Citrus Sinensis ID: 011151


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQARRRESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELYID
cHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHccEEEEEccccccccccccccccEEEEEEEEEccccccccccccccccccEEEEEccccccccccccHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEcccccccccccccccccccccccccEEEcccccccccHHHHHccccccEEEEccccccccHHHHHHHccccccccccEEEEEEccccccHHHHHHHcHHHHHHccccccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccHHHHHHccccccccccccccccEEEc
ccHHHHHHHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEEEccccccccHccHcHcccccccEEEEccccccccccccHHHHccccccEEEEEcccccccccccHHcccccccccccccEEEcccccccccccHHHcccccccEEEEcccccHHcccHHHcccccccEEEEcccccHccccccccccccccEEEEEEccccccccccHHHHHcHHHHccEEccccccccccHHHHHccccccccccEEEccccccccccHHHcccccHHHHHHHccccccccEEEEEccccccccccccHcccccccEEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccccccccccccccEEEEcccccHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHHHHcccccccccccccEEEEc
MEDIGEEYFNILAsrsffqdfdkdddgeistckmHDIVHDFAQYLcsnecltvevhsgeelainSFGEKKILHLLLTLhrgasvpisiwgnvkglRGLRSLLVesddyswfsevLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNlerlnitscnhlrelpQGIGKLRKLmyldnddtwflRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRecsirglggvsdaGEARRAELEKKKNLVELGLHFDRLRDGDEEQARRRESERLLealgpppnlkelvideyrgrrnvvprnwVMSLTNLRALLLKNcrncehlpplgklpsleslYIEGMQSVKRVGNeflgvesdtdgssiiafpklkhlkfydmeeleewdfgtaikgeiiimprlsfleisgccklkalpdLLLQKTTLQKLLigrcpileercrketgedwpnirhipelyid
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGydrarslgslkklnllrecsirglggvsdageaRRAELEkkknlvelglhfdrlrdgdeeQARRRESErllealgpppnlkelvideyrgrrnvvprnwvMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGvesdtdgssiiafpklkhLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTtlqklligrcpileercrketgedwpnirhipelyid
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDeeqarrreserllealGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDlllqkttlqkllIGRCPILEERCRKETGEDWPNIRHIPELYID
******EYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGV****************LVELGLHF****************************LKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELY**
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVH*********FGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLR***********SERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELYID
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDG**********ERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELYID
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQARRRESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELYID
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEELAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQARRRESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCRKETGEDWPNIRHIPELYID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query492 2.2.26 [Sep-21-2011]
Q9LRR5 1424 Putative disease resistan yes no 0.878 0.303 0.300 5e-34
Q7XBQ9970 Disease resistance protei N/A no 0.863 0.438 0.278 1e-32
Q7XA42 979 Putative disease resistan N/A no 0.695 0.349 0.302 5e-32
Q9LRR4 1054 Putative disease resistan no no 0.884 0.412 0.294 2e-31
Q7XA40 992 Putative disease resistan N/A no 0.766 0.380 0.301 2e-31
Q7XA39 988 Putative disease resistan N/A no 0.778 0.387 0.305 5e-30
Q38834852 Disease resistance RPP13- no no 0.593 0.342 0.262 3e-11
Q8W3K3910 Putative disease resistan no no 0.873 0.472 0.263 3e-09
P0C8S1906 Probable disease resistan no no 0.857 0.465 0.259 5e-09
Q39214926 Disease resistance protei no no 0.857 0.455 0.255 1e-08
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 144/479 (30%), Positives = 231/479 (48%), Gaps = 47/479 (9%)

Query: 1   MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEE 60
           +EDIG +Y   L ++SFFQ  D      +++  MHD+++D A+ +  + C  +E  +  E
Sbjct: 458 LEDIGNDYLGDLVAQSFFQRLDI----TMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPE 513

Query: 61  LAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFS-----EVL 115
           +   +           +  R        + ++ G   LR++L  +   S  S     +VL
Sbjct: 514 IPSTTRH--------FSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVL 565

Query: 116 PQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCE 175
             L + L+ LR L L   Q       I  +P +++ L  L+YL L   + I++LPE +C 
Sbjct: 566 NPLLNALSGLRILSLSHYQ-------ITNLPKSLKGLKLLRYLDLSSTK-IKELPEFVCT 617

Query: 176 LYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVV 235
           L NL+ L +++C  L  LP+ I +L  L  LD   T  +  +P GI +L +L++++ FV+
Sbjct: 618 LCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVE-MPPGIKKLRSLQKLSNFVI 676

Query: 236 GGGYDRARSLGSLKKLNLLR-ECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRD 294
           G        L  LK+L+ LR    I  L  V+ A EA+ A L++K  L  L L +     
Sbjct: 677 G--RLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGS 734

Query: 295 G---DEEQARRRESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWV--MSLTNLRALLL 349
           G       A   + + +L  L P P+LK   I+ Y+G     P+ W+   S   + ++ L
Sbjct: 735 GFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQG--GAFPK-WLGDSSFFGITSVTL 791

Query: 350 KNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFY 409
            +C  C  LPP+G+LPSL+ L IE    +++VG +F   E+++ G   + F  L+ LKFY
Sbjct: 792 SSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRG---VPFQSLQILKFY 848

Query: 410 DMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKL-KALPDLLLQKTTLQKLLIGRCPI 467
            M   +EW       G   I P L  L I  C  L K  P+ L   T   ++ I  CP+
Sbjct: 849 GMPRWDEWICPELEDG---IFPCLQKLIIQRCPSLRKKFPEGLPSST---EVTISDCPL 901




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
255549784 786 leucine-rich repeat containing protein, 0.957 0.599 0.437 3e-91
359482788 903 PREDICTED: putative disease resistance p 0.918 0.500 0.446 5e-90
147825450 927 hypothetical protein VITISV_000086 [Viti 0.924 0.490 0.447 8e-89
359482792 922 PREDICTED: putative disease resistance p 0.914 0.488 0.449 7e-86
359482790 923 PREDICTED: putative disease resistance p 0.918 0.489 0.439 1e-85
359482784 919 PREDICTED: putative disease resistance p 0.916 0.490 0.436 2e-85
359482769 904 PREDICTED: putative disease resistance p 0.922 0.502 0.430 2e-85
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.936 0.478 0.428 2e-85
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.936 0.519 0.417 7e-82
224118674 960 cc-nbs-lrr resistance protein [Populus t 0.957 0.490 0.419 8e-82
>gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  342 bits (877), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 218/498 (43%), Positives = 300/498 (60%), Gaps = 27/498 (5%)

Query: 1   MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEE 60
           ME IGE+Y + LA  SFF+   K D G + +CKM++IVHDFAQY+  NEC ++EV+  EE
Sbjct: 268 MERIGEKYLHNLAGHSFFEVVHKIDCGHVMSCKMYNIVHDFAQYIVKNECFSIEVNDEEE 327

Query: 61  LAINSFGEKKILHLLLTLHRGASVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFD 120
           L + S   K++ HL + L +  S P SI+     L+ LR+L V+    S     L  LF 
Sbjct: 328 LKMMSL-HKEVRHLRVMLGKDVSFPSSIYR----LKDLRTLWVQCKGNSKVGAALSNLFG 382

Query: 121 KLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLE 180
           +LTCLR+L L       C   + +IP++I KL+HL+ + L   ++++ LPE LCEL NL+
Sbjct: 383 RLTCLRSLNLSN-----CN--LAEIPSSICKLIHLRQIDLSYNKDLKGLPEALCELCNLQ 435

Query: 181 RLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYD 240
            LN+  C  L +LP+G+ KL  L +L N    F   LP GI +L  LR + +F +G    
Sbjct: 436 TLNMDGCFSLVKLPRGLEKLINLRHLHNGG--FEGVLPKGISKLTCLRSLNRFSIGQNNQ 493

Query: 241 RARSLGSLKKLNLLREC-SIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQ 299
            A +LG LK LN L+ C  I GL  V+D GEA++AEL KK  +  L L F +   GD E 
Sbjct: 494 EACNLGDLKNLNHLQGCLCIMGLEIVADVGEAKQAELRKKTEVTRLELRFGK---GDAEW 550

Query: 300 ARRRESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLP 359
            +  + E LL AL P P ++EL I +Y+GR  V P +W++ L+NL+ ++L NC+ CEHLP
Sbjct: 551 RKHHDDEILL-ALEPSPYVEELGIYDYQGR-TVFP-SWMIFLSNLKTVILTNCKTCEHLP 607

Query: 360 PLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEW-- 417
           PLGKLP LE+L I GM  V++ G EFLG+ES +  SS IAFPKL +L+F  M   E W  
Sbjct: 608 PLGKLPFLENLRIWGMDGVQKAGLEFLGLESSSSSSSGIAFPKLINLRFMRMRNWEVWAD 667

Query: 418 DF----GTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRCPILEERCR 473
           DF          +I IMP+L  L  + C KLKA+PD  L+K TLQ+L +   P L+   +
Sbjct: 668 DFIRMGDEEDSTKITIMPQLRSLSFAWCSKLKAVPDQFLRKATLQELTLTCSPELKRAYQ 727

Query: 474 KETGEDWPNIRHIPELYI 491
           K  G+DW  I HIP + I
Sbjct: 728 KGIGQDWHKISHIPNIKI 745




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118674|ref|XP_002317879.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222858552|gb|EEE96099.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.876 0.302 0.295 1.5e-31
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.800 0.373 0.282 1.7e-27
TAIR|locus:2146228 1245 AT5G18350 [Arabidopsis thalian 0.229 0.090 0.321 2.1e-10
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.434 0.235 0.278 2.2e-10
TAIR|locus:2098145 1240 AT3G44630 [Arabidopsis thalian 0.394 0.156 0.305 2.3e-10
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.441 0.239 0.261 6.4e-10
TAIR|locus:2163578771 AT5G45500 "AT5G45500" [Arabido 0.306 0.195 0.329 9.8e-10
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.274 0.177 0.281 6.6e-09
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.274 0.150 0.281 7.1e-09
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.209 0.114 0.288 1.8e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 360 (131.8 bits), Expect = 1.5e-31, P = 1.5e-31
 Identities = 142/480 (29%), Positives = 224/480 (46%)

Query:     1 MEDIGEEYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNECLTVEVHSGEE 60
             +EDIG +Y   L ++SFFQ  D      +++  MHD+++D A+ +  + C  +E  +  E
Sbjct:   458 LEDIGNDYLGDLVAQSFFQRLDIT----MTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPE 513

Query:    61 LAINSFGEKKILHLLLTLHR-GASVPISIWGNVKGLRGLRSLLVESDDYSWFS-----EV 114
             +   +       H   +  +  ASV      ++ G   LR++L  +   S  S     +V
Sbjct:   514 IPSTT------RHFSFSRSQCDASVAFR---SICGAEFLRTILPFNSPTSLESLQLTEKV 564

Query:   115 LPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLC 174
             L  L + L+ LR L L   Q       I  +P +++ L  L+YL L   + I++LPE +C
Sbjct:   565 LNPLLNALSGLRILSLSHYQ-------ITNLPKSLKGLKLLRYLDLSSTK-IKELPEFVC 616

Query:   175 ELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFV 234
              L NL+ L +++C  L  LP+ I +L  L  LD   T  +  +P GI +L +L++++ FV
Sbjct:   617 TLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVE-MPPGIKKLRSLQKLSNFV 675

Query:   235 VGGGYDRARSLGSLKKLNLLR-ECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLR 293
             +G        L  LK+L+ LR    I  L  V+ A EA+ A L++K  L  L L +    
Sbjct:   676 IGRL--SGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKG 733

Query:   294 DG---DXXXXXXXXXXXXXXXXGPPPNLKELVIDEYRGRRNVVPRNWV--MSLTNLRALL 348
              G                     P P+LK   I+ Y+G     P+ W+   S   + ++ 
Sbjct:   734 SGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQG--GAFPK-WLGDSSFFGITSVT 790

Query:   349 LKNCRNCEHLPPLGKLPSLESLYIEGMQSVKRVGNEFLGVESDTDGSSIIAFPKLKHLKF 408
             L +C  C  LPP+G+LPSL+ L IE    +++VG +F   E+++ G   + F  L+ LKF
Sbjct:   791 LSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRG---VPFQSLQILKF 847

Query:   409 YDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKL-KALPDXXXXXXXXXXXXIGRCPI 467
             Y M   +EW       G   I P L  L I  C  L K  P+            I  CP+
Sbjct:   848 YGMPRWDEWICPELEDG---IFPCLQKLIIQRCPSLRKKFPEGLPSSTEVT---ISDCPL 901




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146228 AT5G18350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163578 AT5G45500 "AT5G45500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 51.0 bits (122), Expect = 1e-06
 Identities = 84/317 (26%), Positives = 127/317 (40%), Gaps = 62/317 (19%)

Query: 93  KGLRGLRSLLVESDDYSWFSEV---LPQLFDKLTC-LRALKLE-VRQRWLCKNF------ 141
           KG+R L  L   +  +    EV   LP+ FD L   LR L+ +    R +  NF      
Sbjct: 555 KGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLV 614

Query: 142 --------IKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLREL 193
                   ++K+   +  L  L+ + L G + ++++P+ L    NLE L ++ C+ L EL
Sbjct: 615 KLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVEL 673

Query: 194 PQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVVGGGYDRARSLGSLKKLNL 253
           P  I  L KL  LD      L  LP GI                      +L SL +LNL
Sbjct: 674 PSSIQYLNKLEDLDMSRCENLEILPTGI----------------------NLKSLYRLNL 711

Query: 254 LRECSIRGLGGVS------DAGEARRAELEKK---KNLVELGLHFDRLRDGDEEQARRRE 304
                ++    +S      D  E    E       +NL EL L      +   E+   R 
Sbjct: 712 SGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILC-----EMKSEKLWERV 766

Query: 305 SER--LLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLG 362
                L+  L   P+L  L + +      + P + + +L  L  L ++NC N E LP   
Sbjct: 767 QPLTPLMTML--SPSLTRLFLSDIPSLVEL-PSS-IQNLHKLEHLEIENCINLETLPTGI 822

Query: 363 KLPSLESLYIEGMQSVK 379
            L SLESL + G   ++
Sbjct: 823 NLESLESLDLSGCSRLR 839


syringae 6; Provisional. Length = 1153

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 492
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG4237498 consensus Extracellular matrix protein slit, conta 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.39
KOG4341483 consensus F-box protein containing LRR [General fu 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.91
KOG4341483 consensus F-box protein containing LRR [General fu 98.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.74
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.73
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.57
PLN03150623 hypothetical protein; Provisional 98.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
PLN03150623 hypothetical protein; Provisional 98.49
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.31
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.85
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.68
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.68
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.62
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.55
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.27
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.02
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.06
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.75
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.14
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.37
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.21
smart0037026 LRR Leucine-rich repeats, outliers. 88.21
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.86
KOG4308478 consensus LRR-containing protein [Function unknown 82.97
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.97  E-value=9e-31  Score=286.31  Aligned_cols=412  Identities=21%  Similarity=0.271  Sum_probs=269.4

Q ss_pred             HHHHHHHhCCCCccccCCCCCCeeeEEeChhHHHHHHHhhccce-------EEeecCCcccccccccCccceEEEEEEee
Q 011151            7 EYFNILASRSFFQDFDKDDDGEISTCKMHDIVHDFAQYLCSNEC-------LTVEVHSGEELAINSFGEKKILHLLLTLH   79 (492)
Q Consensus         7 ~~~~~L~~~~ll~~~~~~~~~~~~~~~~hdl~~~~~~~i~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~l~l~~~   79 (492)
                      ..++.|+++|||+....       .++|||++|+||+.++.++.       +.+.......+.....++.+++.+.+...
T Consensus       470 ~~l~~L~~ksLi~~~~~-------~~~MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~  542 (1153)
T PLN03210        470 IGLKNLVDKSLIHVRED-------IVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDID  542 (1153)
T ss_pred             hChHHHHhcCCEEEcCC-------eEEhhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccC
Confidence            34889999999987542       48899999999999987652       33333322222222334467788777655


Q ss_pred             cCCCcccccccCccCCCCceEEEeccCCc---cccccccchhhccCC-eeeEEecchhhhhhccccccccCchhhccCcC
Q 011151           80 RGASVPISIWGNVKGLRGLRSLLVESDDY---SWFSEVLPQLFDKLT-CLRALKLEVRQRWLCKNFIKKIPTNIEKLLHL  155 (492)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~---~~~~~~~~~~~~~~~-~L~~L~L~~~~~~~~~~~~~~l~~~~~~l~~L  155 (492)
                      .+.+... -..+|.++++|+.|.+..+..   ......+|..|..++ .|+.|++.       ++.+..+|..+ .+.+|
T Consensus       543 ~~~~~~i-~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~-------~~~l~~lP~~f-~~~~L  613 (1153)
T PLN03210        543 EIDELHI-HENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWD-------KYPLRCMPSNF-RPENL  613 (1153)
T ss_pred             ccceeee-cHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEec-------CCCCCCCCCcC-CccCC
Confidence            5544111 112345899999999976531   112333566566654 58999998       88888888776 56889


Q ss_pred             CEEEccCCCCccccchhhhcCCCCCeeecCcccccccccccccCCCCCcEEecCCCcccccccccccccccccccceEEe
Q 011151          156 KYLSLCGQREIEKLPETLCELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLRRVTKFVV  235 (492)
Q Consensus       156 ~~L~L~~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~  235 (492)
                      +.|++.++. +..+|..+..+++|+.|+++++..+..+|. ++.+++|+.|++++|.....+|..+..+++|+.|++..+
T Consensus       614 ~~L~L~~s~-l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c  691 (1153)
T PLN03210        614 VKLQMQGSK-LEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRC  691 (1153)
T ss_pred             cEEECcCcc-ccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCC
Confidence            999999988 888888888899999999988876777775 788889999999998877888888888889999888876


Q ss_pred             ecccCCCcCccccccccccCCceEecCCCCCChhhhhHhhhcccCCcceEecccccCCCCchhhHhh-------------
Q 011151          236 GGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQARR-------------  302 (492)
Q Consensus       236 ~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~-------------  302 (492)
                      .....++..    ..++.|+.+.+.++.......       ...++|+.|+++++.+...+..-...             
T Consensus       692 ~~L~~Lp~~----i~l~sL~~L~Lsgc~~L~~~p-------~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~  760 (1153)
T PLN03210        692 ENLEILPTG----INLKSLYRLNLSGCSRLKSFP-------DISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSE  760 (1153)
T ss_pred             CCcCccCCc----CCCCCCCEEeCCCCCCccccc-------cccCCcCeeecCCCccccccccccccccccccccccchh
Confidence            544322221    146667777766664433211       12356777777777643322100000             


Q ss_pred             ----hhHHHHhhhcCCCCCccEEEEeecCCCccccCchhhhccccccEEEEecccCCCcCCCCCCCCccceeeccccccc
Q 011151          303 ----RESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPPLGKLPSLESLYIEGMQSV  378 (492)
Q Consensus       303 ----~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~l~~~~~~~l~~L~~L~L~~~~~~~~~~~l~~l~~L~~L~l~~~~~l  378 (492)
                          ......+.....+++|+.|++++|..... + |..+..+++|+.|++++|...+.+|....+++|+.|++++|..+
T Consensus       761 ~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~-l-P~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L  838 (1153)
T PLN03210        761 KLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVE-L-PSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRL  838 (1153)
T ss_pred             hccccccccchhhhhccccchheeCCCCCCccc-c-ChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCcc
Confidence                00000000011234566666666543332 4 55566666666666666655555555335666666666666544


Q ss_pred             eeecccccCCcCCCCCCcccccccccceeccCcccccccccCccccccccCCCCcceEeecCCCCcccCCcccCCCCCCC
Q 011151          379 KRVGNEFLGVESDTDGSSIIAFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQ  458 (492)
Q Consensus       379 ~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~l~~l~~L~  458 (492)
                      ..++.               ..++|+.|++.++. ++      .+|.++..+++|+.|++++|+.++.+|..+..+++|+
T Consensus       839 ~~~p~---------------~~~nL~~L~Ls~n~-i~------~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~  896 (1153)
T PLN03210        839 RTFPD---------------ISTNISDLNLSRTG-IE------EVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLE  896 (1153)
T ss_pred             ccccc---------------cccccCEeECCCCC-Cc------cChHHHhcCCCCCEEECCCCCCcCccCcccccccCCC
Confidence            33221               22456666655532 22      3567788999999999999999999998888999999


Q ss_pred             eEEEeCCCchhhh
Q 011151          459 KLLIGRCPILEER  471 (492)
Q Consensus       459 ~L~l~~c~~l~~~  471 (492)
                      .+++++|+.+++.
T Consensus       897 ~L~l~~C~~L~~~  909 (1153)
T PLN03210        897 TVDFSDCGALTEA  909 (1153)
T ss_pred             eeecCCCcccccc
Confidence            9999999988754



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 87.7 bits (218), Expect = 3e-19
 Identities = 30/114 (26%), Positives = 45/114 (39%), Gaps = 7/114 (6%)

Query: 115 LPQLFDKLTCLRALKLEVRQRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLC 174
           LP     L  L++LK+         + +  +   I  L  L+ L L G   +   P    
Sbjct: 198 LPASIANLQNLKSLKIR-------NSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFG 250

Query: 175 ELYNLERLNITSCNHLRELPQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLR 228
               L+RL +  C++L  LP  I +L +L  LD      L  LP  I +L    
Sbjct: 251 GRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANC 304


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.52
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.02
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.98
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.98
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.7
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.97
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 90.93
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-33  Score=295.11  Aligned_cols=389  Identities=20%  Similarity=0.192  Sum_probs=265.2

Q ss_pred             cceEEEEEEeecCC-CcccccccCccCCCCceEEEeccCCccccccccchhhccCCeeeEEecchhhhhhcccccc-ccC
Q 011151           69 KKILHLLLTLHRGA-SVPISIWGNVKGLRGLRSLLVESDDYSWFSEVLPQLFDKLTCLRALKLEVRQRWLCKNFIK-KIP  146 (492)
Q Consensus        69 ~~~~~l~l~~~~~~-~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~-~l~  146 (492)
                      ++++.+++.+|.+. .+|..+.   ..+++|+.|++++|.   +.+..|..|+.+++|++|+++       ++.+. .+|
T Consensus       269 ~~L~~L~L~~n~l~~~ip~~~~---~~~~~L~~L~Ls~n~---l~~~~p~~~~~l~~L~~L~L~-------~n~l~~~ip  335 (768)
T 3rgz_A          269 KSLQYLSLAENKFTGEIPDFLS---GACDTLTGLDLSGNH---FYGAVPPFFGSCSLLESLALS-------SNNFSGELP  335 (768)
T ss_dssp             TTCCEEECCSSEEEESCCCCSC---TTCTTCSEEECCSSE---EEECCCGGGGGCTTCCEEECC-------SSEEEEECC
T ss_pred             CCCCEEECcCCccCCccCHHHH---hhcCcCCEEECcCCc---CCCccchHHhcCCCccEEECC-------CCcccCcCC
Confidence            46667777666655 3454443   124888888888887   776678878888888888888       77765 677


Q ss_pred             ch-hhccCcCCEEEccCCCCccccchhhhcCC-CCCeeecCcccccccccccccC--CCCCcEEecCCCccccccccccc
Q 011151          147 TN-IEKLLHLKYLSLCGQREIEKLPETLCELY-NLERLNITSCNHLRELPQGIGK--LRKLMYLDNDDTWFLRYLPVGIG  222 (492)
Q Consensus       147 ~~-~~~l~~L~~L~L~~~~~~~~lp~~~~~l~-~L~~L~l~~~~~~~~lp~~~~~--l~~L~~L~l~~~~~~~~~~~~l~  222 (492)
                      .. +.++++|++|++++|.+.+.+|..+.++. +|++|++++|.+...+|..+..  +++|++|++++|.+.+.+|..+.
T Consensus       336 ~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~  415 (768)
T 3rgz_A          336 MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS  415 (768)
T ss_dssp             HHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG
T ss_pred             HHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh
Confidence            65 78888888888888884457888888877 8888888888866667766665  77889999998888778888888


Q ss_pred             ccccccccceEEeecccCCCcCccccccccccCCceEecCCCCCChhhhhHhhhcccCCcceEecccccCCCCchhhHhh
Q 011151          223 ELINLRRVTKFVVGGGYDRARSLGSLKKLNLLRECSIRGLGGVSDAGEARRAELEKKKNLVELGLHFDRLRDGDEEQARR  302 (492)
Q Consensus       223 ~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~  302 (492)
                      .+++|+.|++..+.....   ....+..++.|+.+.+....-..    .....+..+++|+.|++++|.+++        
T Consensus       416 ~l~~L~~L~Ls~N~l~~~---~p~~l~~l~~L~~L~L~~n~l~~----~~p~~~~~l~~L~~L~L~~N~l~~--------  480 (768)
T 3rgz_A          416 NCSELVSLHLSFNYLSGT---IPSSLGSLSKLRDLKLWLNMLEG----EIPQELMYVKTLETLILDFNDLTG--------  480 (768)
T ss_dssp             GCTTCCEEECCSSEEESC---CCGGGGGCTTCCEEECCSSCCCS----CCCGGGGGCTTCCEEECCSSCCCS--------
T ss_pred             cCCCCCEEECcCCcccCc---ccHHHhcCCCCCEEECCCCcccC----cCCHHHcCCCCceEEEecCCcccC--------
Confidence            899999998888876632   33445556666666665543221    111456788899999999888642        


Q ss_pred             hhHHHHhhhcCCCCCccEEEEeecCCCccccCchhhhccccccEEEEecccCCCcCCC-CCCCCccceeeccccccceee
Q 011151          303 RESERLLEALGPPPNLKELVIDEYRGRRNVVPRNWVMSLTNLRALLLKNCRNCEHLPP-LGKLPSLESLYIEGMQSVKRV  381 (492)
Q Consensus       303 ~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~l~~~~~~~l~~L~~L~L~~~~~~~~~~~-l~~l~~L~~L~l~~~~~l~~~  381 (492)
                          ..+..+..+++|++|++++|.+... + |.++..+++|++|++++|.+.+.+|. ++.+++|+.|++++|.....+
T Consensus       481 ----~~p~~l~~l~~L~~L~L~~N~l~~~-~-p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i  554 (768)
T 3rgz_A          481 ----EIPSGLSNCTNLNWISLSNNRLTGE-I-PKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI  554 (768)
T ss_dssp             ----CCCGGGGGCTTCCEEECCSSCCCSC-C-CGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBC
T ss_pred             ----cCCHHHhcCCCCCEEEccCCccCCc-C-ChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcC
Confidence                3455677788999999999988752 4 88888899999999999988877776 788889999999888754444


Q ss_pred             cccccCCcCC----------------------------------------------------------CCCCcccccccc
Q 011151          382 GNEFLGVESD----------------------------------------------------------TDGSSIIAFPKL  403 (492)
Q Consensus       382 ~~~~~~~~~~----------------------------------------------------------~~~~~~~~l~~L  403 (492)
                      +..+......                                                          ........+++|
T Consensus       555 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L  634 (768)
T 3rgz_A          555 PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM  634 (768)
T ss_dssp             CGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCC
T ss_pred             ChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccc
Confidence            4333211000                                                          001112234455


Q ss_pred             cceeccCcc------------------cccccccCccccccccCCCCcceEeecCCCCcccCCcccCCCCCCCeEEEeCC
Q 011151          404 KHLKFYDME------------------ELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRC  465 (492)
Q Consensus       404 ~~L~l~~~~------------------~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~l~~l~~L~~L~l~~c  465 (492)
                      +.|+++++.                  ++..+.+.+.+|..++.+++|+.|++++|...+.+|..+..+++|++|++++|
T Consensus       635 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          635 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN  714 (768)
T ss_dssp             CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSS
T ss_pred             cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCC
Confidence            555554432                  11123355678888889999999999997766688988999999999999987


Q ss_pred             Cchh---------------------------hhhhcCCCCCCccCCCCCcccc
Q 011151          466 PILE---------------------------ERCRKETGEDWPNIRHIPELYI  491 (492)
Q Consensus       466 ~~l~---------------------------~~~~~~~~~~~~~i~~~~~~~~  491 (492)
                      +.-.                           ..|....+++|++|+|+|+++-
T Consensus       715 ~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~~  767 (768)
T 3rgz_A          715 NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHHH  767 (768)
T ss_dssp             EEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC---------------
T ss_pred             cccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccCC
Confidence            5210                           1467788999999999998764



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 492
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-04
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 42.1 bits (97), Expect = 1e-04
 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 9/95 (9%)

Query: 134 QRWLCKNFIKKIPTNIEKLLHLKYLSLCGQREIEKLPETLCELYNLERLNITSCNHLREL 193
             +       +I +  +    L+ L++   + + +LP        LERL   S NHL E+
Sbjct: 265 NLYYLNASSNEIRSLCDLPPSLEELNVSNNK-LIELPALPP---RLERLIA-SFNHLAEV 319

Query: 194 PQGIGKLRKLMYLDNDDTWFLRYLPVGIGELINLR 228
           P+    L++L    N     LR  P     + +LR
Sbjct: 320 PELPQNLKQLHVEYNP----LREFPDIPESVEDLR 350


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.05
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.49
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.87  E-value=5.7e-21  Score=183.89  Aligned_cols=57  Identities=16%  Similarity=0.282  Sum_probs=26.9

Q ss_pred             ccccccceeccCcccccccccCccccccccCCCCcceEeecCCCCcccCCcccCCCCCCCeEEEeCC
Q 011151          399 AFPKLKHLKFYDMEELEEWDFGTAIKGEIIIMPRLSFLEISGCCKLKALPDLLLQKTTLQKLLIGRC  465 (492)
Q Consensus       399 ~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~l~~l~~L~~L~l~~c  465 (492)
                      .+|+|++|++++|. ++++.       .+..+++|++|++++| .+++++. +.++++|+.|+|++|
T Consensus       327 ~l~~L~~L~L~~n~-l~~l~-------~l~~l~~L~~L~l~~N-~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         327 SLTKLQRLFFANNK-VSDVS-------SLANLTNINWLSAGHN-QISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             GCTTCCEEECCSSC-CCCCG-------GGGGCTTCCEEECCSS-CCCBCGG-GTTCTTCSEEECCCE
T ss_pred             cCCCCCEEECCCCC-CCCCh-------hHcCCCCCCEEECCCC-cCCCChh-hccCCCCCEeeCCCC
Confidence            45555555555542 33321       2334555555555543 3444432 444555555555543



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure