Citrus Sinensis ID: 011239

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MCPKYDGKTGSSEQNADTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRSDDCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEPRLLRSDSVQEQVVSDKLSKNIRHKMVEIDSINDSCSSSKSNMELLSASKKTEVDETGECSSSSAVMLETTGKDLSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKSPNIISEKGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRTKSRPPQLSAKVLMKSETQTT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHccccccccccEEcccccccccEEEcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccc
ccccccccccccccccccccccccccccccccEEEcccccccccEEEEEHcccccEEEEcccccccEcccccccEEEEcccccccccccccccccccccHHccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHcccEEccccccHHHEEEEcccccccEEEcccccccccccccccccHHHcccccHcccccccccccccccccccccccccccccHHHcccccccccccEEEcccEEEEccccccccccccccccccccccHHHHccHHHccccccccccccccEEEHHHHHcccccccccEEEccEEcccEEEEEccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEHEEEEccccccc
mcpkydgktgsseqnadtlcplnfdrnsqhstvstmsgstaptLVYQRrklrgnsvpifstqdpvntkrsddclsvvsfdavsvpmeEQHAVSLAevgteavgtpilppiisqseprllrsdsvQEQVVSDKLSKNIRHKMVEidsindscsssksNMELLSAskktevdetgecssssAVMLEttgkdlsakDLCISILRnegmlerfwptqirssandvdsgtgcsgicsrsckicgrsETALKLLLCDDceeafhvtcytprikivpsdewfchlCLKKKHKTLKatarkspniisekgrgrnasakgepspielmltstvpyttsvrvgkgfqadipdwlaptnndgyalgepleldtsecpslhdlnsynlsnlssiGNWLQCKQVlegtgdgvdgtscgkwrraplfevqtddwecfcavqwdpthadcavpqeleTDEVSKQLKYLEMLRLRLDAKRrkfdrtksrppqlsAKVLMKSETQTT
mcpkydgktgsseqnaDTLCPLNFDRNSQHstvstmsgstapTLVYQrrklrgnsvpifstqdpvntkrsddCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEPRLLRSDSVQEQVvsdklsknirhkmveidsindscssskSNMELLSAskktevdetgecssssAVMLettgkdlsaKDLCISILRNEGMLERFWPTQIRssandvdsgtgcSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKkhktlkatarkspniisekgrgrnasakgepspielMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDakrrkfdrtksrppqlsakvlmksetqtt
MCPKYDGKTGSSEQNADTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRSDDCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEPRLLRSDSVQEQVVSDKLSKNIRHKMVEidsindscsssksnMELLSASKKTEVDETGECSSSSAVMLETTGKDLSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFchlclkkkhktlkataRKSPNIISEKGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPslhdlnsynlsnlssignWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRTKSRPPQLSAKVLMKSETQTT
***********************************************************************DCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPI*******************************************************************************LSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKH*********************************LMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRL******************************
*********************************************************************************************************************************************************************************************************************************GCSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLC**********************************************************************************************************LQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEML***************************K******
**************NADTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRSDDCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEP************VSDKLSKNIRHKMVEIDSINDS****************************SAVMLETTGKDLSAKDLCISILRNEGMLERFWPTQIRSSA**********GICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKSPNIISEK***********PSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRTKSRPPQLSAKVLMKSETQTT
*******************CPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRSDDCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEPRLLRSDSV*****************************************************************LSAKDLCISILRNEGMLERF*****************CSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKK*********************************ELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRTKSRPPQLSAKVLMK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPKYDGKTGSSEQNADTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRSDDCLSVVSFDAVSVPMEEQHAVSLAEVGTEAVGTPILPPIISQSEPRLLRSDSVQEQVVSDKLSKNIRHKMVEIDSINDSCSSSKSNMELLSASKKTEVDETGECSSSSAVMLETTGKDLSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKSPNIISEKGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCAVPQELETDEVSKQLKYxxxxxxxxxxxxxxxxxxxxxPPQLSAKVLMKSETQTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
Q9P1Y6 1649 PHD and RING finger domai yes no 0.169 0.050 0.306 1e-08
Q63625 1685 PHD and RING finger domai yes no 0.091 0.026 0.488 1e-08
A6H619 1682 PHD and RING finger domai yes no 0.091 0.026 0.488 1e-08
Q09477372 Uncharacterized zinc fing yes no 0.124 0.163 0.442 2e-08
Q92785391 Zinc finger protein ubi-d no no 0.097 0.122 0.479 8e-08
P58268405 Zinc finger protein ubi-d yes no 0.097 0.118 0.479 1e-07
Q61103391 Zinc finger protein ubi-d no no 0.097 0.122 0.458 2e-07
Q9W636366 Zinc finger protein ubi-d N/A no 0.097 0.131 0.458 2e-07
Q9DE132130 Bromodomain adjacent to z no no 0.136 0.031 0.363 2e-07
Q9QX66387 Zinc finger protein neuro no no 0.116 0.147 0.440 2e-07
>sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 18/101 (17%)

Query: 235 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKS 294
           C++CGRS+   +LLLCD C+  +H+ C  P ++ VP DEWFC  C              +
Sbjct: 186 CEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECA-------------A 232

Query: 295 PNIISEKGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKG 335
           P ++     G  +  +     + L+L   VP T+ +R   G
Sbjct: 233 PGVVLAADAGPVSEEE-----VSLLLADVVPTTSRLRPRAG 268

Homo sapiens (taxid: 9606)
>sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 Back     alignment and function description
>sp|Q09477|YP99_CAEEL Uncharacterized zinc finger protein C28H8.9 OS=Caenorhabditis elegans GN=C28H8.9/C28H8.10 PE=1 SV=2 Back     alignment and function description
>sp|Q92785|REQU_HUMAN Zinc finger protein ubi-d4 OS=Homo sapiens GN=DPF2 PE=1 SV=2 Back     alignment and function description
>sp|P58268|REQU_CHICK Zinc finger protein ubi-d4 OS=Gallus gallus GN=REQ PE=2 SV=1 Back     alignment and function description
>sp|Q61103|REQU_MOUSE Zinc finger protein ubi-d4 OS=Mus musculus GN=Dpf2 PE=1 SV=1 Back     alignment and function description
>sp|Q9W636|REQUB_XENLA Zinc finger protein ubi-d4 B (Fragment) OS=Xenopus laevis GN=req-b PE=2 SV=2 Back     alignment and function description
>sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 Back     alignment and function description
>sp|Q9QX66|DPF1_MOUSE Zinc finger protein neuro-d4 OS=Mus musculus GN=Dpf1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
224087304 651 predicted protein [Populus trichocarpa] 0.922 0.694 0.523 1e-120
224142701 714 predicted protein [Populus trichocarpa] 0.914 0.627 0.507 1e-112
356517838487 PREDICTED: uncharacterized protein LOC10 0.832 0.837 0.496 1e-108
449457271512 PREDICTED: uncharacterized protein LOC10 0.887 0.849 0.481 1e-102
255573763373 conserved hypothetical protein [Ricinus 0.689 0.906 0.468 3e-78
224087296 607 predicted protein [Populus trichocarpa] 0.671 0.542 0.513 1e-77
356507021224 PREDICTED: bromodomain adjacent to zinc 0.453 0.991 0.601 4e-74
357465269475 PHD and RING finger domain-containing pr 0.722 0.745 0.430 2e-73
224121224486 predicted protein [Populus trichocarpa] 0.642 0.648 0.414 1e-62
218194845470 hypothetical protein OsI_15901 [Oryza sa 0.753 0.785 0.363 3e-62
>gi|224087304|ref|XP_002308115.1| predicted protein [Populus trichocarpa] gi|222854091|gb|EEE91638.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 244/466 (52%), Positives = 301/466 (64%), Gaps = 14/466 (3%)

Query: 17  DTLCPLNFDRNSQHSTVSTMSGSTAPTLVYQRRKLRGNSVPIFSTQDPVNTKRS-DDCLS 75
           D+ C L+   + Q  T STMS  +A   VY RRKLRGNS    S Q P  TKRS +DCLS
Sbjct: 180 DSQCRLSLQGSPQLPTSSTMSEISARNFVYSRRKLRGNSATFLSAQVPGITKRSREDCLS 239

Query: 76  VVSFDAVSVPMEEQHAVSL-----AEVGTEAVGTPILPPIISQSEPRLLRSDS-----VQ 125
           ++S D  S+ +EE   VS       E GT   G    PP++   EP + +S+S     + 
Sbjct: 240 IISSDGPSLVVEEARVVSQDHQDQFERGTG--GALPRPPLVCYGEPHVSKSESSSGCSLV 297

Query: 126 EQVVSDKLSKNIRHKMVEIDSINDSCSSSKSNMELLSASKKTEVDETGECSSSSAVMLET 185
           E +VSD+ +K  R K++E+DSINDSCSSSKSNM+L+S S KTE D+ GECSSSS V  E 
Sbjct: 298 EDLVSDEATKKSRPKIIEVDSINDSCSSSKSNMDLVSDSTKTEGDDNGECSSSSIVAAEV 357

Query: 186 TGKDLSAKDLCISILRNEGMLERFWPTQIRSSANDVDSGTGCSGICSRSCKICGRSETAL 245
           TG+D S  D CISILR +G  E  WP +   SA  +  G+G     SR CK C R  + +
Sbjct: 358 TGEDQSENDQCISILRRQGAFEGVWPGKTHVSAKSIGDGSGSGSSSSRPCKKCFRKGSPV 417

Query: 246 KLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKAT-ARKSPNIISEKGRG 304
           K+L+CD+CE++FHV+C  PR+K +P DEW C  C KKK    K T +RKS NII + GR 
Sbjct: 418 KMLICDNCEDSFHVSCCNPRVKRIPVDEWLCRSCWKKKRIIPKETISRKSLNIIGDMGRC 477

Query: 305 RNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSE 364
           R+AS+ GE +PI LML  T PYT  VRVGKGFQ DIPDW  P  N    +G+PL L+ S 
Sbjct: 478 RDASSTGESNPIALMLRDTEPYTGGVRVGKGFQVDIPDWSGPIINVVDIIGKPLVLEPSY 537

Query: 365 CPSLHDLNSYNLSNLSSIGNWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFC 424
              L +L S   S L SIGNWLQCKQV++   +G + T CGKWRRAPLFEVQT  WECFC
Sbjct: 538 FVGLFELKSNKSSKLGSIGNWLQCKQVIDDAAEGGNVTICGKWRRAPLFEVQTAVWECFC 597

Query: 425 AVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFDRT 470
            V WDP HADCA PQELETDEV KQ+KY++MLR R+ AK +K  R 
Sbjct: 598 CVFWDPIHADCAAPQELETDEVMKQIKYIQMLRPRIAAKHQKLRRA 643

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224142701|ref|XP_002324693.1| predicted protein [Populus trichocarpa] gi|222866127|gb|EEF03258.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356517838|ref|XP_003527593.1| PREDICTED: uncharacterized protein LOC100800660 [Glycine max] Back     alignment and taxonomy information
>gi|449457271|ref|XP_004146372.1| PREDICTED: uncharacterized protein LOC101212408 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255573763|ref|XP_002527802.1| conserved hypothetical protein [Ricinus communis] gi|223532798|gb|EEF34574.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224087296|ref|XP_002308114.1| predicted protein [Populus trichocarpa] gi|222854090|gb|EEE91637.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356507021|ref|XP_003522270.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 2A-like [Glycine max] Back     alignment and taxonomy information
>gi|357465269|ref|XP_003602916.1| PHD and RING finger domain-containing protein [Medicago truncatula] gi|355491964|gb|AES73167.1| PHD and RING finger domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224121224|ref|XP_002330774.1| predicted protein [Populus trichocarpa] gi|222872576|gb|EEF09707.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|218194845|gb|EEC77272.1| hypothetical protein OsI_15901 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
TAIR|locus:2047630631 AT2G19260 "AT2G19260" [Arabido 0.336 0.261 0.482 7.2e-51
WB|WBGene00016200372 dpff-1 [Caenorhabditis elegans 0.102 0.134 0.480 1.5e-05
UNIPROTKB|E9PJ24 1645 PHRF1 "PHD and RING finger dom 0.083 0.024 0.487 0.00011
UNIPROTKB|F8WEF5 1647 PHRF1 "PHD and RING finger dom 0.083 0.024 0.487 0.00011
UNIPROTKB|Q9P1Y6 1649 PHRF1 "PHD and RING finger dom 0.083 0.024 0.487 0.00011
UNIPROTKB|H9KZW6725 H9KZW6 "Uncharacterized protei 0.230 0.155 0.266 0.00011
MGI|MGI:2141847 1682 Phrf1 "PHD and ring finger dom 0.083 0.024 0.487 0.00012
RGD|708360 1685 Phrf1 "PHD and ring finger dom 0.083 0.024 0.487 0.00012
UNIPROTKB|Q63625 1685 Phrf1 "PHD and RING finger dom 0.083 0.024 0.487 0.00012
UNIPROTKB|D4ADM0733 LOC100362634 "Protein LOC10036 0.230 0.154 0.274 0.00012
TAIR|locus:2047630 AT2G19260 "AT2G19260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 400 (145.9 bits), Expect = 7.2e-51, Sum P(3) = 7.2e-51
 Identities = 84/174 (48%), Positives = 102/174 (58%)

Query:   301 KGRGRNASAKGEPSPIELMLTSTVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLEL 360
             K +      KG  S  E     TVP+   +R+GK FQAD+PDW  PT +D   +GEPLE+
Sbjct:   459 KNQSSKTKTKGRISH-ERKWRVTVPFVIGIRIGKMFQADVPDWSGPTMSDTSFVGEPLEI 517

Query:   361 DTSECPXXXXXXXXXXXXXXXXXXWLQCKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDW 420
               SE                    WLQC++  E T    +G  CGKWRRAP  EVQT DW
Sbjct:   518 GQSEY-MHDLKKAKNSKKQCSAVNWLQCRE--EDT----NGVICGKWRRAPRSEVQTKDW 570

Query:   421 ECFCAVQWDPTHADCAVPQELETDEVSKQLKYLEMLRLRLDAKRRKFD-RTKSR 473
             ECFC   WDP+ ADCAVPQELET E+ KQLKY++MLR R DAK+RK   + +SR
Sbjct:   571 ECFCCFSWDPSRADCAVPQELETSEILKQLKYIKMLRPRSDAKKRKLGPKGRSR 624
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
WB|WBGene00016200 dpff-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E9PJ24 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8WEF5 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P1Y6 PHRF1 "PHD and RING finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZW6 H9KZW6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2141847 Phrf1 "PHD and ring finger domains 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708360 Phrf1 "PHD and ring finger domains 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63625 Phrf1 "PHD and RING finger domain-containing protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4ADM0 LOC100362634 "Protein LOC100362634" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00009252001
SubName- Full=Chromosome undetermined scaffold_226, whole genome shotgun sequence; (538 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
pfam0062851 pfam00628, PHD, PHD-finger 4e-09
smart0024947 smart00249, PHD, PHD zinc finger 8e-09
pfam0749650 pfam07496, zf-CW, CW-type Zinc Finger 0.001
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 0.001
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 52.1 bits (125), Expect = 4e-09
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 235 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKI--VPSDEWFCHLC 279
           C +CG+ +   +LLLCD C+  FH+ C  P ++   +P  EW+C  C
Sbjct: 2   CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPEC 48

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|219431 pfam07496, zf-CW, CW-type Zinc Finger Back     alignment and domain information
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
KOG4299 613 consensus PHD Zn-finger protein [General function 99.24
KOG1244336 consensus Predicted transcription factor Requiem/N 99.21
KOG0825 1134 consensus PHD Zn-finger protein [General function 99.07
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 98.99
KOG1512381 consensus PHD Zn-finger protein [General function 98.77
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.7
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.4
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.31
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.08
KOG1973274 consensus Chromatin remodeling protein, contains P 98.0
KOG0383 696 consensus Predicted helicase [General function pre 97.84
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.72
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.28
KOG0957707 consensus PHD finger protein [General function pre 97.2
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.09
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.95
COG5141 669 PHD zinc finger-containing protein [General functi 96.62
KOG0954 893 consensus PHD finger protein [General function pre 96.48
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.27
KOG0956 900 consensus PHD finger protein AF10 [General functio 96.15
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 95.36
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 89.12
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 88.13
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 87.2
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 87.16
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 84.31
KOG0956 900 consensus PHD finger protein AF10 [General functio 80.19
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 80.04
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.24  E-value=3.3e-12  Score=138.42  Aligned_cols=167  Identities=23%  Similarity=0.372  Sum_probs=103.6

Q ss_pred             cccccccccccCCCCeEEecCCCCcccccccCCC--cCCCCCCCccccccccccccccc-ccccCCCCcccccccCCCCC
Q 011239          232 SRSCKICGRSETALKLLLCDDCEEAFHVTCYTPR--IKIVPSDEWFCHLCLKKKHKTLK-ATARKSPNIISEKGRGRNAS  308 (490)
Q Consensus       232 ~~~C~VC~~~g~~~~LL~CD~Cdr~yH~~Cl~Pp--L~~iP~g~W~C~~C~~~~~~~~k-~~~~k~p~l~~e~~~~r~as  308 (490)
                      .+||..|++.|.-..++|||+|+++||++|+.||  .+.+|.|.|||+.|..+-..... .+.+..-.+.. .. ....+
T Consensus       253 ~~fCsaCn~~~~F~~~i~CD~Cp~sFH~~CLePPl~~eniP~g~W~C~ec~~k~~in~~~~t~~~~~~~~~-i~-t~~~~  330 (613)
T KOG4299|consen  253 EDFCSACNGSGLFNDIICCDGCPRSFHQTCLEPPLEPENIPPGSWFCPECKIKSVINPKMETLSNRGTVVD-IF-TQFVS  330 (613)
T ss_pred             HHHHHHhCCccccccceeecCCchHHHHhhcCCCCCcccCCCCccccCCCeeeeecccchhhhhhccchHH-HH-HHHHH
Confidence            4699999999865667999999999999999999  45799999999999876422111 11111000000 00 00111


Q ss_pred             CCCCCChhhhhccc-CCCceeeeecCCCccccCCCCCCCCCCCCCCcCCCccCCCCCCCccccccccccCCccCCCceEe
Q 011239          309 AKGEPSPIELMLTS-TVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTSECPSLHDLNSYNLSNLSSIGNWLQ  387 (490)
Q Consensus       309 ~~~~mnpie~~L~e-~~~y~~~Vr~G~~Fqa~VP~ws~~~~~y~~~I~ePMdLd~se~~~L~~l~~~~~~k~~s~gnw~q  387 (490)
                      -....||+.+.+++ +..+|-+|..|..            -.|.++-. ++.|+...+. |......++  +++.|+-+.
T Consensus       331 ~IDs~np~q~~lPe~i~~~~~~v~~g~~------------~~~sd~~~-~~pl~~~~~~-~d~e~~e~g--~~ssg~~~~  394 (613)
T KOG4299|consen  331 KIDSHNPIQKILPENISESFGGVSRGDD------------GQYSDTQD-EKPLDPPALI-LDGENDENG--IDSSGTELL  394 (613)
T ss_pred             hhhccchhhhhCCHHHHhhccccccCCC------------CccccccC-CcCCChhhhc-ccccCCccC--CCccCcchh
Confidence            23567899999999 6777777765531            11211111 2333332221 111112222  345799999


Q ss_pred             cccccCCCCCCCCcccCCCccccCcccccCCCCceecccccCCCCCCCC
Q 011239          388 CKQVLEGTGDGVDGTSCGKWRRAPLFEVQTDDWECFCAVQWDPTHADCA  436 (490)
Q Consensus       388 C~~c~~~~~~~~~~i~C~kwrr~p~~~~~~~~w~c~c~~~wdp~h~dC~  436 (490)
                      |..|........-+..|.                 +|+.+|   |.||+
T Consensus       395 ~~~c~~~~~~s~~vl~c~-----------------ye~s~~---h~dc~  423 (613)
T KOG4299|consen  395 CGRCSKTQTESVVVLDCQ-----------------YEQSPE---HPDCK  423 (613)
T ss_pred             hcccCcchhhhhhhhccc-----------------cccCCC---Ccccc
Confidence            999988555544555888                 999999   99998

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
4gy5_A241 Crystal Structure Of The Tandem Tudor Domain And Pl 3e-05
3ask_A226 Structure Of Uhrf1 In Complex With Histone Tail Len 3e-05
3zvz_B57 Phd Finger Of Human Uhrf1 Length = 57 1e-04
3shb_A77 Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 1e-04
1f62_A51 Wstf-Phd Length = 51 2e-04
3zvy_A72 Phd Finger Of Human Uhrf1 In Complex With Unmodifie 2e-04
3sou_A70 Structure Of Uhrf1 Phd Finger In Complex With Histo 2e-04
2lgg_A69 Structure Of Phd Domain Of Uhrf1 In Complex With H3 2e-04
3t6r_A72 Structure Of Uhrf1 In Complex With Unmodified H3 N- 2e-04
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 4e-04
>pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
Query: 234 SCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPS-DEWF 275
           +C +CG  +   K L+CD+C+ AFH+ C  P +  VPS DEW+
Sbjct: 192 ACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWY 234
>pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 Back     alignment and structure
>pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 Back     alignment and structure
>pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 Back     alignment and structure
>pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 Back     alignment and structure
>pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-13
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-13
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 5e-13
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-12
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-12
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 5e-12
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 6e-12
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-12
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 8e-12
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 9e-12
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 9e-12
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-08
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-11
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-11
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-11
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 4e-11
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 1e-10
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-10
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-10
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-04
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 3e-10
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 5e-10
2yt5_A66 Metal-response element-binding transcription facto 1e-09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-08
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 4e-08
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 2e-07
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 3e-07
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 2e-04
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-04
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 3e-04
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 4e-04
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 4e-04
3o70_A68 PHD finger protein 13; PHF13, structural genomics 6e-04
1we9_A64 PHD finger family protein; structural genomics, PH 6e-04
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 9e-04
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 9e-04
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
 Score = 63.5 bits (155), Expect = 2e-13
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 235 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCL 280
           CK+C +     KL+LCD+C +AFH+ C  P +  VP  EW C  C 
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQ 48
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Length = 100 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Length = 69 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.69
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.68
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.62
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.56
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.55
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.53
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.47
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.46
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.43
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.41
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 99.41
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.39
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.38
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.37
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.35
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.35
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.34
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.34
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.32
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.31
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.28
2yt5_A66 Metal-response element-binding transcription facto 99.26
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 99.2
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.16
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.13
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.02
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.91
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.82
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.72
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.67
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.66
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.65
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.65
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.63
1weu_A91 Inhibitor of growth family, member 4; structural g 98.57
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.55
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.52
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.39
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.34
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.25
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.04
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.01
1we9_A64 PHD finger family protein; structural genomics, PH 97.99
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.89
1wew_A78 DNA-binding family protein; structural genomics, P 97.86
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.85
1wee_A72 PHD finger family protein; structural genomics, PH 97.79
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.78
1wem_A76 Death associated transcription factor 1; structura 97.77
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.71
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.69
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.55
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.44
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.36
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.14
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.85
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.82
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.64
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.23
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 95.18
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 91.31
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 90.17
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 88.79
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 88.76
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 88.41
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 87.8
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 84.99
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 84.84
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 84.75
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.44
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 84.31
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 83.88
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 83.86
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 83.17
2d9e_A121 Peregrin; four-helix bundle, transcription activat 82.1
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 81.85
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 81.66
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.09
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
Probab=99.69  E-value=3.4e-18  Score=159.84  Aligned_cols=123  Identities=22%  Similarity=0.496  Sum_probs=91.4

Q ss_pred             ccccccccccccCCCCeEEecCCCCcccccccCCCcCCCCCCCcccccccccccccccccccCCCCcccccccCCCCCCC
Q 011239          231 CSRSCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLKKKHKTLKATARKSPNIISEKGRGRNASAK  310 (490)
Q Consensus       231 c~~~C~VC~~~g~~~~LL~CD~Cdr~yH~~Cl~PpL~~iP~g~W~C~~C~~~~~~~~k~~~~k~p~l~~e~~~~r~as~~  310 (490)
                      ++++|.+|+++|   .||+||.|+++||++|+.|+|..+|.|+|+|+.|+........... ..+...++   .+.....
T Consensus         3 ~~~~C~~C~~~g---~ll~Cd~C~~~~H~~C~~p~l~~~p~~~W~C~~C~~~~~~~~e~dc-~~~~~~s~---~~~~~~~   75 (184)
T 3o36_A            3 NEDWCAVCQNGG---ELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDC-DAPSHNSE---KKKTEGL   75 (184)
T ss_dssp             SCSSCTTTCCCS---SCEECSSSSCEECTTTSSSCCSSCCSSCCCCTTTSCSSSCSSCCGG-GCCSSCTT---TSCCTTC
T ss_pred             CCCccccCCCCC---eeeecCCCCcccCccccCCCCCCCCCCCEECccccCcccccccccc-cccccccc---ccccccc
Confidence            357899999988   7999999999999999999999999999999999976532111000 01111111   1222334


Q ss_pred             CCCChhhhhccc-CCCceeeeecCCCccccCCCCCCCCCCCCCCcCCCccCCCC
Q 011239          311 GEPSPIELMLTS-TVPYTTSVRVGKGFQADIPDWLAPTNNDGYALGEPLELDTS  363 (490)
Q Consensus       311 ~~mnpie~~L~e-~~~y~~~Vr~G~~Fqa~VP~ws~~~~~y~~~I~ePMdLd~s  363 (490)
                      .+|.+..++.++ ++..+...+.+..|..+|..   ..++|+++|++||||.+-
T Consensus        76 ~~l~~~~~~~c~~il~~l~~~~~s~~F~~Pv~~---~~pdY~~iIk~PmdL~tI  126 (184)
T 3o36_A           76 VKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPL---TVPDYYKIIKNPMDLSTI  126 (184)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHSTTCHHHHSCCCT---TSTTHHHHCSSCCCHHHH
T ss_pred             cccCHHHHHHHHHHHHHHHhchhhhhhcccccc---CCCchhhhcCCCCCHHHH
Confidence            568888887777 66666677778899999985   578999999999999874
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 2e-12
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-11
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 4e-10
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 4e-10
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 2e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-08
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-06
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 3e-05
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 9e-04
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 59.6 bits (144), Expect = 2e-12
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 235 CKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLC 279
           CK+C +     KL+LCD+C +AFH+ C  P +  VP  EW C  C
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.21
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.18
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.1
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.89
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.53
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.43
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.35
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.27
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.16
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.01
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.6
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 80.58
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 80.07
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.21  E-value=1.9e-12  Score=95.79  Aligned_cols=48  Identities=42%  Similarity=1.032  Sum_probs=45.2

Q ss_pred             cccccccccCCCCeEEecCCCCcccccccCCCcCCCCCCCcccccccc
Q 011239          234 SCKICGRSETALKLLLCDDCEEAFHVTCYTPRIKIVPSDEWFCHLCLK  281 (490)
Q Consensus       234 ~C~VC~~~g~~~~LL~CD~Cdr~yH~~Cl~PpL~~iP~g~W~C~~C~~  281 (490)
                      .|.+|+..++++.||.||.|++.||+.|+.|++..+|.++|||+.|+.
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~   49 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP   49 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcC
Confidence            488999988888999999999999999999999999999999999975
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure