%  Similarity=0.662  Sum_probs=414.8

Q ss_pred             hhHHHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHHHHHHcCcChHHHHHHHHHHHHhhchhhhhcCCChHHHHHHHHHH
Q 011076            2 VLAQLGGSISRAIQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVREMQTNIKKIVNLDDLAAGHNKRRIIQQAIFN   81 (494)
Q Consensus         2 ~~~~l~~~l~~~~~~l~~~~~~~e~~i~~~l~ei~~aLl~adv~~~~v~~~~~~v~~~~~~~~~~~~~~~~~~i~~~v~~   81 (494)
                      ||++|+++|++++++|+|++++||++|+++++|||++||+||||+++|++|+++|++++.+++++++++|+++++++|++
T Consensus         1 m~e~L~~~l~~~l~kl~g~~~i~E~~i~e~~reir~ALLeADVnl~vVk~fi~~ikera~g~ev~~~l~p~q~~iKiV~e   80 (451)
T COG0541           1 MFESLSDRLSNALKKLRGKGRITEKDVKEALREIRRALLEADVNLKVVKDFIKRIKERALGEEVPKGLTPGQQFIKIVYE   80 (451)
T ss_pred             ChHHHHHHHHHHHHHhhCCCcCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHhccccCCCCCCHHHHHHHHHHH
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCCCCCCCCCCCCeEEEEEcCCCCcHHHHHHHHHHHHHhcCCceEEEEcccCcchhHHHHHhhhhccCcceec
Q 011076           82 ELCKMLDPGKPSFTPKKGKPSVIMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFRAGAFDQLKQNATKAKIPFYG  161 (494)
Q Consensus        82 eL~~ll~~~~~~~~~~~~~~~vI~lvG~~GvGKTTl~~kLA~~l~~~g~kVaiVs~D~~r~~a~~qLk~~~~~~~i~~~~  161 (494)
                      ||+++|+....++.+...+|.+|++||+|||||||||+|||+||+++|+||++|+||+|||||++||++++.+.++|||+
T Consensus        81 ELv~llG~~~~~~~l~~~~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q~~v~~f~  160 (451)
T COG0541          81 ELVKLLGGENSELNLAKKPPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFG  160 (451)
T ss_pred             HHHHHhCCCCcccccCCCCCeEEEEEeccCCChHhHHHHHHHHHHHcCCceEEEecccCChHHHHHHHHHHHHcCCceec
Confidence            99999998667777767789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCChHHHHHHHHHHHhccCCcEEEEeCCCCCchhHHHHHHHHHHHHhcCCCEEEEEecCCCcccHHHHHHHHhccCC
Q 011076          162 SYTESDPVRIAVEGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEATNPDLVIFVMDSSIGQAAFDQAQAFKQSVS  241 (494)
Q Consensus       162 ~~~~~dp~~i~~~~l~~~~~~~~dvIIIDTaG~~~~~~~l~~el~~i~~~~~~d~vllVvDa~~g~~~~~~~~~f~~~~~  241 (494)
                      ..++.+|++++++++++++.++|||||||||||++.++++++|+..+..+++||+++||+||++||++.+++++|++.++
T Consensus       161 ~~~~~~Pv~Iak~al~~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik~~~~P~E~llVvDam~GQdA~~~A~aF~e~l~  240 (451)
T COG0541         161 SGTEKDPVEIAKAALEKAKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVINPDETLLVVDAMIGQDAVNTAKAFNEALG  240 (451)
T ss_pred             CCCCCCHHHHHHHHHHHHHHcCCCEEEEeCCCcccccHHHHHHHHHHHhhcCCCeEEEEEecccchHHHHHHHHHhhhcC
Confidence            98889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEEeCccCCCCccchhHHHHhcCCCeEEeccccccccccccCccchhhcccCCCCchHHHHHHHHhCCCCCchHHHh
Q 011076          242 VGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQ  321 (494)
Q Consensus       242 i~~vVltK~D~~~~~g~~ls~~~~~g~Pi~fi~~Ge~i~~l~~f~p~~~vs~~~G~Gdi~~L~e~i~~~~~~~~~~~~~~  321 (494)
                      +++||+||+|+++++|++||+.+.||+||+|+|+||++++|++|+|++|+||++|+||+.+|+|++++.+++++++++.+
T Consensus       241 itGvIlTKlDGdaRGGaALS~~~~tg~PIkFiGtGEki~dLE~F~P~R~asRILGMGDv~sLvEk~~~~~d~e~a~~~~~  320 (451)
T COG0541         241 ITGVILTKLDGDARGGAALSARAITGKPIKFIGTGEKIDDLEPFHPDRFASRILGMGDVLSLIEKAEEVVDEEEAEKLAE  320 (451)
T ss_pred             CceEEEEcccCCCcchHHHhhHHHHCCCeEEEecCCCcccCCCcChHHHHHHhcCcccHHHHHHHHHHhhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999888999999


Q ss_pred             hhhcchhhHHHHHHHHHHHhccCChhHHhhcCCCCCCccCcchhhhhhHHhHHhHhHhhcCCCHHhhcCCCCCCcchHHH
Q 011076          322 KLSEGNFTLRIMYEQFQNILKMGPIGQVFSMLPGFSSELMPKGREKESQAKIKRYMTMMDSMTNEELDSSNPKLMNDSRI  401 (494)
Q Consensus       322 ~~~~~~f~~~d~~~ql~~~~~~g~~~~~~~~lPg~~~~~~~~~~~~~~~~~~~~~~~ii~smt~~er~~~~~~~i~~sr~  401 (494)
                      ++.+|+|||+||++|+++|+||||+++|++||||++ ...+....+.++++++||+|||+|||++||+||  .+|++||+
T Consensus       321 kl~~g~FtL~Df~~Ql~~m~kmGpl~~ll~miPG~~-~~~~~~~~~~~e~~~kr~~aIi~SMT~~Er~nP--~ii~~SR~  397 (451)
T COG0541         321 KLKKGKFTLEDFLEQLEQMKKMGPLSKLLSMIPGMG-MKDSDKDIELDEKKLKRIEAIIDSMTPEERENP--DIINASRK  397 (451)
T ss_pred             HHHhCCCCHHHHHHHHHHHHccCCHHHHHHhCCCCC-CCCchhhhhccHHHHHHHHHHHHcCCHHHhhCc--cccChHHH
Confidence            999999999999999999999999999999999997 222222234578999999999999999999996  88999999


Q ss_pred             HHHHhhcCCCHHHHHHHHHHHHHHHHHHHHhcC
Q 011076          402 MRIARGSGRQVREVMEMLEEYKRLAKIWSKMKG  434 (494)
Q Consensus       402 ~rIa~gsg~~~~~v~~ll~~~~~~~~~~~~~~~  434 (494)
                      +|||+||||+++|||+||+||++|++|||+|++
T Consensus       398 rRIA~GSG~sv~dVn~Llkq~~~m~~mmk~m~~  430 (451)
T COG0541         398 RRIARGSGTSVQDVNKLLKQFKQMKKMMKKMSG  430 (451)
T ss_pred             HHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHhC
Confidence            999999999999999999999999999999987

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PF02978 SRP_SPB: Signal peptide binding domain; InterPro: IPR004125 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1159 Era GTPase [General function prediction only]	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR00436 era GTP-binding protein Era	Back alignment and domain information

>PRK00089 era GTPase Era; Reviewed	Back alignment and domain information

>PRK15494 era GTPase Era; Provisional	Back alignment and domain information

>COG0486 ThdF Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>COG1160 Predicted GTPases [General function prediction only]	Back alignment and domain information

>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03156 GTP_HflX GTP-binding protein HflX	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions	Back alignment and domain information

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK12298 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>cd01894 EngA1 EngA1 subfamily	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>PHA02518 ParA-like protein; Provisional	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PRK11058 GTPase HflX; Provisional	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>cd01895 EngA2 EngA2 subfamily	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK03003 GTP-binding protein Der; Reviewed	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PRK13849 putative crown gall tumor protein VirC1; Provisional	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>cd00881 GTP_translation_factor GTP translation factor family	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>TIGR01007 eps_fam capsular exopolysaccharide family	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>PRK00093 GTP-binding protein Der; Reviewed	Back alignment and domain information

>smart00053 DYNc Dynamin, GTPase	Back alignment and domain information

>PRK15467 ethanolamine utilization protein EutP; Provisional	Back alignment and domain information

>cd01898 Obg Obg subfamily	Back alignment and domain information

>TIGR01969 minD_arch cell division ATPase MinD, archaeal	Back alignment and domain information

>cd03110 Fer4_NifH_child This protein family's function is unkown	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK09866 hypothetical protein; Provisional	Back alignment and domain information

>PRK11670 antiporter inner membrane protein; Provisional	Back alignment and domain information

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>PRK09554 feoB ferrous iron transport protein B; Reviewed	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell	Back alignment and domain information

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase	Back alignment and domain information

>PRK12299 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd01890 LepA LepA subfamily	Back alignment and domain information

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein	Back alignment and domain information

>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins	Back alignment and domain information

>PRK12296 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG	Back alignment and domain information

>cd04171 SelB SelB subfamily	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB	Back alignment and domain information

>PRK04213 GTP-binding protein; Provisional	Back alignment and domain information

>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA)	Back alignment and domain information

>TIGR02528 EutP ethanolamine utilization protein, EutP	Back alignment and domain information

>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring	Back alignment and domain information

>cd04168 TetM_like Tet(M)-like subfamily	Back alignment and domain information

>COG2262 HflX GTPases [General function prediction only]	Back alignment and domain information

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans	Back alignment and domain information

>cd01884 EF_Tu EF-Tu subfamily	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd01886 EF-G Elongation factor G (EF-G) subfamily	Back alignment and domain information

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04166 CysN_ATPS CysN_ATPS subfamily	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>PRK12297 obgE GTPase CgtA; Reviewed	Back alignment and domain information

>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily	Back alignment and domain information

>PRK13869 plasmid-partitioning protein RepA; Provisional	Back alignment and domain information

>PRK13233 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR02729 Obg_CgtA Obg family GTPase CgtA	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PRK10037 cell division protein; Provisional	Back alignment and domain information

>PRK00454 engB GTP-binding protein YsxC; Reviewed	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>COG0218 Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR01968 minD_bact septum site-determining protein MinD	Back alignment and domain information

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>PRK13705 plasmid-partitioning protein SopA; Provisional	Back alignment and domain information

>cd04165 GTPBP1_like GTPBP1-like	Back alignment and domain information

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily	Back alignment and domain information

>cd01889 SelB_euk SelB subfamily	Back alignment and domain information

>cd04157 Arl6 Arl6 subfamily	Back alignment and domain information

>cd01864 Rab19 Rab19 subfamily	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>cd04154 Arl2 Arl2 subfamily	Back alignment and domain information

>TIGR03453 partition_RepA plasmid partitioning protein RepA	Back alignment and domain information

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon	Back alignment and domain information

>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation	Back alignment and domain information

>cd04142 RRP22 RRP22 subfamily	Back alignment and domain information

>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases	Back alignment and domain information

>cd04169 RF3 RF3 subfamily	Back alignment and domain information

>cd01861 Rab6 Rab6 subfamily	Back alignment and domain information

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily	Back alignment and domain information

>PHA02519 plasmid partition protein SopA; Reviewed	Back alignment and domain information

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd04104 p47_IIGP_like p47 (47-kDa) family	Back alignment and domain information

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2)	Back alignment and domain information

>PRK13231 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>cd00879 Sar1 Sar1 subfamily	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>cd04158 ARD1 ARD1 subfamily	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd01860 Rab5_related Rab5-related subfamily	Back alignment and domain information

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily	Back alignment and domain information

>cd04151 Arl1 Arl1 subfamily	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase)	Back alignment and domain information

>PLN03127 Elongation factor Tu; Provisional	Back alignment and domain information

>cd01863 Rab18 Rab18 subfamily	Back alignment and domain information

>cd04113 Rab4 Rab4 subfamily	Back alignment and domain information

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor	Back alignment and domain information

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily	Back alignment and domain information

>cd01866 Rab2 Rab2 subfamily	Back alignment and domain information

>cd04136 Rap_like Rap-like subfamily	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>CHL00071 tufA elongation factor Tu	Back alignment and domain information

>TIGR00437 feoB ferrous iron transporter FeoB	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>PRK00049 elongation factor Tu; Reviewed	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily	Back alignment and domain information

>cd01868 Rab11_like Rab11-like	Back alignment and domain information

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2	Back alignment and domain information

>PRK12735 elongation factor Tu; Reviewed	Back alignment and domain information

>cd04149 Arf6 Arf6 subfamily	Back alignment and domain information

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2	Back alignment and domain information

>PLN03118 Rab family protein; Provisional	Back alignment and domain information

>PRK12736 elongation factor Tu; Reviewed	Back alignment and domain information

>COG0523 Putative GTPases (G3E family) [General function prediction only]	Back alignment and domain information

>cd04114 Rab30 Rab30 subfamily	Back alignment and domain information

>cd04147 Ras_dva Ras-dva subfamily	Back alignment and domain information

>cd04135 Tc10 TC10 subfamily	Back alignment and domain information

>cd01865 Rab3 Rab3 subfamily	Back alignment and domain information

>cd04101 RabL4 RabL4 (Rab-like4) subfamily	Back alignment and domain information

>cd01893 Miro1 Miro1 subfamily	Back alignment and domain information

>cd00157 Rho Rho (Ras homology) family	Back alignment and domain information

>PRK12317 elongation factor 1-alpha; Reviewed	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily	Back alignment and domain information

>cd04110 Rab35 Rab35 subfamily	Back alignment and domain information

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily	Back alignment and domain information

>cd04106 Rab23_lke Rab23-like subfamily	Back alignment and domain information

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily	Back alignment and domain information

>TIGR00484 EF-G translation elongation factor EF-G	Back alignment and domain information

>cd04124 RabL2 RabL2 subfamily	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>cd01870 RhoA_like RhoA-like subfamily	Back alignment and domain information

>cd04140 ARHI_like ARHI subfamily	Back alignment and domain information

>TIGR00485 EF-Tu translation elongation factor TU	Back alignment and domain information

>TIGR00487 IF-2 translation initiation factor IF-2	Back alignment and domain information

>COG1163 DRG Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK04004 translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>cd04144 Ras2 Ras2 subfamily	Back alignment and domain information

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases	Back alignment and domain information

>PRK11537 putative GTP-binding protein YjiA; Provisional	Back alignment and domain information

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional	Back alignment and domain information

>TIGR01393 lepA GTP-binding protein LepA	Back alignment and domain information

>PTZ00133 ADP-ribosylation factor; Provisional	Back alignment and domain information

>CHL00189 infB translation initiation factor 2; Provisional	Back alignment and domain information

>PRK00741 prfC peptide chain release factor 3; Provisional	Back alignment and domain information

>PLN00223 ADP-ribosylation factor; Provisional	Back alignment and domain information

>cd04175 Rap1 Rap1 subgroup	Back alignment and domain information

>PRK05433 GTP-binding protein LepA; Provisional	Back alignment and domain information

>PRK10218 GTP-binding protein; Provisional	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>PRK00007 elongation factor G; Reviewed	Back alignment and domain information

>cd04127 Rab27A Rab27a subfamily	Back alignment and domain information

>PRK05306 infB translation initiation factor IF-2; Validated	Back alignment and domain information

>TIGR02034 CysN sulfate adenylyltransferase, large subunit	Back alignment and domain information

>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]	Back alignment and domain information

>cd04112 Rab26 Rab26 subfamily	Back alignment and domain information

>cd01892 Miro2 Miro2 subfamily	Back alignment and domain information

>TIGR00475 selB selenocysteine-specific elongation factor SelB	Back alignment and domain information

>cd04148 RGK RGK subfamily	Back alignment and domain information

>PTZ00369 Ras-like protein; Provisional	Back alignment and domain information

>cd04122 Rab14 Rab14 subfamily	Back alignment and domain information

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains	Back alignment and domain information

>cd04109 Rab28 Rab28 subfamily	Back alignment and domain information

>cd04116 Rab9 Rab9 subfamily	Back alignment and domain information

>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]	Back alignment and domain information

>TIGR00503 prfC peptide chain release factor 3	Back alignment and domain information

>cd04176 Rap2 Rap2 subgroup	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>cd04125 RabA_like RabA-like subfamily	Back alignment and domain information

>cd04118 Rab24 Rab24 subfamily	Back alignment and domain information

>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional	Back alignment and domain information

>cd04177 RSR1 RSR1 subgroup	Back alignment and domain information

>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma	Back alignment and domain information

>cd04132 Rho4_like Rho4-like subfamily	Back alignment and domain information

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily	Back alignment and domain information

>cd04130 Wrch_1 Wrch-1 subfamily	Back alignment and domain information

>PRK12739 elongation factor G; Reviewed	Back alignment and domain information

>cd04167 Snu114p Snu114p subfamily	Back alignment and domain information

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily	Back alignment and domain information

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily	Back alignment and domain information

>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D	Back alignment and domain information

>cd01882 BMS1 Bms1	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>cd04111 Rab39 Rab39 subfamily	Back alignment and domain information

>PF02881 SRP54_N: SRP54-type protein, helical bundle domain; InterPro: IPR013822 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd04126 Rab20 Rab20 subfamily	Back alignment and domain information

>PTZ00141 elongation factor 1- alpha; Provisional	Back alignment and domain information

>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PLN03110 Rab GTPase; Provisional	Back alignment and domain information

>TIGR02475 CobW cobalamin biosynthesis protein CobW	Back alignment and domain information

>cd01850 CDC_Septin CDC/Septin	Back alignment and domain information

>PLN03108 Rab family protein; Provisional	Back alignment and domain information

>cd01885 EF2 EF2 (for archaea and eukarya)	Back alignment and domain information

>PRK04000 translation initiation factor IF-2 subunit gamma; Validated	Back alignment and domain information

>cd04134 Rho3 Rho3 subfamily	Back alignment and domain information

>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG0536 Obg Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta)	Back alignment and domain information

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily	Back alignment and domain information

>PRK12740 elongation factor G; Reviewed	Back alignment and domain information

>cd04143 Rhes_like Rhes_like subfamily	Back alignment and domain information

>cd04117 Rab15 Rab15 subfamily	Back alignment and domain information

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria	Back alignment and domain information

>COG3596 Predicted GTPase [General function prediction only]	Back alignment and domain information

>cd04120 Rab12 Rab12 subfamily	Back alignment and domain information

>cd01899 Ygr210 Ygr210 subfamily	Back alignment and domain information

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily	Back alignment and domain information

>TIGR00347 bioD dethiobiotin synthase	Back alignment and domain information

>PRK09602 translation-associated GTPase; Reviewed	Back alignment and domain information

>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PLN03071 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK13351 elongation factor G; Reviewed	Back alignment and domain information

>cd01871 Rac1_like Rac1-like subfamily	Back alignment and domain information

>PLN00043 elongation factor 1-alpha; Provisional	Back alignment and domain information

>cd01874 Cdc42 Cdc42 subfamily	Back alignment and domain information

>TIGR02836 spore_IV_A stage IV sporulation protein A	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily	Back alignment and domain information

>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family	Back alignment and domain information

>KOG0410 consensus Predicted GTP binding protein [General function prediction only]	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only]	Back alignment and domain information

>cd04128 Spg1 Spg1p	Back alignment and domain information

>cd04131 Rnd Rnd subfamily	Back alignment and domain information

>PLN03126 Elongation factor Tu; Provisional	Back alignment and domain information

>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]	Back alignment and domain information

>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily	Back alignment and domain information

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily	Back alignment and domain information

>cd04121 Rab40 Rab40 subfamily	Back alignment and domain information

>cd01900 YchF YchF subfamily	Back alignment and domain information

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional	Back alignment and domain information

>cd04129 Rho2 Rho2 subfamily	Back alignment and domain information

>cd01875 RhoG RhoG subfamily	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence	Back alignment and domain information

>PTZ00258 GTP-binding protein; Provisional	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK13886 conjugal transfer protein TraL; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK09601 GTP-binding protein YchF; Reviewed	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00490 aEF-2 translation elongation factor aEF-2	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>COG2229 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK07560 elongation factor EF-2; Reviewed	Back alignment and domain information

>PRK00090 bioD dithiobiotin synthetase; Reviewed	Back alignment and domain information

>cd04178 Nucleostemin_like Nucleostemin-like	Back alignment and domain information

>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00416 elongation factor 2; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases	Back alignment and domain information

>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PLN00116 translation elongation factor EF-2 subunit; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>cd04133 Rop_like Rop subfamily	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>cd01855 YqeH YqeH	Back alignment and domain information

>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>cd01857 HSR1_MMR1 HSR1/MMR1	Back alignment and domain information

>cd01849 YlqF_related_GTPase YlqF-related GTPases	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>cd04103 Centaurin_gamma Centaurin gamma	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK09563 rbgA GTPase YlqF; Reviewed	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF	Back alignment and domain information

>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>COG1161 Predicted GTPases [General function prediction only]	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>cd01873 RhoBTB RhoBTB subfamily	Back alignment and domain information

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK12289 GTPase RsgA; Reviewed	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification]	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK05632 phosphate acetyltransferase; Reviewed	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PRK12288 GTPase RsgA; Reviewed	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13796 GTPase YqeH; Provisional	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>cd01856 YlqF YlqF	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>cd04102 RabL3 RabL3 (Rab-like3) subfamily	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00157 ribosome small subunit-dependent GTPase A	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK12374 putative dithiobiotin synthetase; Provisional	Back alignment and domain information

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>COG1162 Predicted GTPases [General function prediction only]	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>cd01859 MJ1464 MJ1464	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only]	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

Homologous Structure Templates