Citrus Sinensis ID: 011435


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MKGTHLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
ccccEEEHHHHHHHHHHHcccccccccccEEEccccEEEEEcccccEEEcccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEEccccEEEEEcccccccccEEEEEEccccccccccccccccccccccEEEEcccccEEEEEccccEEEEEEcccEEEEEEcccccccccccccccccccccccEEEEccccEEEEEEccccEEEEEEcccccEEEEccccccccEEEEEEEEEEcEEEEEEEcccccEEEcccccccEEccccccEEEEcccccccccccccccccccccccccHHcccccEEEEEcccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEccccccccEEccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHccccHcccccccEEEccccEEEEEccccEEEEEccccEEEEEcccccccccccccccccccEEEEcccccEEEEEccccEEEEEccccccccEEEEEEEccccccccccccccHcEcccccEEEEcccccEEEEEccccEEEEEccccEEEEEEccccccccccccHHHHcccccccEEEEcccccEEEEEccccEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccEccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHcHccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccEEcccccccccccccccccEEEEcccccccccEEEEEcccccccccccccccccccccccc
MKGTHLLLTLTLLIAFTLQfqahaapagplIKHLTSLLKWttrssskapqadgnvlqfENGYLVETVIegneigvvpykirvsedgelfavdevnsnivkitpplsqysrgrlvagsfqgytghvdgkpnearfnhpkgvtmddkgnlyVADTLNLAIRKIGdagvttiaggksnvagfrdgpsedakfsndfdvvyvrptcsLLVIDRGNAALRQISlnqddceyqynsisptdILMVVGAVLVGYVTCMLqqgfgpfffsrtqqpsesefneETEIKelsnkekpipivesmkeepgwpsfgQLIIDLSKLALEAMGSMFlnfvpfrfrssgtkgnltplrdtlrmpedeaappvvqrqksavplsethqvrtpgtgdkypdmkppkiksasfkdsslstkhrsSKRQEYAEfygsgevpppysksksqkertrhrqrdksgelvygvsgmepkpvemkpvdydnlkfdhynmrskygddsyrf
MKGTHLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRssskapqadgnvlQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKitpplsqysrgRLVAGSFQGytghvdgkpnearfNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNeeteikelsnkekpiPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPpvvqrqksavplsethqvrtpgtgdkypdmkppkiksasfkdsslstkhrsskRQEYAefygsgevpppysksksqkertrhrqrdksgelvygvsgmepkpvemkpvdydnlkfdhynmrskygddsyrf
MKGthllltltlliaftlQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
****HLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTT**********GNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVD************GVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGF********KFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFS************************************GWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFR***********************************************************************************************************************************************************
***THLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPS**********************************FGQLIIDLSKLALEAMGSMFLNFV*******************LRMPEDEAA******************************************************************************************ELVYGVSGMEP*PVEMKPVDYDNLKFDHYNMRSKY*******
MKGTHLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWT********QADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRT****************LSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDE****************************KYPDMKPPKIKS*******************YAEFYGSG************************GELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
*KGTHLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSR**********************KPIPIVES*KEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRS**TKGNLTPLRDTLRMPEDEAAPPVV************************************************************************************SGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGTHLLLTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q5ZI67727 NHL repeat-containing pro yes no 0.240 0.160 0.309 0.0008
>sp|Q5ZI67|NHLC2_CHICK NHL repeat-containing protein 2 OS=Gallus gallus GN=NHLRC2 PE=2 SV=1 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 9/126 (7%)

Query: 75  VVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARF 134
           + P K+ V + GE   + +   + + +T        G+++       +G  DG+ +EA F
Sbjct: 219 LFPGKVTVDKSGERLVIADTGHHRILVT-----LKNGQILHTIGGPNSGRKDGRFSEAAF 273

Query: 135 NHPKGVTMDDKGNLYVADTLNLAIRKIGDAG--VTTIAG-GKSNVAGFRDGPSEDAKFSN 191
           N P+GV + +   +YVADT N  IRKI      VTT+AG G   V        E+   S+
Sbjct: 274 NSPQGVAIKNN-VIYVADTENHLIRKIDLELEIVTTVAGIGIQGVDKEGGAKGEEQPISS 332

Query: 192 DFDVVY 197
            +DVV+
Sbjct: 333 PWDVVF 338





Gallus gallus (taxid: 9031)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
255567088484 conserved hypothetical protein [Ricinus 0.985 0.989 0.761 0.0
356549639487 PREDICTED: uncharacterized protein LOC10 0.973 0.971 0.723 0.0
225461726484 PREDICTED: uncharacterized protein LOC10 0.979 0.983 0.727 0.0
357452081493 hypothetical protein MTR_2g075860 [Medic 0.973 0.959 0.682 0.0
224117004460 predicted protein [Populus trichocarpa] 0.936 0.989 0.688 0.0
449438911480 PREDICTED: uncharacterized protein LOC10 0.950 0.962 0.666 0.0
224117390495 predicted protein [Populus trichocarpa] 0.948 0.931 0.65 0.0
42572439493 NHL domain-containing protein [Arabidops 0.942 0.929 0.663 1e-173
297834352489 NHL repeat-containing protein [Arabidops 0.942 0.936 0.663 1e-173
22331093492 NHL domain-containing protein [Arabidops 0.940 0.928 0.661 1e-171
>gi|255567088|ref|XP_002524526.1| conserved hypothetical protein [Ricinus communis] gi|223536200|gb|EEF37853.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/491 (76%), Positives = 410/491 (83%), Gaps = 12/491 (2%)

Query: 1   MKGTHLL----LTLTLLIAFTLQFQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVL 56
           M+ +HL     L LTL +AF LQFQAHAAPAGPLIKH +S LKWT RSSSK PQ+DGNVL
Sbjct: 1   MRRSHLFYFAPLLLTLFLAFNLQFQAHAAPAGPLIKHFSSFLKWTARSSSKTPQSDGNVL 60

Query: 57  QFENGYLVETVIEGNEIGVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAG 116
           QFE+GYLVETV+EGNEIGVVPYKIRVSEDGEL+AVDEVNSNIVKITPPLSQYSR RLVAG
Sbjct: 61  QFEDGYLVETVVEGNEIGVVPYKIRVSEDGELYAVDEVNSNIVKITPPLSQYSRARLVAG 120

Query: 117 SFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNV 176
           SFQGY GHVDGK NEARFNHPKG+TMDDKGN+YVADTLNLAIRKIGDAGVTTIAGGKSN 
Sbjct: 121 SFQGYKGHVDGKSNEARFNHPKGITMDDKGNVYVADTLNLAIRKIGDAGVTTIAGGKSNT 180

Query: 177 AGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDI 236
           AG+RDGPSEDAKFS DFDVVYV  TCSLLV+DRGN ALRQISLNQ+DC+YQ +SI+ TD+
Sbjct: 181 AGYRDGPSEDAKFSTDFDVVYVHSTCSLLVVDRGNVALRQISLNQEDCDYQSSSITVTDL 240

Query: 237 LMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKE 296
           LMVVGAV  GYVTCMLQQGFGP FFS+TQ  SES      EI E  + EKP PI  SMKE
Sbjct: 241 LMVVGAVFTGYVTCMLQQGFGPSFFSKTQHFSES------EILEHQSMEKPTPITGSMKE 294

Query: 297 EPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPP 356
           EP WPSFGQL+IDLSKL LEA+  MFL  +P   RS+G++  LTPL+DTLRMPEDE  PP
Sbjct: 295 EPRWPSFGQLMIDLSKLTLEALADMFLYLIPSWLRSNGSRKGLTPLKDTLRMPEDEVEPP 354

Query: 357 VVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFY 416
            V RQ  +VPLSET QV  P   DKY +MKPPKIKSASFKD SLS+KHRSSKRQEYAEFY
Sbjct: 355 SVHRQSISVPLSETRQVHNPNASDKYSEMKPPKIKSASFKDPSLSSKHRSSKRQEYAEFY 414

Query: 417 GSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMR 476
           GSGE+P    +SKS KE+TRHRQRDKSGE+    +G EPKPV MK VDYDN KFDHYNMR
Sbjct: 415 GSGEMPSS-GRSKSHKEKTRHRQRDKSGEVAPAATGAEPKPVNMKHVDYDNPKFDHYNMR 473

Query: 477 SKYGD-DSYRF 486
           SKYG  +SY+F
Sbjct: 474 SKYGSGNSYQF 484




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356549639|ref|XP_003543199.1| PREDICTED: uncharacterized protein LOC100797841 [Glycine max] Back     alignment and taxonomy information
>gi|225461726|ref|XP_002285515.1| PREDICTED: uncharacterized protein LOC100245328 [Vitis vinifera] gi|302142876|emb|CBI20171.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357452081|ref|XP_003596317.1| hypothetical protein MTR_2g075860 [Medicago truncatula] gi|355485365|gb|AES66568.1| hypothetical protein MTR_2g075860 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224117004|ref|XP_002317450.1| predicted protein [Populus trichocarpa] gi|222860515|gb|EEE98062.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438911|ref|XP_004137231.1| PREDICTED: uncharacterized protein LOC101210502 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224117390|ref|XP_002331700.1| predicted protein [Populus trichocarpa] gi|222874306|gb|EEF11437.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42572439|ref|NP_974315.1| NHL domain-containing protein [Arabidopsis thaliana] gi|332642057|gb|AEE75578.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834352|ref|XP_002885058.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330898|gb|EFH61317.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22331093|ref|NP_188104.2| NHL domain-containing protein [Arabidopsis thaliana] gi|20260314|gb|AAM13055.1| unknown protein [Arabidopsis thaliana] gi|25083516|gb|AAN72090.1| unknown protein [Arabidopsis thaliana] gi|332642056|gb|AEE75577.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
TAIR|locus:2099357493 AT3G14860 "AT3G14860" [Arabido 0.921 0.908 0.669 1.4e-158
TAIR|locus:2016189509 AT1G70280 "AT1G70280" [Arabido 0.913 0.872 0.362 1.7e-68
TAIR|locus:2199862545 AT1G23880 "AT1G23880" [Arabido 0.806 0.719 0.393 5.8e-66
TAIR|locus:2147780 754 AT5G14890 [Arabidopsis thalian 0.746 0.481 0.359 4.8e-55
TAIR|locus:2199872400 AT1G23890 "AT1G23890" [Arabido 0.407 0.495 0.425 2.2e-34
TAIR|locus:20107281055 AT1G56500 [Arabidopsis thalian 0.292 0.134 0.306 0.0002
TAIR|locus:2099357 AT3G14860 "AT3G14860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1545 (548.9 bits), Expect = 1.4e-158, P = 1.4e-158
 Identities = 320/478 (66%), Positives = 373/478 (78%)

Query:    20 FQAHAAPAGPLIKHLTSLLKWTTRSSSKAPQADGNVLQFENGYLVETVIEGNEIGVVPYK 79
             FQA AAP+G LIKH++S+LKWTT SSSK  Q+D NVLQFENGYLVETV+EGN+IGVVPYK
Sbjct:    35 FQAQAAPSGSLIKHMSSVLKWTTGSSSKLSQSDTNVLQFENGYLVETVVEGNDIGVVPYK 94

Query:    80 IRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKG 139
             IRVS+DGEL+AVDE+NSNI+KITPPLSQYSRGRLVAGSFQG TGH DGKP+EARFNHP+G
Sbjct:    95 IRVSDDGELYAVDELNSNIMKITPPLSQYSRGRLVAGSFQGKTGHADGKPSEARFNHPRG 154

Query:   140 VTMDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVR 199
             VTMDDKGN+YVADTLNLAIRKIGD+GVTTIAGGKSN+AG+RDGPSEDAKFSNDFDVVYVR
Sbjct:   155 VTMDDKGNVYVADTLNLAIRKIGDSGVTTIAGGKSNIAGYRDGPSEDAKFSNDFDVVYVR 214

Query:   200 PTCSLLVIDRGNAALRQISLNQDDCEYQYNS-ISPTDILMVVGAVLVGYVTCMLQQGFGP 258
             PTCSLLVIDRGNAALRQISL+++DC+YQ +S IS TDIL+V+GAVL+GY TCMLQQGFG 
Sbjct:   215 PTCSLLVIDRGNAALRQISLSEEDCDYQDDSSISLTDILLVIGAVLIGYATCMLQQGFGN 274

Query:   259 FFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAM 318
              FFS+TQ  SE+ + EE   KE     +P+      KEEPGWPSFGQL+ DL KLALE +
Sbjct:   275 SFFSKTQVGSETSYEEEHPGKE--KLSRPVHEKTITKEEPGWPSFGQLLTDLCKLALEFI 332

Query:   319 GSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGT 378
              S   + VP RF+   T  NL PL+D L MPEDE  PP VQR  +  P+SE+     P  
Sbjct:   333 TS---HLVPARFQ---TNPNLRPLKDRLIMPEDEQEPPRVQRHTAPAPISESRHAHLPKA 386

Query:   379 GDKYPDMKPPKIKSAS-FKDSSLSTK--HR-SSKRQEYAEFYGSGEVPPPYSKSKSQKER 434
              D YP+ K PK++S+S  KD +LS+   HR SSKRQ+YA+FY SGEV  P    K  KER
Sbjct:   387 DDSYPEHKTPKLRSSSVMKDPTLSSSKHHRTSSKRQDYAQFYASGEVAQP----KIHKER 442

Query:   435 TRHRQRDKSGELVYGVSGMEPKPVE---MKPVDYDNL-KFDHYNMRS-KYGDDS-YRF 486
             +R R RDK+ E        EPKP     +KPV+Y N  KFDHYNMRS KYG ++ +RF
Sbjct:   443 SRRRHRDKTTET-------EPKPTPSDTVKPVEYSNSSKFDHYNMRSSKYGPETPFRF 493




GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
TAIR|locus:2016189 AT1G70280 "AT1G70280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199862 AT1G23880 "AT1G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147780 AT5G14890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199872 AT1G23890 "AT1G23890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027848001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (484 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 3e-10
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 1e-05
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 2e-04
pfam0143628 pfam01436, NHL, NHL repeat 4e-04
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score = 62.2 bits (151), Expect = 3e-10
 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 5/103 (4%)

Query: 123 GHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAG--VTTIAGGKSNVAGFR 180
           G  DG  +E    HP GV     G +YVAD+ N  I+K+  A   VTT+AG  +  AGF+
Sbjct: 792 GDHDGVGSEVLLQHPLGVLCAKDGQIYVADSYNHKIKKLDPATKRVTTLAG--TGKAGFK 849

Query: 181 DGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDD 223
           DG +  A+ S    +        L V D  N+ +R + LN+ +
Sbjct: 850 DGKALKAQLSEPAGLALG-ENGRLFVADTNNSLIRYLDLNKGE 891


Length = 1057

>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|110440 pfam01436, NHL, NHL repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.7
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.48
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.42
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 99.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.24
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.03
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.98
COG3391381 Uncharacterized conserved protein [Function unknow 98.67
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.64
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.64
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 98.57
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 98.54
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.5
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.4
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.36
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.36
COG3391381 Uncharacterized conserved protein [Function unknow 98.32
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.29
KOG12141289 consensus Nidogen and related basement membrane pr 98.25
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.16
PRK11028330 6-phosphogluconolactonase; Provisional 98.11
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.11
PRK11028330 6-phosphogluconolactonase; Provisional 98.06
KOG12141289 consensus Nidogen and related basement membrane pr 98.01
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 97.92
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.74
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 97.72
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.67
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.41
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.4
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 97.31
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.3
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.29
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.14
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.12
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.1
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.03
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.99
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.97
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 96.94
PF13449326 Phytase-like: Esterase-like activity of phytase 96.88
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 96.75
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.51
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.51
PRK02888635 nitrous-oxide reductase; Validated 96.4
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 96.37
PF05787524 DUF839: Bacterial protein of unknown function (DUF 96.34
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.29
COG3211616 PhoX Predicted phosphatase [General function predi 95.87
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 95.49
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.47
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 95.35
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 95.34
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 95.28
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.06
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.01
PF13449326 Phytase-like: Esterase-like activity of phytase 94.95
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 94.9
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.6
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.6
KOG1215877 consensus Low-density lipoprotein receptors contai 93.84
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.73
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 93.45
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 93.28
PRK02888635 nitrous-oxide reductase; Validated 93.11
KOG0266456 consensus WD40 repeat-containing protein [General 92.91
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 92.44
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 91.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 91.88
COG3211616 PhoX Predicted phosphatase [General function predi 91.49
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.67
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 90.57
KOG0266456 consensus WD40 repeat-containing protein [General 90.02
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 89.78
PRK03629429 tolB translocation protein TolB; Provisional 89.7
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 89.62
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 89.42
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 89.39
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 88.12
smart00284255 OLF Olfactomedin-like domains. 87.32
PRK04792448 tolB translocation protein TolB; Provisional 87.0
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 86.53
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 86.41
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 86.31
PRK01742429 tolB translocation protein TolB; Provisional 86.16
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.95
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 84.41
PRK02889427 tolB translocation protein TolB; Provisional 83.99
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 83.73
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 83.67
KOG1215877 consensus Low-density lipoprotein receptors contai 83.42
PTZ00421493 coronin; Provisional 82.56
PRK03629429 tolB translocation protein TolB; Provisional 82.35
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 82.17
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 81.85
PRK05137435 tolB translocation protein TolB; Provisional 81.72
PRK04792448 tolB translocation protein TolB; Provisional 81.63
PRK04922433 tolB translocation protein TolB; Provisional 81.57
COG3823262 Glutamine cyclotransferase [Posttranslational modi 80.64
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 80.45
PRK00178430 tolB translocation protein TolB; Provisional 80.27
PRK05137435 tolB translocation protein TolB; Provisional 80.15
PRK04043419 tolB translocation protein TolB; Provisional 80.12
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
Probab=99.70  E-value=4.7e-16  Score=181.13  Aligned_cols=142  Identities=34%  Similarity=0.465  Sum_probs=117.6

Q ss_pred             CccceeEEEccCCe-EEEEECCCCEEEEEcCCCCcccccEEEeccc------CCccccCCCCccccccCCcceEEEcCCC
Q 011435           74 GVVPYKIRVSEDGE-LFAVDEVNSNIVKITPPLSQYSRGRLVAGSF------QGYTGHVDGKPNEARFNHPKGVTMDDKG  146 (486)
Q Consensus        74 ~~~P~GlAVd~dG~-LYVaD~~n~rI~kid~~g~~~~~~~~vaG~~------~G~~G~~dG~~~~a~Ln~P~GIavD~dG  146 (486)
                      +..|.||+++++|+ |||+|..+++|++++.++.   ...+++|..      ....|..+|....+.|++|.||++|++|
T Consensus       739 ~~~P~GIavspdG~~LYVADs~n~~Irv~D~~tg---~~~~~~gg~~~~~~~l~~fG~~dG~g~~~~l~~P~Gvavd~dG  815 (1057)
T PLN02919        739 FAQPSGISLSPDLKELYIADSESSSIRALDLKTG---GSRLLAGGDPTFSDNLFKFGDHDGVGSEVLLQHPLGVLCAKDG  815 (1057)
T ss_pred             ccCccEEEEeCCCCEEEEEECCCCeEEEEECCCC---cEEEEEecccccCcccccccCCCCchhhhhccCCceeeEeCCC
Confidence            46899999999987 9999999999999998743   234444421      1123434555556789999999999999


Q ss_pred             CEEEEeCCCCEEEEEcCCC--ceEEcCCCCCCCCcCCCCccccccCCCceeEEEcCCCeEEEEeCCCCeEEEEECCC
Q 011435          147 NLYVADTLNLAIRKIGDAG--VTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQ  221 (486)
Q Consensus       147 ~LYVAD~~n~rIrkid~~G--v~tiaGg~~g~~G~~DG~~~~a~f~~P~gIa~vd~~G~LYVaD~gn~rIr~id~~G  221 (486)
                      +|||||..|++|++||.++  +.+++|.  +..||.||....+.|+.|.+|+ ++++|+|||+|.+|++|++|+++.
T Consensus       816 ~LYVADs~N~rIrviD~~tg~v~tiaG~--G~~G~~dG~~~~a~l~~P~GIa-vd~dG~lyVaDt~Nn~Irvid~~~  889 (1057)
T PLN02919        816 QIYVADSYNHKIKKLDPATKRVTTLAGT--GKAGFKDGKALKAQLSEPAGLA-LGENGRLFVADTNNSLIRYLDLNK  889 (1057)
T ss_pred             cEEEEECCCCEEEEEECCCCeEEEEecc--CCcCCCCCcccccccCCceEEE-EeCCCCEEEEECCCCEEEEEECCC
Confidence            9999999999999999876  7888875  5568888888889999999998 788999999999999999999975



>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1215 consensus Low-density lipoprotein receptors containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
3hrp_A409 Crystal Structure Of Structural Genomics Protein Of 1e-06
>pdb|3HRP|A Chain A, Crystal Structure Of Structural Genomics Protein Of Unknown Function (np_812590.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.70 A Resolution Length = 409 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 41/125 (32%), Positives = 60/125 (48%), Gaps = 11/125 (8%) Query: 77 PYKIRVSEDGELFAVDEVNSNIVKITPP-LSQYSRGRLVAGSFQGYTGHVDGKPNEARFN 135 PY I D + D+ S++ KITP ++ G + Q DG EA F Sbjct: 270 PYLIYYFVDSNFYXSDQNLSSVYKITPDGECEWFCGSATQKTVQ------DGLREEALFA 323 Query: 136 HPKGVTMDDKGNLYVADTL-NLAIRK--IGDAGVTTIAGGKSNVAGFRDGPSEDAKFSND 192 P G T+D+ GN Y+ D +RK I D V+T+A G+ +VA DG +A F+ Sbjct: 324 QPNGXTVDEDGNFYIVDGFKGYCLRKLDILDGYVSTVA-GQVDVASQIDGTPLEATFNYP 382 Query: 193 FDVVY 197 +D+ Y Sbjct: 383 YDICY 387

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 1e-32
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 2e-16
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 5e-14
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 3e-08
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 9e-32
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 3e-06
3kya_A496 Putative phosphatase; structural genomics, joint c 5e-25
3kya_A496 Putative phosphatase; structural genomics, joint c 4e-16
3kya_A496 Putative phosphatase; structural genomics, joint c 3e-04
3kya_A496 Putative phosphatase; structural genomics, joint c 6e-04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 1e-12
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 2e-11
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 8e-11
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 4e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-11
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 6e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 8e-09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-08
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 3e-06
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 4e-11
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 3e-08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 6e-07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 6e-05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 7e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 9e-11
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 1e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 7e-10
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-08
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 6e-04
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 2e-07
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 5e-07
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 1e-05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 4e-05
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 6e-05
2p4o_A306 Hypothetical protein; putative lactonase, structur 6e-04
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
 Score =  127 bits (321), Expect = 1e-32
 Identities = 46/178 (25%), Positives = 75/178 (42%), Gaps = 16/178 (8%)

Query: 51  ADGNVLQFENGYLVETVIEGNE------IGVVPYKIRVSEDGELFAVDEVNSNIVKITPP 104
           ++ N  +F       T+I+  E          PY I    D   +  D+  S++ KITP 
Sbjct: 238 SNKNFGRFNVKTQEVTLIKQLELSGSLGTNPGPYLIYYFVDSNFYMSDQNLSSVYKITPD 297

Query: 105 LSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTL-NLAIRKI-- 161
                      GS        DG   EA F  P G+T+D+ GN Y+ D      +RK+  
Sbjct: 298 ----GECEWFCGS-ATQKTVQDGLREEALFAQPNGMTVDEDGNFYIVDGFKGYCLRKLDI 352

Query: 162 GDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISL 219
            D  V+T+AG + +VA   DG   +A F+  +D+          + +    A+R+ ++
Sbjct: 353 LDGYVSTVAG-QVDVASQIDGTPLEATFNYPYDIC-YDGEGGYWIAEAWGKAIRKYAV 408


>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
3kya_A496 Putative phosphatase; structural genomics, joint c 99.88
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.83
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.8
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.8
3kya_A496 Putative phosphatase; structural genomics, joint c 99.72
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.71
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.69
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.67
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.57
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.54
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.53
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.51
3v65_B386 Low-density lipoprotein receptor-related protein; 99.5
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.5
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.49
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.48
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.47
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.47
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.46
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.44
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.44
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.43
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.42
3v65_B386 Low-density lipoprotein receptor-related protein; 99.42
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.4
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 99.4
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.38
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.36
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.35
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.34
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.33
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.33
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.27
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.24
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.23
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.21
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.2
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.18
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.18
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.16
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.15
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.15
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.13
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.05
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.02
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.01
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.99
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.98
2qe8_A343 Uncharacterized protein; structural genomics, join 98.97
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.93
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.91
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.9
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.9
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.89
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.88
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.88
2qe8_A343 Uncharacterized protein; structural genomics, join 98.86
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.83
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.79
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.76
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.71
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.7
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.69
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.68
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.65
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.64
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.59
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.56
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.49
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.48
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.48
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.45
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 98.44
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.43
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.4
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.3
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.3
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 98.26
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.24
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.23
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.19
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 98.19
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.18
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.14
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.12
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.09
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.08
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.07
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.06
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.04
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.02
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.02
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.93
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.93
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.91
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.87
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.85
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.84
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.77
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.74
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.74
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.73
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.72
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.71
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.67
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.62
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.61
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.6
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.52
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.51
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.48
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.37
2ece_A462 462AA long hypothetical selenium-binding protein; 97.35
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.33
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.3
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.19
2ece_A462 462AA long hypothetical selenium-binding protein; 97.11
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.09
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.07
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.01
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 96.97
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.89
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.89
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.78
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 96.7
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.64
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.6
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 96.47
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 96.32
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.23
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.04
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 95.89
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.73
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.53
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.39
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.38
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.24
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.14
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.0
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.41
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.21
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.15
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.99
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 93.86
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.84
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.64
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.63
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 93.56
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.5
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.43
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.42
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.4
4a2l_A795 BT_4663, two-component system sensor histidine kin 93.28
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.25
4a2l_A795 BT_4663, two-component system sensor histidine kin 92.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 92.92
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.84
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 92.84
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.79
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.65
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 92.64
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 92.61
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.4
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 92.37
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.23
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 92.05
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 91.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 91.93
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 91.7
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.65
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 91.5
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 91.44
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.43
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.4
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 91.27
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 91.24
3ott_A758 Two-component system sensor histidine kinase; beta 91.02
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 90.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.83
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.75
4g56_B357 MGC81050 protein; protein arginine methyltransfera 90.73
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.72
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 90.58
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.51
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 90.5
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 90.46
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 90.37
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.36
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 90.24
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.19
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 90.17
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 89.99
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 89.76
4g56_B357 MGC81050 protein; protein arginine methyltransfera 89.71
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 89.67
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 89.58
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 89.4
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 89.31
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 89.04
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 88.76
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 88.48
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 88.37
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 87.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 87.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 87.81
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 87.7
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 87.26
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 87.24
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 87.21
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.98
3jrp_A379 Fusion protein of protein transport protein SEC13 86.8
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 86.57
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.48
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 86.44
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 86.0
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 85.91
2pm7_B297 Protein transport protein SEC13, protein transport 85.7
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 85.34
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 85.31
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 84.55
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 84.42
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 84.33
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 84.22
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 84.18
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 84.14
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 84.02
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 83.95
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 83.89
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 83.79
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 83.39
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 83.32
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 83.25
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 83.24
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 83.08
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 83.01
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 82.7
3jrp_A379 Fusion protein of protein transport protein SEC13 82.69
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 82.05
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 81.94
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 81.92
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 81.82
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.57
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 80.52
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 80.18
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.88  E-value=2.5e-22  Score=215.05  Aligned_cols=150  Identities=25%  Similarity=0.319  Sum_probs=125.7

Q ss_pred             ccceeEEEccCCe-EEEEECCCCEEEEEcCCCCc--ccccEEEecccCCccccCCCCccccccCCcc-eEEEc-------
Q 011435           75 VVPYKIRVSEDGE-LFAVDEVNSNIVKITPPLSQ--YSRGRLVAGSFQGYTGHVDGKPNEARFNHPK-GVTMD-------  143 (486)
Q Consensus        75 ~~P~GlAVd~dG~-LYVaD~~n~rI~kid~~g~~--~~~~~~vaG~~~G~~G~~dG~~~~a~Ln~P~-GIavD-------  143 (486)
                      ..|++|+++++|+ |||+|+.+|+|++++.++..  .....+++|. .|..|+.||.+..++|+.|. |+++|       
T Consensus       310 ~~p~~ia~~p~G~~lYvaD~~~h~I~kid~dg~~~~~~~~~~~aG~-~g~~G~~DG~~~~a~f~~P~~gv~vd~~~~~~~  388 (496)
T 3kya_A          310 SWEFQIFIHPTGKYAYFGVINNHYFMRSDYDEIKKEFITPYNFVGG-YKQSGYRDDVGTEARMNNPCQGVFVKNPDYTGE  388 (496)
T ss_dssp             SCCEEEEECTTSSEEEEEETTTTEEEEEEEETTTTEECCCEEEEEB-TTBCCCBCCBGGGCBCSSEEEEEEEECTTCCSS
T ss_pred             CCceEEEEcCCCCEEEEEeCCCCEEEEEecCCCcceecccEEecCC-CCCCcccCCcccccccCCCeEEEEEcccccccc
Confidence            4589999999998 99999999999999877532  1123678886 35677788988999999999 89998       


Q ss_pred             CCCCEEEEeCCCCEEEEEcCCC-ceEEcCCCCC-------CCCcCCC-CccccccCCCceeEEEcCC-CeEEEEeCCCCe
Q 011435          144 DKGNLYVADTLNLAIRKIGDAG-VTTIAGGKSN-------VAGFRDG-PSEDAKFSNDFDVVYVRPT-CSLLVIDRGNAA  213 (486)
Q Consensus       144 ~dG~LYVAD~~n~rIrkid~~G-v~tiaGg~~g-------~~G~~DG-~~~~a~f~~P~gIa~vd~~-G~LYVaD~gn~r  213 (486)
                      .+|+|||||+.|||||+|+++| +++++|....       .+||.|| ++..++|+.|.+|+ ++++ |+|||+|.+|+|
T Consensus       389 ~~g~lyVaD~~N~rIr~i~~~G~v~TiaG~g~~~~~~~~~~~G~~dG~~~~~a~f~~P~gIa-vd~~~g~lyVaD~~N~r  467 (496)
T 3kya_A          389 EEYDFYFVDRLNFCVRKVTPEGIVSTYAGRGASTSLADGNQWGTDDGDLREVARFRDVSGLV-YDDVKEMFYVHDQVGHT  467 (496)
T ss_dssp             CCEEEEEEEGGGTEEEEECTTCBEEEEEESCTTHHHHHSCSCCCCCEETTTTCCCSSEEEEE-EETTTTEEEEEETTTTE
T ss_pred             CCCeEEEEECCCCEEEEEeCCCCEEEEecccccccccCccccccCCCCchhhhhcCCCcEEE-EECCCCEEEEEeCCCCE
Confidence            7899999999999999999999 8999987431       1478888 88999999999998 5664 999999999999


Q ss_pred             EEEEECCCCceee
Q 011435          214 LRQISLNQDDCEY  226 (486)
Q Consensus       214 Ir~id~~G~~~~~  226 (486)
                      ||+|+++++.|.-
T Consensus       468 Irki~~~~~~~~~  480 (496)
T 3kya_A          468 IRTISMEQEENVA  480 (496)
T ss_dssp             EEEEEECCCC---
T ss_pred             EEEEECCCCcccc
Confidence            9999999876544



>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d1q7fa_279 b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (D 5e-06
d1rwia_260 b.68.9.1 (A:) Serine/threonine-protein kinase PknD 2e-05
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 279 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 45.8 bits (107), Expect = 5e-06
 Identities = 19/84 (22%), Positives = 32/84 (38%), Gaps = 6/84 (7%)

Query: 120 GYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADTLNLAIRKIGDAG-VTTIAGGKSNVAG 178
           G  G ++G+     F  P GV ++ + ++ VADT N  I+     G      G       
Sbjct: 13  GEFGVMEGQ-----FTEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDS 67

Query: 179 FRDGPSEDAKFSNDFDVVYVRPTC 202
               P+  A   N  D++    + 
Sbjct: 68  QLLYPNRVAVVRNSGDIIVTERSP 91


>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.62
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.62
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.6
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.44
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.42
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.34
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.34
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.29
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.27
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.17
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.17
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.08
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.99
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.81
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.23
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.16
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.09
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.07
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.05
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.81
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.81
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.73
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.73
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.59
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.58
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.39
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.3
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.21
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.21
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.04
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.9
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.89
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.41
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.36
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.35
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.29
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.99
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 95.97
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.81
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.46
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 94.28
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.23
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.17
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.38
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.25
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 92.21
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.23
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.18
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 90.17
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 89.31
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 88.63
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 87.88
d1tbga_340 beta1-subunit of the signal-transducing G protein 87.79
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 87.42
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 85.98
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 85.94
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 83.51
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.09
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 80.94
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Serine/threonine-protein kinase PknD
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.63  E-value=1e-15  Score=145.83  Aligned_cols=116  Identities=20%  Similarity=0.331  Sum_probs=96.7

Q ss_pred             CccceeEEEccCCeEEEEECCCCEEEEEcCCCCcccccEEEecccCCccccCCCCccccccCCcceEEEcCCCCEEEEeC
Q 011435           74 GVVPYKIRVSEDGELFAVDEVNSNIVKITPPLSQYSRGRLVAGSFQGYTGHVDGKPNEARFNHPKGVTMDDKGNLYVADT  153 (486)
Q Consensus        74 ~~~P~GlAVd~dG~LYVaD~~n~rI~kid~~g~~~~~~~~vaG~~~G~~G~~dG~~~~a~Ln~P~GIavD~dG~LYVAD~  153 (486)
                      +..|.||+++++|++|++|..+++|.+++.++..    .....              ...|..|.||++|++|+|||+|.
T Consensus       139 ~~~p~~i~~~~~g~~~v~~~~~~~i~~~d~~~~~----~~~~~--------------~~~~~~p~gi~~d~~g~l~vsd~  200 (260)
T d1rwia_         139 LNDPDGVAVDNSGNVYVTDTDNNRVVKLEAESNN----QVVLP--------------FTDITAPWGIAVDEAGTVYVTEH  200 (260)
T ss_dssp             CCSCCEEEECTTCCEEEEEGGGTEEEEECTTTCC----EEECC--------------CSSCCSEEEEEECTTCCEEEEET
T ss_pred             cCCcceeeecCCCCEeeeccccccccccccccce----eeeee--------------ccccCCCccceeeeeeeeeeeec
Confidence            3689999999999999999999999999988542    22222              12477899999999999999999


Q ss_pred             CCCEEEEEcCCC-ceEEcCCCCCCCCcCCCCccccccCCCceeEEEcCCCeEEEEeCCCCeEEEEECCCC
Q 011435          154 LNLAIRKIGDAG-VTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQD  222 (486)
Q Consensus       154 ~n~rIrkid~~G-v~tiaGg~~g~~G~~DG~~~~a~f~~P~gIa~vd~~G~LYVaD~gn~rIr~id~~G~  222 (486)
                      .+++|.++++++ ..++...              ..|..|.+|+ ++++|+|||+|.+++||++|+..++
T Consensus       201 ~~~~i~~~~~~~~~~~~~~~--------------~~~~~P~~i~-~d~~g~l~vad~~~~rI~~i~~~~~  255 (260)
T d1rwia_         201 NTNQVVKLLAGSTTSTVLPF--------------TGLNTPLAVA-VDSDRTVYVADRGNDRVVKLTSLEH  255 (260)
T ss_dssp             TTTEEEEECTTCSCCEECCC--------------CSCCCEEEEE-ECTTCCEEEEEGGGTEEEEECCCGG
T ss_pred             CCCEEEEEeCCCCeEEEEcc--------------CCCCCeEEEE-EeCCCCEEEEECCCCEEEEEeCCCC
Confidence            999999999988 5444432              2377899998 7899999999999999999998764



>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure