Citrus Sinensis ID: 011313

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKERKKRLEKERMERAKRYEEPAWARIDDEGDNEVGNEEGLEEEEIEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKEDEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKAST
ccccccccEEEccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccc
cccccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHcccccccccccccccccHHHHHcccccccccccccccccccccccccccccEEHEEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccHHHHcccccEEEEEEEccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccEEEEEcccccccccccccccEEEEccccccccccccHHcccccccccccccHHHHHHHHHHHccccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEcc
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEvlsdpkerawydshrsqilfsdlnsasncgpvpnlysyfsntafsgysdsgpnrksrrVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKERKKRLEKERMERAKryeepawariddegdnevgneegleeEEIEKKRSEFYCvlcgkkfksekqwtnheqskKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERfkdnvgveereigsgvgglsgdedveseffdvadgvevnevddrfgkededededaDDEVNMLKAMLSGhknrkrvavrkedevlKTEAHveneigesefmeydnckstrrknkkdrgkksggeaakgdrdgfkstneeanghhnsgvieessshscvgnknngisdnhsekdpkipdqpvdgkgtkkdrkaklknsskgnktkast
masekrclyevlglrkecttDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFsgysdsgpnrksrrvmeeenkklrkkakreynetvrelaafvkkrdkrvMDMMvkkneeierkreeekerkkrlekermerakryeepawariddegdnevgneegleeeeiekkrSEFYCVLCGKKfksekqwtnheqskkhkekvaDLRESFVDEDEVMADFGELDGEVEELGerfkdnvgveereigsgvgglsgdeDVESEFfdvadgvevnevddrfgkededededadDEVNMLKAmlsghknrkrvavrkedevlkteahveneigesefmeydnckstrrknkkdrgkksggeaakgdrdgfkstneeanGHHNSGVIEESSSHSCVGNKNNgisdnhsekdpkipdqpvdgkgtkkdrkaklknsskgnktkast
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVkkneeierkreeekerkkrlekermerakrYEEPAWARiddegdnevgneegleeeeieKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFgeldgeveelgeRFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKededededaddeVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKAST
******CLYEVLGLRKECTTDEIRSAYKKLALQR**************ATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAF*********************************************************************************************************************EFYCVLCGKKF*****************************************************************************FFDVA******************************************************************************************************************************************************************************
***EKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRK**********KLRKKAKREYNETVRELAAFVKKRDKRVM******************************************************************SEFYCVLCGKKFKSEKQ***********EKVADL******************************************************************************************************************************************************************************************************************************************
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGY***************************YNETVRELAAFVKKRDKRVMDMMVKKNEEI**************EKERMERAKRYEEPAWARIDDEGDN*************EKKRSEFYCVLCGKKFKS*****************ADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDR*************DEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNC************************DGFKSTNEEANGHHN*************GNKNNGISDNHSEKDPKIPDQP***************************
*****RCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFS******NCGPVPNLYSYFSNTAFSGYSDSGPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEE********************ERAKRYE***W***********************KKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMA*FGELDGEVEELGERFKDNVGVEEREIGS*********DVESEFFDVADGV******************DADDEVNMLKAMLSGH****************TE*********SEF***********************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYSDSGPNRKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDKRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYEEPAWARIDDEGDNEVGNEEGLEEEEIEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKEDEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDGKGTKKDRKAKLKNSSKGNKTKAST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query489 2.2.26 [Sep-21-2011]
Q0II91533 DnaJ homolog subfamily C yes no 0.519 0.476 0.278 6e-22
Q5F1R6531 DnaJ homolog subfamily C yes no 0.507 0.467 0.288 1e-20
Q6PGY5545 DnaJ homolog subfamily C yes no 0.310 0.278 0.342 4e-18
P53863 590 J protein JJJ1 OS=Sacchar yes no 0.149 0.123 0.526 1e-14
Q54ED3459 DnaJ homolog subfamily A no no 0.153 0.163 0.461 2e-11
Q74H58373 Chaperone protein DnaJ OS yes no 0.141 0.184 0.506 3e-11
P39102459 DnaJ protein homolog XDJ1 no no 0.157 0.167 0.428 8e-11
Q8EUM4388 Chaperone protein DnaJ OS yes no 0.134 0.170 0.492 3e-10
A5UYW4370 Chaperone protein DnaJ OS yes no 0.216 0.286 0.362 4e-10
Q9XCA6383 Chaperone protein DnaJ OS yes no 0.137 0.174 0.492 4e-10
>sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 164/356 (46%), Gaps = 102/356 (28%)

Query: 6   RCLYEVLGLRKECTTDEIRSAYKKLALQRHPDK-------------LVQSG---LSQAEA 49
           +C YE LG+R++ + +E++ AY+KLAL+ HPDK             L+Q+    LS  + 
Sbjct: 2   KCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQE 61

Query: 50  TAQFQ--------------------ELVHAYEVLSDP----KERAWYDSHRSQI------ 79
            A +                     +L+H + V         E+ +Y  +R+        
Sbjct: 62  RAWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDEKGFYTVYRNVFEMIAKE 121

Query: 80  --------------LFSDLNSASNCGPVPNLYSYFS------NTAFSGYSDS--GPNRKS 117
                          F D  S  +    P  Y+Y+       N A+    D+    NR  
Sbjct: 122 ELESALEEDMEDFPTFGDSQSDYDTVVHP-FYAYWQSFCTQKNFAWKEEYDTRQASNRWE 180

Query: 118 RRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVM---DMMVKKNEEIERKREEEKE 174
           +R ME+ENKK+R KA++E NE VR+L AF++KRD+RV     ++ ++N E  RK E  + 
Sbjct: 181 KRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDRRVQAHRKLVEEQNAEKARKAEAMR- 239

Query: 175 RKKRLEKERMERAKRYEEPAWARIDD----------EGDNEVGNEEGLEEEEIEKKR--- 221
           R+++L++ ++  A++Y E +W  + D          + + + G+  G +E E ++ R   
Sbjct: 240 RQQKLKQAKL--AEQYREQSWMAVADLEKELREMEAQYEKQFGDGSGEDEAEDQELRDGQ 297

Query: 222 --------------SEFYCVLCGKKFKSEKQWTNHEQSKKHKEKVADLRESFVDED 263
                            YC  C K FK+EK   NHE+SKKH+E VA L++   +E+
Sbjct: 298 DGKDSDEAEDAELYDGLYCPACDKSFKTEKAMRNHEKSKKHREMVALLKQQLEEEE 353
May act as a co-chaperone for HSP70.
Bos taurus (taxid: 9913)
>sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 Back     alignment and function description
>sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 Back     alignment and function description
>sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 Back     alignment and function description
>sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 Back     alignment and function description
>sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
255547203553 conserved hypothetical protein [Ricinus 0.965 0.853 0.516 2e-99
359481801 595 PREDICTED: dnaJ homolog subfamily C memb 0.959 0.788 0.469 6e-92
449524982588 PREDICTED: LOW QUALITY PROTEIN: dnaJ hom 0.926 0.770 0.425 1e-70
449441091588 PREDICTED: dnaJ homolog subfamily C memb 0.920 0.765 0.426 1e-69
356511845 620 PREDICTED: dnaJ homolog subfamily C memb 0.828 0.653 0.417 2e-52
15221189 630 DNAJ heat shock N-terminal domain-contai 0.619 0.480 0.488 1e-47
297839305 632 hypothetical protein ARALYDRAFT_339622 [ 0.699 0.541 0.438 6e-44
356562611 626 PREDICTED: dnaJ homolog subfamily C memb 0.224 0.175 0.738 4e-43
443730435501 hypothetical protein CAPTEDRAFT_220238 [ 0.521 0.508 0.379 4e-39
405968857577 DnaJ-like protein subfamily C member 21 0.576 0.488 0.355 5e-39
>gi|255547203|ref|XP_002514659.1| conserved hypothetical protein [Ricinus communis] gi|223546263|gb|EEF47765.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  369 bits (948), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 282/546 (51%), Positives = 347/546 (63%), Gaps = 74/546 (13%)

Query: 2   ASEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYE 61
           ASEKRC YEVLGL ++C+ DEIR+AYKKLALQRHPDKL++SGLSQ+EATAQFQEL  AYE
Sbjct: 3   ASEKRCHYEVLGLSRDCSPDEIRAAYKKLALQRHPDKLIKSGLSQSEATAQFQELSQAYE 62

Query: 62  VLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSN------------------- 102
           +LSDPKERAWYDSHRSQILFS+ N  S+   +PN   Y +                    
Sbjct: 63  ILSDPKERAWYDSHRSQILFSNPNDVSS-SVIPNFKIYANEVSFCKKLGLGLENNVREMP 121

Query: 103 ------------TAFSGY-----------------SDSGPNRKSRRVMEEENKKLRKKAK 133
                       TAF  Y                   +G NRKSRRVMEEENKKLRKKA+
Sbjct: 122 LMGNLESPYEQVTAFYNYWLGFVTVMDFCWVDQYDVMAGVNRKSRRVMEEENKKLRKKAR 181

Query: 134 REYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEKERKKRLEKERMERAKRYEEP 193
           REYNETVR LA FVKKRDKRV+DMMVKKN E+E+++EEE+ERKK+LE+ER+ERA+ YEEP
Sbjct: 182 REYNETVRGLAEFVKKRDKRVIDMMVKKNTEMEKRKEEERERKKKLERERIERARAYEEP 241

Query: 194 AWARIDDEGDNEVGNEEGLEEEEIEKKRS----EFYCVLCGKKFKSEKQWTNHEQSKKHK 249
            WAR+++E   +V + E   EEE+E K+     E YCV+CGKKFKSEKQW NHEQSKKHK
Sbjct: 242 EWARVNEE---DVEDIEEFHEEEMENKKGNGGKELYCVVCGKKFKSEKQWKNHEQSKKHK 298

Query: 250 EKVADLRESFVDEDEVMADFGELDG--------EVEELGERFKDNVGVEEREIGSGVGGL 301
           EKVA+LRESF  EDE   + G  DG         V+E+ ERFKD V + + E G     L
Sbjct: 299 EKVAELRESFESEDE---NDGYFDGVEEDNHEHNVDEVEERFKDGVRITDEENGVENPEL 355

Query: 302 SGDEDVESEFFDVADGVEVNEVDDRFGKEDEDEDEDADDEVNMLKAMLSGHKNRKRVAVR 361
              ED    FFD  D  E+   +   G  DED+ ED D E+++L+AM++GHK+RK    R
Sbjct: 356 INKED---GFFDAEDFDEMEGSNVEDGNGDEDDVEDGDAEMSILEAMVTGHKSRKSRKAR 412

Query: 362 KEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKGDRDGFKSTNEE 421
              E   TE HV++   E    EY+N K+ RRK KKDRGK  G   A+GD D  KS +++
Sbjct: 413 HLGEHFPTEVHVDDVNEEPNVTEYNNRKTRRRKGKKDRGKSDGRVPARGDFDE-KSPDDK 471

Query: 422 ANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQPVDG-KGTKKDRKAKLKNSS 480
             G  +    EE SSHS V N+N+G  ++H  K+ +  DQPVD  +  KK+   K  NSS
Sbjct: 472 IEGLDDKRT-EEFSSHSFVENENDGNINDHLRKNHR-SDQPVDNQRAKKKESNTKSNNSS 529

Query: 481 KGNKTK 486
           KG K K
Sbjct: 530 KGKKGK 535

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481801|ref|XP_002278802.2| PREDICTED: dnaJ homolog subfamily C member 21-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449524982|ref|XP_004169500.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily C member 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441091|ref|XP_004138317.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511845|ref|XP_003524632.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Glycine max] Back     alignment and taxonomy information
>gi|15221189|ref|NP_177565.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|12324903|gb|AAG52405.1|AC020579_7 putative heat shock protein; 32627-30541 [Arabidopsis thaliana] gi|332197449|gb|AEE35570.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297839305|ref|XP_002887534.1| hypothetical protein ARALYDRAFT_339622 [Arabidopsis lyrata subsp. lyrata] gi|297333375|gb|EFH63793.1| hypothetical protein ARALYDRAFT_339622 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356562611|ref|XP_003549563.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Glycine max] Back     alignment and taxonomy information
>gi|443730435|gb|ELU15945.1| hypothetical protein CAPTEDRAFT_220238 [Capitella teleta] Back     alignment and taxonomy information
>gi|405968857|gb|EKC33886.1| DnaJ-like protein subfamily C member 21 [Crassostrea gigas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
TAIR|locus:2019647630 AT1G74250 [Arabidopsis thalian 0.734 0.569 0.354 3e-91
UNIPROTKB|F1LPX6533 Dnajc21 "Protein Dnajc21" [Rat 0.206 0.189 0.447 4.2e-36
UNIPROTKB|E2QZB7532 DNAJC21 "Uncharacterized prote 0.206 0.189 0.447 8.6e-36
UNIPROTKB|Q5F1R6531 DNAJC21 "DnaJ homolog subfamil 0.206 0.190 0.438 1.3e-35
UNIPROTKB|Q0II91533 DNAJC21 "DnaJ homolog subfamil 0.206 0.189 0.447 4.6e-35
DICTYBASE|DDB_G0286579 633 dnaja5 "DnaJ homolog subfamily 0.220 0.170 0.438 7e-35
UNIPROTKB|F1SND3533 DNAJC21 "Uncharacterized prote 0.206 0.189 0.443 6.7e-34
UNIPROTKB|G4N7F1548 MGG_03581 "Uncharacterized pro 0.184 0.164 0.479 8.7e-34
FB|FBgn0027599540 CG2790 [Drosophila melanogaste 0.202 0.183 0.462 2e-30
ZFIN|ZDB-GENE-030131-8928545 dnajc21 "DnaJ (Hsp40) homolog, 0.261 0.234 0.397 1.5e-26
TAIR|locus:2019647 AT1G74250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 3.0e-91, Sum P(2) = 3.0e-91
 Identities = 137/386 (35%), Positives = 189/386 (48%)

Query:   112 GPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVXXXXXXXXXXXX 171
             GPNRKSRR+MEEENKK RKKAKREYN+TVR LA FVKKRDKRV+DM+V            
Sbjct:   195 GPNRKSRRMMEEENKKSRKKAKREYNDTVRGLAEFVKKRDKRVIDMLVKKNAEMEKKKEE 254

Query:   172 XXXXXXXXXXXXXXXXXXYEEPAWARXXXXXXXXXXXXXXXXXXXXXKKRSE-FYCVLCG 230
                               YEEP WA+                     K+++E  YC++C 
Sbjct:   255 ERERKKKMEKERLERAMNYEEPEWAKAHEGEDEGAGLSELEEEDDDAKRKNEQLYCIVCS 314

Query:   231 KKFKSEKQWTNHEQSKKHKEKVADLRESFVD------EDEVMADFXXXXXXXXXXXXRFK 284
             KKFKSEKQW NHEQSKKHKEKVA+LRESF D      E+E+                  +
Sbjct:   315 KKFKSEKQWKNHEQSKKHKEKVAELRESFTDYEEENEEEEIDGPLDSPESVEELHEKLQE 374

Query:   285 D-NVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKXXXXXXXXXXXXVN 343
             + N+  EER++   V G   DE  + E+F VA+       +D  G             + 
Sbjct:   375 ELNIDNEERDVKKEVVG-EADE-TDDEYF-VAE-------EDMQGSSESEDEDDE---MT 421

Query:   344 MLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKN--KKDRGK 401
             +LK M+SG KN+++  V KE++  +TE  +E +   +EF E+DN KST R    K++R K
Sbjct:   422 LLKKMVSGQKNKQKNVVSKEEDEDETEVEIEGDT--AEFSEFDNQKSTGRNKEAKEERNK 479

Query:   402 KSGGEAAKGDRDGFKSTNEEANGHHNSGVIEESSSHSCVGNKNNGISDNHSEKDPKIPDQ 461
             ++ G     D    +   E  N   N    E +S       K+   S  +  +      +
Sbjct:   480 QNAGNDMADDTSKVQIPGEGGNPDENMNATESASGALADSQKDEANSMEYDNRK-STGRR 538

Query:   462 PVDGKGTKKDRKAKL-KNSSKGNKTK 486
                 KG  K+ + +L + SS+ + T+
Sbjct:   539 RRSKKGKDKNNQGELNEKSSEADDTQ 564
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
UNIPROTKB|F1LPX6 Dnajc21 "Protein Dnajc21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZB7 DNAJC21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F1R6 DNAJC21 "DnaJ homolog subfamily C member 21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0II91 DNAJC21 "DnaJ homolog subfamily C member 21" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286579 dnaja5 "DnaJ homolog subfamily A member 5" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND3 DNAJC21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G4N7F1 MGG_03581 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
FB|FBgn0027599 CG2790 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8928 dnajc21 "DnaJ (Hsp40) homolog, subfamily C, member 21" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
pfam0022663 pfam00226, DnaJ, DnaJ domain 7e-19
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-15
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 5e-15
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-14
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-14
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-13
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-13
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-13
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-12
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-12
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-12
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-12
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-12
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 7e-12
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-11
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-11
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-11
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-11
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 5e-11
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-10
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-10
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-10
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 6e-10
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 7e-10
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 9e-10
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 1e-09
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-09
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 4e-09
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-09
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 4e-08
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-08
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 5e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 6e-08
pfam1287425 pfam12874, zf-met, Zinc-finger of C2H2 type 2e-07
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-07
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 6e-07
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 4e-06
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 6e-06
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 7e-06
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-05
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 3e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 79.9 bits (198), Expect = 7e-19
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  CLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDP 66
            YE+LG+ ++ + +EI+ AY+KLAL+ HPDK          A  +F+E+  AYEVLSDP
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDP----AAEEKFKEINEAYEVLSDP 56

Query: 67 KERAWYD 73
          ++RA YD
Sbjct: 57 EKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 489
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.88
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.79
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14296372 chaperone protein DnaJ; Provisional 99.78
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PRK14286372 chaperone protein DnaJ; Provisional 99.74
PRK14287371 chaperone protein DnaJ; Provisional 99.73
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.73
PRK14298377 chaperone protein DnaJ; Provisional 99.72
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.71
PRK14276380 chaperone protein DnaJ; Provisional 99.71
PRK14282369 chaperone protein DnaJ; Provisional 99.71
PRK14297380 chaperone protein DnaJ; Provisional 99.7
PRK14285365 chaperone protein DnaJ; Provisional 99.7
PRK14277386 chaperone protein DnaJ; Provisional 99.7
PRK14278378 chaperone protein DnaJ; Provisional 99.7
PRK14280376 chaperone protein DnaJ; Provisional 99.7
PRK14294366 chaperone protein DnaJ; Provisional 99.7
PRK10767371 chaperone protein DnaJ; Provisional 99.69
PRK14279392 chaperone protein DnaJ; Provisional 99.68
PRK14301373 chaperone protein DnaJ; Provisional 99.68
PRK14283378 chaperone protein DnaJ; Provisional 99.67
PRK14295389 chaperone protein DnaJ; Provisional 99.67
PRK14299291 chaperone protein DnaJ; Provisional 99.67
PRK14291382 chaperone protein DnaJ; Provisional 99.67
KOG0718546 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PRK14290365 chaperone protein DnaJ; Provisional 99.66
PRK14281397 chaperone protein DnaJ; Provisional 99.66
PRK14284391 chaperone protein DnaJ; Provisional 99.66
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.66
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.65
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.63
PRK14300372 chaperone protein DnaJ; Provisional 99.63
PRK14289386 chaperone protein DnaJ; Provisional 99.63
PRK14292371 chaperone protein DnaJ; Provisional 99.62
PRK14293374 chaperone protein DnaJ; Provisional 99.62
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.59
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.56
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.54
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.52
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.51
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.48
PHA03102153 Small T antigen; Reviewed 99.44
PRK01356166 hscB co-chaperone HscB; Provisional 99.4
PRK05014171 hscB co-chaperone HscB; Provisional 99.37
PRK03578176 hscB co-chaperone HscB; Provisional 99.36
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.34
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.31
PRK00294173 hscB co-chaperone HscB; Provisional 99.3
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.25
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.14
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.11
PTZ00100116 DnaJ chaperone protein; Provisional 99.05
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.97
PHA02624 647 large T antigen; Provisional 98.95
PRK01773173 hscB co-chaperone HscB; Provisional 98.93
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.75
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.74
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 98.56
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.21
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.09
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.89
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 97.78
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.78
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 97.16
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.16
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 96.88
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.63
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 96.62
KOG4727193 consensus U1-like Zn-finger protein [General funct 96.25
KOG0431453 consensus Auxilin-like protein and related protein 96.17
KOG0724335 consensus Zuotin and related molecular chaperones 96.08
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.71
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.69
PLN02748468 tRNA dimethylallyltransferase 95.58
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.93
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.46
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.41
COG5188470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 93.64
KOG3032264 consensus Uncharacterized conserved protein [Funct 92.68
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.65
smart0035526 ZnF_C2H2 zinc finger. 91.46
KOG2837309 consensus Protein containing a U1-type Zn-finger a 90.21
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 90.15
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 89.29
PHA0276855 hypothetical protein; Provisional 87.47
KOG3454165 consensus U1 snRNP-specific protein C [RNA process 85.69
PHA0061644 hypothetical protein 82.43
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 81.01
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 80.26
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-59  Score=483.92  Aligned_cols=378  Identities=36%  Similarity=0.522  Sum_probs=276.1

Q ss_pred             CCCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhhhhhhcc
Q 011313            3 SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFS   82 (489)
Q Consensus         3 s~~~dyYevLGV~~~As~~eIKkAYRklalk~HPDKn~~~~~~~~~a~~~F~~I~~AYevLsDp~~R~~YD~~~~~~l~~   82 (489)
                      ..++|||+||||.++|++.+||++||+|||+||||+|  |. ..++|+++|++|+.||+|||||+.|+|||+|+.+||++
T Consensus         5 ~~~~c~YE~L~v~~~a~d~eik~~YRklALq~HPDkn--pd-~ieeat~~F~~i~aAYeVLSdp~eR~wyd~hreqil~~   81 (508)
T KOG0717|consen    5 FKKRCYYEVLGVERDADDDEIKKNYRKLALQYHPDKN--PD-RIEEATQQFQLIQAAYEVLSDPQERAWYDSHREQILRG   81 (508)
T ss_pred             hhhhHHHHHhcccccCCHHHHHHHHHHHHHhhCCCCC--Cc-cHHHHHHHHHHHHHHHHHhcChHhhhhHHHHHHHHhcC
Confidence            3679999999999999999999999999999999998  32 68899999999999999999999999999999999998


Q ss_pred             CCCCCCCCCCCCCcccccCCCCCCCCCCC---------------------------------------------------
Q 011313           83 DLNSASNCGPVPNLYSYFSNTAFSGYSDS---------------------------------------------------  111 (489)
Q Consensus        83 ~~~~~~~~~~~~dlf~ff~~~~f~g~~d~---------------------------------------------------  111 (489)
                      .....  +..+++||.||+.+||.||.++                                                   
T Consensus        82 ~~s~~--~~~~~dlf~ff~~~~y~gy~~~~~gfy~vy~dvf~~~~~~e~~~~~d~~~~ap~fg~~~t~ye~~~~fY~~W~  159 (508)
T KOG0717|consen   82 KNSDT--GVQIEDLFQFFTSSCYIGYENTSAGFYRVYQDVFNALASDELPFLGDSKLLYPLFGYSTTDYEQVVPFYQFWL  159 (508)
T ss_pred             CCCcc--ccchHHHHHHhhhhhhcccccccchhHHHHHHHHHHHhhhhhhhccCCccccccccCCCCcHHHHHHHHHHHH
Confidence            76633  4578899999999999988765                                                   


Q ss_pred             ------------------CCCcccchhhHHHhHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHhHHHHhHHHHHHHHHHHH
Q 011313          112 ------------------GPNRKSRRVMEEENKKLRKKAKREYNETVRELAAFVKKRDKRVMDMMVKKNEEIERKREEEK  173 (489)
Q Consensus       112 ------------------a~~R~~RR~mEkeNkk~r~k~kkeyn~~Ir~Lv~~~kkrDpRv~~~~~~~~~eeerkk~Ee~  173 (489)
                                        +++|..+|+|+++|+++|..++++||.+||.||.||++|||||+.++.++..+..+.+.++.
T Consensus       160 afsT~Ksf~W~d~Ydv~~~~~r~~~R~v~~enkk~rq~ak~eyNe~Vr~lv~fvkKrDpRvk~~l~~k~~E~~r~kqe~~  239 (508)
T KOG0717|consen  160 AFSTKKSFEWLDEYDVEEESDRFTRRLMERENKKQRQYARQEYNETVRNLVGFVKKRDPRVKAMLELKDAEAYRSKQEES  239 (508)
T ss_pred             hhhhhhhHHhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHHHHHHHHHHHHHHHHHHH
Confidence                              88999999999999999999999999999999999999999999977766666666444444


Q ss_pred             HHHHHHHHHHH--HHHhhhcchhhhhhccccCcccCCCcchhHHH-HhhccCcccccccccccCChHHHHHhhhhHHHHH
Q 011313          174 ERKKRLEKERM--ERAKRYEEPAWARIDDEGDNEVGNEEGLEEEE-IEKKRSEFYCVLCGKKFKSEKQWTNHEQSKKHKE  250 (489)
Q Consensus       174 ~rk~~~ek~r~--era~~~~e~~w~~~~e~ee~~~~~~~~~~ee~-~~~~~~~~~C~~C~K~Fks~~~~~nH~~SkkHk~  250 (489)
                      ++++...++..  .+...+....|+.+.+.++.+....+++.+.+ .+...+.+||+||+|+|+|++||.||++||||++
T Consensus       240 Rk~~~~~r~e~~e~r~n~~e~~~~~~~~e~ed~~e~~~d~~~e~de~d~~ge~lyC~vCnKsFKseKq~kNHEnSKKHke  319 (508)
T KOG0717|consen  240 RKQQLRKRREYAETRKNNGEGSEEALKEEIEDELEKSSDDETESDEADNEGEVLYCVVCNKSFKSEKQLKNHENSKKHKE  319 (508)
T ss_pred             HHHHHHHHHHHHHHHHhcccchHHHHHHHHHhhhhhccccchhhhhhhhcCCceEEeeccccccchHHHHhhHHHHHHHH
Confidence            43332222221  22222222344443333332222222222222 2334455999999999999999999999999999


Q ss_pred             HHHHHHHHhhhhhhhhhhcCCCchhhHHHhHHhhhccchhhhhhcCCCCCCCCCCccccchhcccccccccccccccCCC
Q 011313          251 KVADLRESFVDEDEVMADFGELDGEVEELGERFKDNVGVEEREIGSGVGGLSGDEDVESEFFDVADGVEVNEVDDRFGKE  330 (489)
Q Consensus       251 ~~~~l~~~~~~e~~~~~~~~~~e~~~~~l~~~l~~~l~~~~~e~~k~~~~~s~~~~~ere~~~e~~~~~~~e~d~~~~~~  330 (489)
                      +|.+|+++|.++++. +..+                           +.-     ..+.+.+.+           ++-.+
T Consensus       320 nv~eLrqemEEEe~d-~~~~---------------------------qae-----e~e~e~~se-----------ee~~~  355 (508)
T KOG0717|consen  320 NVAELRQEMEEEEED-EAQG---------------------------QAE-----ENELEDFSE-----------EEPED  355 (508)
T ss_pred             HHHHHHHHHHHhhhh-hhhh---------------------------ccc-----cchhhhhhh-----------hcccc
Confidence            999999999876420 0000                           000     012233322           11123


Q ss_pred             CCCCCcchhhhHHHHHHHHccccccccccccccccccccccccccccCCccccccccchhhhhhhhhhhccCCCCCCCCC
Q 011313          331 DEDEDEDADDEVNMLKAMLSGHKNRKRVAVRKEDEVLKTEAHVENEIGESEFMEYDNCKSTRRKNKKDRGKKSGGEAAKG  410 (489)
Q Consensus       331 ~~~~~e~~ddE~~~l~~m~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~n~k~~~~~~~~~~~~~~~~~~~~~  410 (489)
                      +.+.+++...++.-.+-|+|+..|-+-...+-...+-+.  +++.+.+..++.++++.|.++... +.|--.    ++..
T Consensus       356 d~ses~~~n~~~~~~k~~~s~d~n~~~n~~~E~~d~~~e--~~e~d~dtae~ee~d~qk~~~~~k-~~K~~~----D~k~  428 (508)
T KOG0717|consen  356 DPSESEYKNKEKDRDKKNVSFDENEKVNTFAEISDEDFE--PAEEDGDTAESEEFDQQKNKSVNK-KIKPCD----DKKD  428 (508)
T ss_pred             CCCCCchhhhHhhhhhcccchhhhhhhccccccccCCCc--ccccccccccchhhccccccchhh-hccccc----cchh
Confidence            344466667788889999999999877666655555333  346777778888999999966554 222211    4667


Q ss_pred             CCCCCCCCCcccCCCCCCCccccccC
Q 011313          411 DRDGFKSTNEEANGHHNSGVIEESSS  436 (489)
Q Consensus       411 ~~~~~~~~~~~~~~~~~~~~~e~~s~  436 (489)
                      .+.++..|....+.+++..+..+.|.
T Consensus       429 ~a~kvk~pk~~~~kd~~k~a~~~p~~  454 (508)
T KOG0717|consen  429 EAKKVKKPKGKVTKDNKKPATVAPSS  454 (508)
T ss_pred             hhhhccCCCCCCCCccCCCccCCCCC
Confidence            77788888777788888877766554

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG3032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 6e-10
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-08
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-08
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-08
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-08
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-07
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 4e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 5e-07
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 9e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-06
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-06
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-06
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 6e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-05
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-05
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 5e-05
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-04
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 4/71 (5%)
Query: 5  KRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLS 64
          K+  YE+LG+ K     EIR AYK+LA++ HPD+         EA A+F+E+  AYEVL+
Sbjct: 2  KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDR----NQGDKEAEAKFKEIKEAYEVLT 57
Query: 65 DPKERAWYDSH 75
          D ++RA YD +
Sbjct: 58 DSQKRAAYDQY 68
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 7e-19
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-18
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-16
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-16
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-16
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 5e-16
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-16
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 6e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-16
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 8e-16
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-15
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-15
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-15
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-15
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-15
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 5e-15
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-15
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 7e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 4e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-13
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-13
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 3e-13
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 5e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-09
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 6e-06
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 2e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 2e-05
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-05
2guz_A71 Mitochondrial import inner membrane translocase su 2e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 82.6 bits (204), Expect = 7e-19
 Identities = 24/109 (22%), Positives = 42/109 (38%), Gaps = 5/109 (4%)

Query: 3   SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKL--VQSGLSQAEATAQFQELVHAY 60
             K+  Y +LG        +++  Y+KL L  HPDK        +  E   +F E+  A+
Sbjct: 7   MPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAW 66

Query: 61  EVLSDPKERAWYDSHRSQILFSDLNSASNCGPVPNLYSYFSNTAFSGYS 109
           ++L + + +  YD  R +    DL +         L     N     + 
Sbjct: 67  KILGNEETKREYDLQRCE---DDLRNVGPVDAQVYLEEMSWNEGDHSFY 112
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 402 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.79
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.79
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.78
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.78
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.78
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.77
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.76
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.76
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.76
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.76
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.74
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.74
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.73
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.73
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.73
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.69
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.67
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.65
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.64
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.61
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.6
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.58
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.57
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.57
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.56
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.55
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.54
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.53
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.52
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.51
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.48
2guz_A71 Mitochondrial import inner membrane translocase su 99.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.86
2guz_B65 Mitochondrial import inner membrane translocase su 98.43
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 98.14
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.55
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 97.41
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.74
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 96.61
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.2
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 93.92
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 93.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 93.37
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 93.36
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 92.83
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 92.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 92.43
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 92.42
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 92.38
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 92.38
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 91.51
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.26
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.18
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.11
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 92.01
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.97
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.96
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 91.85
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 91.65
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.61
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.38
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 90.51
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 90.28
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 90.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 90.73
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.71
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.56
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 90.53
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 90.5
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.42
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.39
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.1
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.09
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 90.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.02
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 89.9
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.84
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.82
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.75
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.74
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.73
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.73
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.71
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.7
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.62
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 89.6
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.56
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 89.51
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 89.5
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.49
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.45
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 89.44
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.43
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.41
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.35
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 89.35
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.33
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.28
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.26
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.23
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.22
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.2
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.19
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 89.15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.14
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 89.14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.1
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 88.98
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.97
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 88.97
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.96
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.96
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.96
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 88.94
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 88.94
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.93
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.84
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 88.84
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.84
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.8
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.77
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 88.75
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.74
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 88.74
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.7
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.65
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.59
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.55
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 88.51
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.5
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.48
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.39
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.39
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.38
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.38
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.36
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.34
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 88.32
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.3
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 88.29
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.22
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.22
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 88.22
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.17
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 88.07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.87
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 87.87
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 87.84
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.83
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.79
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.78
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 87.74
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.67
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.64
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 87.61
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.57
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.5
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 87.27
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 87.25
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 87.22
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.16
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 87.07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.91
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.86
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 86.61
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 86.57
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 86.54
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 86.21
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.18
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 86.12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 85.56
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 85.48
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 85.22
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 84.46
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 84.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 84.26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 83.76
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 83.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 83.49
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 83.41
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 83.26
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 83.25
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 83.15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 82.9
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 82.15
2lv2_A85 Insulinoma-associated protein 1; structural genomi 81.49
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 81.23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 81.01
4f9c_B144 Protein DBF4 homolog A; Ser/Thr protein kinase, tr 80.84
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 80.82
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 80.58
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 80.38
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 80.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 80.26
2lv2_A85 Insulinoma-associated protein 1; structural genomi 80.25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 80.13
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=1.7e-19  Score=150.56  Aligned_cols=77  Identities=35%  Similarity=0.592  Sum_probs=69.4

Q ss_pred             CCCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhhhhhhcc
Q 011313            3 SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQILFS   82 (489)
Q Consensus         3 s~~~dyYevLGV~~~As~~eIKkAYRklalk~HPDKn~~~~~~~~~a~~~F~~I~~AYevLsDp~~R~~YD~~~~~~l~~   82 (489)
                      ....+||+||||++.|+..+||+|||+|+++||||+++     ...+...|+.|+.||+||+||..|..||..+..++.+
T Consensus         4 ~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~-----~~~a~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~~   78 (88)
T 2ctr_A            4 GSSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNK-----SPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTS   78 (88)
T ss_dssp             CCCCSHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCC-----SHHHHHHHHHHHHHHHHHHSSHHHHHHHHTCHHHHTC
T ss_pred             CCCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCC-----ChHHHHHHHHHHHHHHHHCCHHHHHHHHHhCcccccc
Confidence            45679999999999999999999999999999999982     3568999999999999999999999999999877664


Q ss_pred             CC
Q 011313           83 DL   84 (489)
Q Consensus        83 ~~   84 (489)
                      +.
T Consensus        79 ~~   80 (88)
T 2ctr_A           79 GK   80 (88)
T ss_dssp             SS
T ss_pred             CC
Confidence            43
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 489
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-11
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 5e-11
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 4e-10
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 6e-10
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-09
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 4e-08
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 6e-06
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 64.3 bits (156), Expect = 1e-13
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 3  SEKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLV--QSGLSQAEATAQFQELVHAY 60
          + K+  Y +LG        +++  Y+KL L  HPDK        +  E   +F E+  A+
Sbjct: 13 TLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAW 72

Query: 61 EVLSDPKERAWYDSHRS 77
          ++L + + +  YD  RS
Sbjct: 73 KILGNEETKKKYDLQRS 89
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.84
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.62
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.58
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.57
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.53
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.1
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 96.44
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 95.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.79
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 94.3
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.55
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 93.51
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.38
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 92.98
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.7
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.55
d2cota238 Zinc finger and SCAN domain-containing protein 16, 92.2
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 91.51
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 91.1
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 90.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.23
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 90.12
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.09
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.5
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.39
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.88
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 86.57
d1fu9a_36 U-shaped transcription factor, different fingers { 85.79
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 85.25
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 84.18
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 84.17
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 84.03
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 82.51
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 81.26
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.84  E-value=1.7e-21  Score=156.70  Aligned_cols=72  Identities=46%  Similarity=0.732  Sum_probs=65.0

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCcCCCCCChHHHHHHHHHHHHHHHHhcCchhhhhhhhhhhhh
Q 011313            4 EKRCLYEVLGLRKECTTDEIRSAYKKLALQRHPDKLVQSGLSQAEATAQFQELVHAYEVLSDPKERAWYDSHRSQI   79 (489)
Q Consensus         4 ~~~dyYevLGV~~~As~~eIKkAYRklalk~HPDKn~~~~~~~~~a~~~F~~I~~AYevLsDp~~R~~YD~~~~~~   79 (489)
                      +++|||+||||+++||..+||+|||+|+++||||+++  +  ...+...|..|+.||+||+||.+|..||.+|..+
T Consensus         1 ak~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~--~--~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           1 AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQ--G--DKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCT--T--TCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccC--C--ChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            3689999999999999999999999999999999983  2  3467889999999999999999999999987643
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure