Citrus Sinensis ID: 011476


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
cccccHHHHHHHHHccccHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEcccHHHHHHHHHcccccccEEEEcccccccccccHHHHHccccccccccHHHHHHHHcccccEEEEEEEEEEEEccccEEEEEcccccccccccEEEccccEEEEEccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEccccEEEEEccEEEEEEccccccEEEccccEEEcccccccHHHHHHHHHHcccccccEEccccccccccccEEEEcccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHccccccHHHHHHHHHccccccccEEEcHHHHHHHHHHHHcccccccHHHHHHccccccccc
ccccHHHHccHHHcccccHHHHHHHHHHHHHccHEEcccccccccccccccccccccccEEEEEcccHHHHHHHHHccccccEEEEEccccEEEEccccccccccEEcHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccEEEEEEccccccccccEEEEEccEEEEEEcccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcEEEEcccccHHHHHHHHHHHHHHHHHHHcHccccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEcccEEEEEEcccccEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEcccEEEcccccEEEEEcccccccccccHHHHHHHHHccccHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcHHHHHHHHHHHHHHcccccHHHHHHHHcccEEEc
MRGYTFYERVSrafhdyssLSKLIVISTVGGGSLIAYseanassdaysvappemgikkKKVVVLGTGwagtsflknlnnpsydvqvisprnyfaftpllpsvtcgtvearsivepvrnivrkknvDICFWEAECFKIDAENKKVYCRSsqntnlngkeefcmDYDYLVIAMGarantfntpgveenCNFLKEVEDAQRIRRNVIESFekaslpnlsdeERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKfsrdgidvkLGSMVVKVTDKEIFTKVrgngetssmpygmvvwstgiaphAIIKDFMKQVGQTNRRAlatdewlrvegsdsiyalgdcatvnqRRVMEDIAAIFSKadkdnsgtlTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
mrgytfyeRVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEArsivepvrnivrkknvDICFWEAECFKIDAENKKVYCRSsqntnlngkeeFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIEsfekaslpnlsdeeRKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEekfsrdgidvklgsmvvkvtdkeiftkvrgngetssmpYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIfskadkdnsgtltVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
***YTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEAN*****YSVA**EMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESF************RKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKAL********NLPATAQVLHRFLYIMI*
********RVSRAFHDYSSLSKLIVISTVGGGSLIAYS***********************VVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNL*DEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMK*V***NRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIK*****YPQVELYLKNKKMGDFGDLLKEAKG*VA***VELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
*RGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEAN*************GIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQVELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQVLHRFLYIMIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
Q94BV7582 NAD(P)H dehydrogenase B2, no no 0.975 0.812 0.747 0.0
F4JJJ3580 NAD(P)H dehydrogenase B3, no no 0.971 0.812 0.728 0.0
Q9SKT7582 NAD(P)H dehydrogenase B4, no no 0.960 0.800 0.650 1e-173
Q1JPL4571 NAD(P)H dehydrogenase B1, no no 0.892 0.758 0.617 1e-160
P40215560 External NADH-ubiquinone yes no 0.719 0.623 0.460 1e-80
Q07500545 External NADH-ubiquinone no no 0.715 0.636 0.447 2e-74
F2Z699582 External alternative NADH yes no 0.734 0.611 0.436 2e-73
Q55CD9451 Probable NADH dehydrogena no no 0.643 0.691 0.457 1e-72
O14121551 Probable NADH-ubiquinone yes no 0.649 0.571 0.404 6e-72
O43090551 Probable NADH-ubiquinone no no 0.746 0.656 0.360 6e-65
>sp|Q94BV7|NDB2_ARATH NAD(P)H dehydrogenase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 Back     alignment and function desciption
 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/476 (74%), Positives = 409/476 (85%), Gaps = 3/476 (0%)

Query: 1   MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
           MR ++ +ER S+AF D+ SL++++V+ST+ GG LIAYSEANAS  A   A  E G KKKK
Sbjct: 1   MRNFSVFERFSKAFKDHPSLTRILVVSTISGGGLIAYSEANASYGANGGAVVETGTKKKK 60

Query: 61  VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
           VV+LGTGWAGTSFLKNLNN  Y+VQ+ISPRNYFAFTPLLPSVTCGTVEARS+VEP+RNI 
Sbjct: 61  VVLLGTGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIG 120

Query: 121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
           RK NVD  + EAECFKID  +KKVYCRS Q  + NGK+EF +DYDYLVIA GA++NTFN 
Sbjct: 121 RK-NVDTSYLEAECFKIDPASKKVYCRSKQGLSSNGKKEFSVDYDYLVIATGAQSNTFNI 179

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
           PGVEENC+FLKEVEDAQRIR+ VI+SFEKASLP LSDEERKRILHFV+VGGGPTGVEFAA
Sbjct: 180 PGVEENCHFLKEVEDAQRIRKTVIDSFEKASLPELSDEERKRILHFVVVGGGPTGVEFAA 239

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
           ELHDFV EDL  LYP+ K SV+ITLLEAADHIL MFDKRIT FAEEKFSRDGIDVKLGSM
Sbjct: 240 ELHDFVTEDLVSLYPRAKGSVRITLLEAADHILTMFDKRITEFAEEKFSRDGIDVKLGSM 299

Query: 301 VVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWL 360
           V KV +K+I  K +G GE SS+PYGM+VWSTGI    +IKDFMKQ+GQ NRRALATDEWL
Sbjct: 300 VTKVNEKDISAKTKG-GEVSSIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWL 358

Query: 361 RVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQV 420
           RVEG+D+IYALGDCAT+NQR+VMED++AIFSKADKD SGTLT+KEFQE + DIC RYPQV
Sbjct: 359 RVEGTDNIYALGDCATINQRKVMEDVSAIFSKADKDKSGTLTLKEFQEAMDDICVRYPQV 418

Query: 421 ELYLKNKKMGDFGDLLKEAK-GDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQV 475
           ELYLK+K+M    DLLKEA+  DV+++ +EL IEEFK ALS+VDSQ+K LPATAQV
Sbjct: 419 ELYLKSKRMRGIADLLKEAETDDVSKNNIELKIEEFKSALSQVDSQVKFLPATAQV 474




Calcium-dependent NAD(P)H dehydrogenase; more efficient on NADH. Binds calcium ions.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|F4JJJ3|NDB3_ARATH NAD(P)H dehydrogenase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKT7|NDB4_ARATH NAD(P)H dehydrogenase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 Back     alignment and function description
>sp|Q1JPL4|NDB1_ARATH NAD(P)H dehydrogenase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 Back     alignment and function description
>sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 Back     alignment and function description
>sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 Back     alignment and function description
>sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 Back     alignment and function description
>sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 Back     alignment and function description
>sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 Back     alignment and function description
>sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
224078850584 predicted protein [Populus trichocarpa] 0.979 0.813 0.806 0.0
255567411580 NADH dehydrogenase, putative [Ricinus co 0.973 0.813 0.821 0.0
224114085581 predicted protein [Populus trichocarpa] 0.971 0.810 0.796 0.0
449457690584 PREDICTED: NAD(P)H dehydrogenase B3, mit 0.979 0.813 0.766 0.0
449488409584 PREDICTED: NAD(P)H dehydrogenase B3, mit 0.979 0.813 0.764 0.0
147827159 618 hypothetical protein VITISV_016566 [Viti 0.917 0.720 0.808 0.0
5732076583 contains similarity to Pfam family PF000 0.977 0.813 0.75 0.0
297809693583 hypothetical protein ARALYDRAFT_911770 [ 0.977 0.813 0.747 0.0
388505494574 unknown [Lotus japonicus] 0.956 0.808 0.735 0.0
357475923578 External NADH-ubiquinone oxidoreductase 0.964 0.809 0.725 0.0
>gi|224078850|ref|XP_002305652.1| predicted protein [Populus trichocarpa] gi|222848616|gb|EEE86163.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/476 (80%), Positives = 432/476 (90%), Gaps = 1/476 (0%)

Query: 1   MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
           M G + ++R SRAF DY SL+KLIV+ TV GG  +AY++AN+S+ A++VAPP   I+KKK
Sbjct: 1   MNGLSLFKRASRAFDDYPSLAKLIVVCTVSGGGYVAYADANSSNGAHAVAPPVPEIRKKK 60

Query: 61  VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
           VVV+GTGWAGTSFLK LNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP+R+IV
Sbjct: 61  VVVIGTGWAGTSFLKKLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPIRSIV 120

Query: 121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
           RKK+V + + EAECFKIDAENKKVYCR + ++++NGKEEF +DYDYLVIAMGAR NTFNT
Sbjct: 121 RKKSVSVSYCEAECFKIDAENKKVYCRPNPDSSMNGKEEFAVDYDYLVIAMGARPNTFNT 180

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
           PGV E+CNFLKEVEDAQRIRR+VI+SFEKASLP LSDEERKRILHFV+VGGGPTGVEFAA
Sbjct: 181 PGVVEHCNFLKEVEDAQRIRRSVIDSFEKASLPTLSDEERKRILHFVVVGGGPTGVEFAA 240

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
           ELHDFV++DL KLYP  KD V+IT+LEAADHILNMFDKRIT FAE+KF RDGIDVKLGSM
Sbjct: 241 ELHDFVNDDLVKLYPAAKDFVQITILEAADHILNMFDKRITDFAEKKFHRDGIDVKLGSM 300

Query: 301 VVKVTDKEIFTKVRGN-GETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEW 359
           VVKV+DKEI TKVRGN GE +++PYGMVVWSTGI  H +I+ FM+Q+GQTNRRALATDEW
Sbjct: 301 VVKVSDKEISTKVRGNGGEITAIPYGMVVWSTGIGTHPVIRSFMQQIGQTNRRALATDEW 360

Query: 360 LRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQ 419
           LRVEG +SIYALGDCAT+NQR+VMEDIAAIF KADKDNSGTLTVKEFQEVI DICERYPQ
Sbjct: 361 LRVEGCNSIYALGDCATINQRKVMEDIAAIFKKADKDNSGTLTVKEFQEVIDDICERYPQ 420

Query: 420 VELYLKNKKMGDFGDLLKEAKGDVAQDAVELNIEEFKKALSEVDSQMKNLPATAQV 475
           VELYLKNKKM D  DLLK AKGDVA++A+ELNIEEFKKALSEVDSQMKNLPATAQV
Sbjct: 421 VELYLKNKKMRDIADLLKMAKGDVAKEAIELNIEEFKKALSEVDSQMKNLPATAQV 476




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255567411|ref|XP_002524685.1| NADH dehydrogenase, putative [Ricinus communis] gi|223536046|gb|EEF37704.1| NADH dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114085|ref|XP_002316663.1| predicted protein [Populus trichocarpa] gi|222859728|gb|EEE97275.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449457690|ref|XP_004146581.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449488409|ref|XP_004158024.1| PREDICTED: NAD(P)H dehydrogenase B3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147827159|emb|CAN66469.1| hypothetical protein VITISV_016566 [Vitis vinifera] Back     alignment and taxonomy information
>gi|5732076|gb|AAD48975.1|AF162444_7 contains similarity to Pfam family PF00070 - Pyridine nucleotide-disulphide oxidoreductase class-I; score=26.1, E=0.0008, N=1 [Arabidopsis thaliana] gi|7267261|emb|CAB81044.1| AT4g05020 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297809693|ref|XP_002872730.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. lyrata] gi|297318567|gb|EFH48989.1| hypothetical protein ARALYDRAFT_911770 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388505494|gb|AFK40813.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357475923|ref|XP_003608247.1| External NADH-ubiquinone oxidoreductase [Medicago truncatula] gi|87240748|gb|ABD32606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase; Calcium-binding EF-hand [Medicago truncatula] gi|355509302|gb|AES90444.1| External NADH-ubiquinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
TAIR|locus:2119667580 NDB3 "AT4G21490" [Arabidopsis 0.971 0.812 0.728 2.8e-185
TAIR|locus:2051431582 NDB4 "AT2G20800" [Arabidopsis 0.964 0.804 0.650 5e-163
TAIR|locus:2123713571 NDB1 "AT4G28220" [Arabidopsis 0.952 0.809 0.600 4.7e-151
DICTYBASE|DDB_G0290197 654 DDB_G0290197 "putative NADH de 0.585 0.434 0.391 7.4e-82
SGD|S000004753560 NDE1 "Mitochondrial external N 0.719 0.623 0.460 5.2e-81
SGD|S000002243545 NDE2 "Mitochondrial external N 0.713 0.634 0.448 1.3e-75
ASPGD|ASPL0000060585570 ndiF [Emericella nidulans (tax 0.725 0.617 0.440 1.7e-75
UNIPROTKB|G4NIR5689 MGG_04140 "Mitochondrial NADH 0.839 0.590 0.394 2.1e-75
DICTYBASE|DDB_G0295661584 DDB_G0295661 "pyridine nucleot 0.824 0.684 0.390 7.3e-75
CGD|CAL0004762574 NDE1 [Candida albicans (taxid: 0.468 0.395 0.436 8.5e-75
TAIR|locus:2119667 NDB3 "AT4G21490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1797 (637.6 bits), Expect = 2.8e-185, P = 2.8e-185
 Identities = 347/476 (72%), Positives = 404/476 (84%)

Query:     1 MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKK 60
             MR + ++ER+S+AFHDY SLSK++V+ST+ GG LI YSEAN S   YS    E   +K+K
Sbjct:     1 MRPFAYFERLSQAFHDYPSLSKILVVSTISGGGLIVYSEANPS---YSNNGVETKTRKRK 57

Query:    61 VVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIV 120
             VV+LGTGWAG SFLK LNN SY+VQVISPRNYFAFTPLLPSVTCGTVEARS+VEP+RNI 
Sbjct:    58 VVLLGTGWAGASFLKTLNNSSYEVQVISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIA 117

Query:   121 RKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARANTFNT 180
             RK+NV++ F EAECFKID  +KKVYCRS Q  N  GK+EF +DYDYLVIA GA++NTFN 
Sbjct:   118 RKQNVEMSFLEAECFKIDPGSKKVYCRSKQGVNSKGKKEFDVDYDYLVIATGAQSNTFNI 177

Query:   181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
             PGVEENC+FLKEVEDAQRIR  VI+SFEKASLP L+++ERKR+LHFV+VGGGPTGVEFA+
Sbjct:   178 PGVEENCHFLKEVEDAQRIRSTVIDSFEKASLPGLNEQERKRMLHFVVVGGGPTGVEFAS 237

Query:   241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSM 300
             ELHDFV+EDL KLYPK K+ V+ITLLEAADHIL MFDKRIT FAEEKF+RDGIDVKLGSM
Sbjct:   238 ELHDFVNEDLVKLYPKAKNLVQITLLEAADHILTMFDKRITEFAEEKFTRDGIDVKLGSM 297

Query:   301 VVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWL 360
             VVKV DKEI  K +  GE S++PYGM+VWSTGI    +IKDFMKQ+GQ NRRALATDEWL
Sbjct:   298 VVKVNDKEISAKTKA-GEVSTIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWL 356

Query:   361 RVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICERYPQV 420
             RVEG D+IYALGDCAT+NQR+VMEDIAAIF KADK+NSGTLT+KEF EV+ DIC+RYPQV
Sbjct:   357 RVEGCDNIYALGDCATINQRKVMEDIAAIFKKADKENSGTLTMKEFHEVMSDICDRYPQV 416

Query:   421 ELYLKNKKMGDFGDLLKEAKGDVAQD-AVELNIEEFKKALSEVDSQMKNLPATAQV 475
             ELYLK+K M    DLLK+A+ +   + +VEL+IEE K AL +VDSQ+K LPAT QV
Sbjct:   417 ELYLKSKGMHGITDLLKQAQAENGSNKSVELDIEELKSALCQVDSQVKLLPATGQV 472




GO:0003954 "NADH dehydrogenase activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2051431 NDB4 "AT2G20800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123713 NDB1 "AT4G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290197 DDB_G0290197 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000004753 NDE1 "Mitochondrial external NADH dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
SGD|S000002243 NDE2 "Mitochondrial external NADH dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000060585 ndiF [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NIR5 MGG_04140 "Mitochondrial NADH dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295661 DDB_G0295661 "pyridine nucleotide-disulphide oxidoreductase, NAD-binding region domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0004762 NDE1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94BV7NDB2_ARATH1, ., 6, ., -, ., -0.74780.97520.8127nono
F4JJJ3NDB3_ARATH1, ., 6, ., -, ., -0.72890.97110.8120nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.6.5.30.824
3rd Layer1.6.50.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00009744001
SubName- Full=Chromosome undetermined scaffold_247, whole genome shotgun sequence; (583 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00018147001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (616 aa)
     0.426

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 1e-122
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 2e-93
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 5e-40
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 7e-25
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 2e-24
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 8e-24
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 2e-17
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 3e-17
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 5e-16
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 7e-15
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 4e-13
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 5e-13
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 3e-10
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 5e-10
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-09
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 6e-09
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 2e-08
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 2e-08
TIGR02053463 TIGR02053, MerA, mercuric reductase 2e-07
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 3e-07
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 4e-07
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 5e-07
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 2e-06
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 2e-05
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 4e-05
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 7e-05
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 3e-04
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 4e-04
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 8e-04
pfam0003629 pfam00036, efhand, EF hand 0.003
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.004
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.004
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
 Score =  362 bits (931), Expect = e-122
 Identities = 158/363 (43%), Positives = 221/363 (60%), Gaps = 15/363 (4%)

Query: 56  IKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP 115
           +KK  VVVLGTGWAG  F++NL+   Y++ VISPRN+  FTPLLP  T GT+E RSI EP
Sbjct: 8   LKKPNVVVLGTGWAGAYFVRNLDPKKYNITVISPRNHMLFTPLLPQTTTGTLEFRSICEP 67

Query: 116 VRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARA 175
           VR  + K      +  A  + +D E K+V C     +N      F + YD LV+A GAR 
Sbjct: 68  VRPALAKL--PNRYLRAVVYDVDFEEKRVKCGVVSKSNNANVNTFSVPYDKLVVAHGARP 125

Query: 176 NTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTG 235
           NTFN PGVEE   FLKEV  A+ IR+ +++  E+ASLP  S EERKR+LHFV+VGGGPTG
Sbjct: 126 NTFNIPGVEERAFFLKEVNHARGIRKRIVQCIERASLPTTSVEERKRLLHFVVVGGGPTG 185

Query: 236 VEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDV 295
           VEFAAEL DF  +D+  L P++ +  K+T+LEA   +L  FD+ +  + + +  R G+D+
Sbjct: 186 VEFAAELADFFRDDVRNLNPELVEECKVTVLEAGSEVLGSFDQALRKYGQRRLRRLGVDI 245

Query: 296 KLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALA 355
           +  + V +V DKE+  K   +GE   +P G+VVWSTG+ P  + K    +V +T+R  ++
Sbjct: 246 RTKTAVKEVLDKEVVLK---DGEV--IPTGLVVWSTGVGPGPLTKQL--KVDKTSRGRIS 298

Query: 356 TDEWLRVEGSDSIYALGDCATVNQRRVMEDIAAIFSKADKDNSGTLTVKEFQEVIKDICE 415
            D+ LRV+   +++ALGDCA     R +  +A + S+      G    KEF   +K    
Sbjct: 299 VDDHLRVKPIPNVFALGDCAANE-ERPLPTLAQVASQ-----QGVYLAKEFNNELKGKPM 352

Query: 416 RYP 418
             P
Sbjct: 353 SKP 355


Length = 424

>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PLN02507499 glutathione reductase 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
PRK06116450 glutathione reductase; Validated 100.0
PLN02546558 glutathione reductase 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 99.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.97
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.97
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.97
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.97
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.97
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.97
PLN02852491 ferredoxin-NADP+ reductase 99.97
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.96
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.96
PRK13984604 putative oxidoreductase; Provisional 99.96
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.95
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.95
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.94
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.92
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.91
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.91
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.91
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.9
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.89
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.83
KOG2755334 consensus Oxidoreductase [General function predict 99.82
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.82
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.75
PTZ00188506 adrenodoxin reductase; Provisional 99.73
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.72
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.72
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.68
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.66
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.64
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.61
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.54
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.38
COG2081408 Predicted flavoproteins [General function predicti 99.14
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.05
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.95
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.91
PRK09897534 hypothetical protein; Provisional 98.88
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.87
PLN02463447 lycopene beta cyclase 98.8
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.76
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.76
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.7
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.7
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.68
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.68
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.66
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.66
COG0579429 Predicted dehydrogenase [General function predicti 98.65
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.64
PRK06847375 hypothetical protein; Provisional 98.59
PLN02697529 lycopene epsilon cyclase 98.58
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.58
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.57
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.57
PRK10157428 putative oxidoreductase FixC; Provisional 98.56
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.55
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.53
PRK10015429 oxidoreductase; Provisional 98.52
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.52
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.51
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.51
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.5
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.5
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.5
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.49
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.49
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.49
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.49
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.48
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.48
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.47
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.45
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.44
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.44
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.44
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.43
PRK06184502 hypothetical protein; Provisional 98.42
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.42
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.42
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.41
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.41
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.4
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.4
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.38
PRK06126 545 hypothetical protein; Provisional 98.38
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.37
TIGR02053463 MerA mercuric reductase. This model represents the 98.37
PRK07233434 hypothetical protein; Provisional 98.37
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.37
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.36
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.36
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.36
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.36
PRK08244493 hypothetical protein; Provisional 98.36
PRK06370463 mercuric reductase; Validated 98.35
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.35
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.34
PRK07236386 hypothetical protein; Provisional 98.34
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.34
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.34
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.33
PRK06834488 hypothetical protein; Provisional 98.33
PRK11728393 hydroxyglutarate oxidase; Provisional 98.32
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.32
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.32
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.32
PRK13512438 coenzyme A disulfide reductase; Provisional 98.32
PLN02612567 phytoene desaturase 98.3
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.29
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.29
PRK05257 494 malate:quinone oxidoreductase; Validated 98.28
PRK08163396 salicylate hydroxylase; Provisional 98.28
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.28
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.28
PRK08013400 oxidoreductase; Provisional 98.28
PRK06116450 glutathione reductase; Validated 98.27
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.27
PRK11445351 putative oxidoreductase; Provisional 98.26
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.26
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.26
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.26
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.25
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.25
PRK07846451 mycothione reductase; Reviewed 98.25
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.25
PRK14694468 putative mercuric reductase; Provisional 98.25
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.24
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.24
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.24
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.24
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.24
PRK07190487 hypothetical protein; Provisional 98.23
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.22
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.21
PRK07045388 putative monooxygenase; Reviewed 98.21
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.21
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.21
PRK08401466 L-aspartate oxidase; Provisional 98.2
PRK09126392 hypothetical protein; Provisional 98.2
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.19
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.19
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.19
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.18
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.17
PRK06185407 hypothetical protein; Provisional 98.17
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.16
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.15
PLN02507499 glutathione reductase 98.15
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.15
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.14
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.13
PRK06753373 hypothetical protein; Provisional 98.12
PRK13748561 putative mercuric reductase; Provisional 98.12
PLN02661357 Putative thiazole synthesis 98.12
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.11
PRK14727479 putative mercuric reductase; Provisional 98.11
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.11
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.11
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.11
PRK07588391 hypothetical protein; Provisional 98.11
PRK06475400 salicylate hydroxylase; Provisional 98.1
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.1
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.09
PRK06996398 hypothetical protein; Provisional 98.09
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.09
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.09
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.08
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.08
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.08
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.08
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.07
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.07
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.07
PRK10262321 thioredoxin reductase; Provisional 98.07
PRK07121492 hypothetical protein; Validated 98.06
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.06
COG3349485 Uncharacterized conserved protein [Function unknow 98.06
PTZ00058561 glutathione reductase; Provisional 98.05
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.05
PRK05868372 hypothetical protein; Validated 98.05
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.05
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.05
PRK08274466 tricarballylate dehydrogenase; Validated 98.04
PLN02985514 squalene monooxygenase 98.04
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.04
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.03
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.03
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.03
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.03
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.03
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.02
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.01
PTZ00052499 thioredoxin reductase; Provisional 98.01
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.01
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.99
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.99
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.99
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.99
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.98
PRK07538413 hypothetical protein; Provisional 97.97
PRK06847375 hypothetical protein; Provisional 97.96
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.96
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.95
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.95
PRK06175433 L-aspartate oxidase; Provisional 97.94
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.93
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.93
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.92
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.92
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.91
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.91
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.89
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.89
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.89
PRK07804541 L-aspartate oxidase; Provisional 97.87
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.87
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.86
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.86
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.86
PTZ00153659 lipoamide dehydrogenase; Provisional 97.86
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.85
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.84
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.84
PRK12831464 putative oxidoreductase; Provisional 97.83
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.82
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.81
PLN02546558 glutathione reductase 97.8
PLN02268435 probable polyamine oxidase 97.8
PRK07236386 hypothetical protein; Provisional 97.78
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.78
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.78
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.77
PRK07208479 hypothetical protein; Provisional 97.76
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 97.75
PLN02576496 protoporphyrinogen oxidase 97.75
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.75
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.73
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.73
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.72
PLN02815 594 L-aspartate oxidase 97.72
PLN02852 491 ferredoxin-NADP+ reductase 97.71
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.71
KOG2853509 consensus Possible oxidoreductase [General functio 97.71
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.71
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.68
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.65
PRK08275 554 putative oxidoreductase; Provisional 97.65
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.65
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.64
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.64
PRK08294 634 phenol 2-monooxygenase; Provisional 97.64
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.63
PTZ00188 506 adrenodoxin reductase; Provisional 97.63
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.63
PRK08071510 L-aspartate oxidase; Provisional 97.63
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.62
PRK12416463 protoporphyrinogen oxidase; Provisional 97.62
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.62
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.61
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.6
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.59
PLN02529 738 lysine-specific histone demethylase 1 97.58
PLN02661357 Putative thiazole synthesis 97.58
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.57
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.57
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.57
PRK10157 428 putative oxidoreductase FixC; Provisional 97.56
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.55
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.55
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.54
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.54
PRK08244 493 hypothetical protein; Provisional 97.54
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.54
PLN02463 447 lycopene beta cyclase 97.51
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.5
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 97.5
PRK06184 502 hypothetical protein; Provisional 97.47
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.46
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.45
PRK07512513 L-aspartate oxidase; Provisional 97.44
PLN02487569 zeta-carotene desaturase 97.43
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.43
PRK08163396 salicylate hydroxylase; Provisional 97.42
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.41
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.4
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.4
PLN02568 539 polyamine oxidase 97.39
PRK06834 488 hypothetical protein; Provisional 97.38
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.37
KOG2852380 consensus Possible oxidoreductase [General functio 97.37
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.36
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.36
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.35
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.34
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.33
PLN02676487 polyamine oxidase 97.31
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.29
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.29
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.28
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.28
PLN02697 529 lycopene epsilon cyclase 97.27
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.27
PTZ00367 567 squalene epoxidase; Provisional 97.27
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 97.25
PRK07190 487 hypothetical protein; Provisional 97.24
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.23
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.22
PRK09126392 hypothetical protein; Provisional 97.2
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.2
PRK05868372 hypothetical protein; Validated 97.19
PRK06753373 hypothetical protein; Provisional 97.19
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.18
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.17
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.17
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.17
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.17
PRK13984604 putative oxidoreductase; Provisional 97.16
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.16
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.16
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.11
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.11
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.09
PRK06475400 salicylate hydroxylase; Provisional 97.08
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.05
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.04
PRK11445351 putative oxidoreductase; Provisional 97.03
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.02
PRK07045388 putative monooxygenase; Reviewed 97.02
PRK10015 429 oxidoreductase; Provisional 97.02
PRK07588391 hypothetical protein; Provisional 97.01
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.01
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.01
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.0
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.0
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.99
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.99
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.97
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.97
PRK09897 534 hypothetical protein; Provisional 96.96
PLN03000 881 amine oxidase 96.95
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.92
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.91
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 96.88
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.88
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.87
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.87
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.86
PRK12839 572 hypothetical protein; Provisional 96.86
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 96.85
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.85
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.84
PLN02976 1713 amine oxidase 96.8
PRK07395 553 L-aspartate oxidase; Provisional 96.77
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.77
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 96.76
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 96.75
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.72
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 96.72
PRK11728393 hydroxyglutarate oxidase; Provisional 96.72
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.7
PRK08274 466 tricarballylate dehydrogenase; Validated 96.67
PRK07538413 hypothetical protein; Provisional 96.67
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.64
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.63
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.6
PRK06996398 hypothetical protein; Provisional 96.6
PRK06185407 hypothetical protein; Provisional 96.56
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.56
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.56
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.56
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.52
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.49
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.43
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.41
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.4
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 96.38
PRK08294 634 phenol 2-monooxygenase; Provisional 96.28
PRK09077 536 L-aspartate oxidase; Provisional 96.28
PRK02106 560 choline dehydrogenase; Validated 96.25
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.23
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.2
PLN02985 514 squalene monooxygenase 96.19
PRK07121 492 hypothetical protein; Validated 96.17
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.13
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.07
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.02
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 95.99
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.95
KOG2960328 consensus Protein involved in thiamine biosynthesi 95.92
PRK08275 554 putative oxidoreductase; Provisional 95.9
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 95.87
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.85
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 95.74
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.72
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 95.7
KOG0404322 consensus Thioredoxin reductase [Posttranslational 95.62
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.58
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 95.51
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 95.49
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.45
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 95.45
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.43
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.35
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.31
COG3573 552 Predicted oxidoreductase [General function predict 95.29
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 95.29
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 95.25
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.22
PRK06175433 L-aspartate oxidase; Provisional 95.11
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.05
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.03
PLN02785 587 Protein HOTHEAD 95.02
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 94.99
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 94.98
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.98
PRK06719157 precorrin-2 dehydrogenase; Validated 94.94
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 94.91
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 94.9
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 94.83
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 94.78
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 94.71
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.71
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 94.7
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.67
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 94.62
PRK08401 466 L-aspartate oxidase; Provisional 94.54
PRK07804 541 L-aspartate oxidase; Provisional 94.5
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.31
KOG2755334 consensus Oxidoreductase [General function predict 94.31
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 94.31
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 94.26
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.19
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 94.15
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 94.13
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.12
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.11
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=2.1e-61  Score=455.36  Aligned_cols=370  Identities=60%  Similarity=0.990  Sum_probs=338.4

Q ss_pred             CcchhhhhhhhhhcccCCCCchhhhhhhhcccceeEeeccccCCCCCCCCCCCCCCCCCeEEEECCcHHHHHHHHhcCCC
Q 011476            1 MRGYTFYERVSRAFHDYSSLSKLIVISTVGGGSLIAYSEANASSDAYSVAPPEMGIKKKKVVVLGTGWAGTSFLKNLNNP   80 (485)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvIIG~G~aGl~aA~~L~~~   80 (485)
                      |....++.|.++..+..++.++++..+.+++++...|...++...   .+..+....+++|||+|+||+|.+++..|...
T Consensus         1 m~~~~~~~r~s~~~~~~~s~~k~l~~st~~g~~~~~y~~an~~~~---~~~~~~~~kKk~vVVLGsGW~a~S~lk~ldts   77 (491)
T KOG2495|consen    1 MLFLSSLARISRTTSSSKSTLKILLASTLSGGGLVAYSEANPSEK---VPGPKNGGKKKRVVVLGSGWGAISLLKKLDTS   77 (491)
T ss_pred             CchhhhHHhhccccccCcchhhhhhhheeccceeEEEecCCcccc---CCCCCCCCCCceEEEEcCchHHHHHHHhcccc
Confidence            556677888888888888888999999999999989986664443   22234556789999999999999999999999


Q ss_pred             CCcEEEEcCCCCcccCCCccccccCcccccccccchHHHHhhCCCeEEEEEeEEEEEecCCCEEEEecCCccCCCCCceE
Q 011476           81 SYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEF  160 (485)
Q Consensus        81 g~~V~lie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gv~v~~~~~~v~~id~~~~~v~~~~~~~~~~~~~~~~  160 (485)
                      -|+|+||+++++|.|+|++|...+|+++.+++.++.+.+.++...+++|+++++..||++.+.|+++.-..+..  ..++
T Consensus        78 ~YdV~vVSPRnyFlFTPLLpS~~vGTve~rSIvEPIr~i~r~k~~~~~y~eAec~~iDp~~k~V~~~s~t~~~~--~~e~  155 (491)
T KOG2495|consen   78 LYDVTVVSPRNYFLFTPLLPSTTVGTVELRSIVEPIRAIARKKNGEVKYLEAECTKIDPDNKKVHCRSLTADSS--DKEF  155 (491)
T ss_pred             ccceEEeccccceEEeeccCCccccceeehhhhhhHHHHhhccCCCceEEecccEeecccccEEEEeeeccCCC--ccee
Confidence            99999999999999999999999999999999999999999887678899999999999999999987542211  3467


Q ss_pred             EeecCEEEEccCCCCCCCCCCCCCCccccccChhHHHHHHHHHHHHHhhcCCCCCCHHHHhhcccEEEECCChhHHHHHH
Q 011476          161 CMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA  240 (485)
Q Consensus       161 ~~~yd~lviAtG~~~~~~~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVVGgG~~g~e~A~  240 (485)
                      .+.||+||+|+|+.++++++||..+++++++.++|+.+++..+.++++.+.+|.++++||++..++|||||||+|+|+|.
T Consensus       156 ~i~YDyLViA~GA~~~TFgipGV~e~~~FLKEv~dAqeIR~~~~~~le~a~~~~l~~eerkRlLh~VVVGGGPTGVEFAa  235 (491)
T KOG2495|consen  156 VIGYDYLVIAVGAEPNTFGIPGVEENAHFLKEVEDAQEIRRKVIDNLEKAELPGLSDEERKRLLHFVVVGGGPTGVEFAA  235 (491)
T ss_pred             eecccEEEEeccCCCCCCCCCchhhchhhhhhhhHHHHHHHHHHHHHHHhhcCCCChHHhhheEEEEEECCCCcceeehH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHHHhhCcCCCCCceEEEEecCccccccccHHHHHHHHHHHHhCCcEEEcCceEEEEeCCcEEEEEcCCCeEE
Q 011476          241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETS  320 (485)
Q Consensus       241 ~l~~~~~~~~~~~~p~~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~~~l~~~gV~v~~~~~v~~v~~~~v~~~~~~~G~~~  320 (485)
                      +|+++..+++.+.||+++...+||+++..+++|++|+..+.++.++.+.+.||++.+++.|+.+++..+.... .+|+..
T Consensus       236 EL~Dfi~~Dl~k~yp~l~~~i~vtLiEA~d~iL~mFdkrl~~yae~~f~~~~I~~~~~t~Vk~V~~~~I~~~~-~~g~~~  314 (491)
T KOG2495|consen  236 ELADFIPEDLRKIYPELKKDIKVTLIEAADHILNMFDKRLVEYAENQFVRDGIDLDTGTMVKKVTEKTIHAKT-KDGEIE  314 (491)
T ss_pred             HHHHHHHHHHHHhhhcchhheEEEeeccchhHHHHHHHHHHHHHHHHhhhccceeecccEEEeecCcEEEEEc-CCCcee
Confidence            9999999999999999999999999999999999999999999999999999999999999999999888877 488888


Q ss_pred             EEecCeEEEccCCCCCcchHHHHHHhCCCCCCceeeCCCccccCCCCeEEeccccC
Q 011476          321 SMPYGMVVWSTGIAPHAIIKDFMKQVGQTNRRALATDEWLRVEGSDSIYALGDCAT  376 (485)
Q Consensus       321 ~i~~D~vi~a~G~~~~p~~~~l~~~~g~~~~g~i~vd~~l~t~~~~~Vya~GD~~~  376 (485)
                      +||+.+++|++|++.+|.+..|.++++...++++.||++||..+.+||||+|||+.
T Consensus       315 ~iPYG~lVWatG~~~rp~~k~lm~~i~e~~rr~L~vDE~LrV~G~~nvfAiGDca~  370 (491)
T KOG2495|consen  315 EIPYGLLVWATGNGPRPVIKDLMKQIDEQGRRGLAVDEWLRVKGVKNVFAIGDCAD  370 (491)
T ss_pred             eecceEEEecCCCCCchhhhhHhhcCCccCceeeeeeceeeccCcCceEEeccccc
Confidence            99999999999999999999998888775577999999999999999999999994



>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 1e-64
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 1e-64
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 3e-10
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 8e-10
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 8e-10
3ntd_A 565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 6e-09
3szw_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 1e-08
3sxi_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 1e-08
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 2e-08
3sx6_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3kpk_A434 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3szf_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3sy4_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3nt6_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 3e-08
3t2y_A434 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3t2z_A437 Crystal Structure Of Sulfide:quinone Oxidoreductase 3e-08
3nta_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 5e-08
3hyw_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 4e-07
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 5e-07
3hyv_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 5e-07
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 9e-07
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 3e-06
2cdu_A452 The Crystal Structure Of Water-Forming Nad(P)h Oxid 8e-06
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 8e-06
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 2e-05
3ef6_A410 Crystal Structure Of Toluene 2,3-Dioxygenase Reduct 3e-05
3h8i_A409 The First X-Ray Structure Of A Sulfide:quinone Oxid 6e-05
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 2e-04
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 5e-04
3fg2_P404 Crystal Structure Of Ferredoxin Reductase For The C 5e-04
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure

Iteration: 1

Score = 244 bits (622), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 133/333 (39%), Positives = 206/333 (61%), Gaps = 15/333 (4%) Query: 58 KKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVR 117 K V++LG+GW SFLK+++ Y+V +ISPR+YF FTPLLPS GTV+ +SI+EP+ Sbjct: 42 KPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIV 101 Query: 118 NIVRKKNVDICFWEAECFKIDAENKKVYCRS----------SQNTNLNGKEEFCMDYDYL 167 N KK ++ ++EAE I+ + V +S + L+ E + YDYL Sbjct: 102 NFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYL 161 Query: 168 VIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFV 227 + A+GA NTF PGV + +FLKE+ ++ IRR + EKA+L D ER+R+L V Sbjct: 162 ISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIV 221 Query: 228 IVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEK 287 +VGGGPTGVE A EL D+V +DL K P + + V+I L+EA +LNMF+K+++++A+ Sbjct: 222 VVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSH 281 Query: 288 FSRDGIDVKLGSMVVKVTDKEIFTKVR---GNGETSSMPYGMVVWSTGIAPHAIIKDFMK 344 I V L + V KV +K++ K + G ++PYG ++W+TG +I D K Sbjct: 282 LENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFK 341 Query: 345 QVGQTN--RRALATDEWLRVEGSDSIYALGDCA 375 ++ + N +R LA +++L+V+GS++I+A+GD A Sbjct: 342 KIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNA 374
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|3SZW|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys128ser Variant From Acidithiobacillus Ferrooxidans In Complex With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3SXI|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys128ala Variant From Acidithiobacillus Ferrooxidans Complexed With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|3SX6|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Cys356ala Variant From Acidithiobacillus Ferrooxidans Complexed With Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3KPK|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase From Acidithiobacillus Ferrooxidans, C160a Mutant Length = 434 Back     alignment and structure
>pdb|3SZF|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase H198a Variant From Acidithiobacillus Ferrooxidans In Complex With Bound Trisulfide And Decylubiquinone Length = 437 Back     alignment and structure
>pdb|3SY4|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase Ser126ala Variant From Acidithiobacillus Ferrooxidans Length = 437 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|3T2Y|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase His132ala Variant From Acidithiobacillus Ferrooxidans With Bound Disulfide Length = 434 Back     alignment and structure
>pdb|3T2Z|A Chain A, Crystal Structure Of Sulfide:quinone Oxidoreductase From Acidithiobacillus Ferrooxidans Length = 437 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|3HYW|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase Of The Hyperthermophilic Bacterium Aquifex Aeolicus In Complex With Decylubiquinone Length = 430 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|3HYV|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase From The Hyperthermophilic Bacterium Aquifex Aeolicus Length = 430 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure
>pdb|2CDU|A Chain A, The Crystal Structure Of Water-Forming Nad(P)h Oxidase From Lactobacillus Sanfranciscensis Length = 452 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|3EF6|A Chain A, Crystal Structure Of Toluene 2,3-Dioxygenase Reductase Length = 410 Back     alignment and structure
>pdb|3H8I|A Chain A, The First X-Ray Structure Of A Sulfide:quinone Oxidoreductase: Insights Into Sulfide Oxidation Mechanism Length = 409 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|3FG2|P Chain P, Crystal Structure Of Ferredoxin Reductase For The Cyp199a2 System From Rhodopseudomonas Palustris Length = 404 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 2e-51
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 8e-50
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 4e-49
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-41
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 4e-04
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 3e-39
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 2e-04
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 4e-39
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 2e-38
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 9e-38
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 4e-37
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 5e-37
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 4e-36
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 4e-36
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 5e-35
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 1e-05
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 3e-29
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 5e-27
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 1e-22
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 3e-19
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 2e-18
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 6e-18
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 3e-17
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 6e-17
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 1e-16
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 1e-16
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-16
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 9e-16
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-15
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 4e-15
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 8e-12
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 1e-11
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 1e-11
1fec_A490 Trypanothione reductase; redox-active center, oxid 2e-11
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 2e-11
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 6e-11
4dna_A463 Probable glutathione reductase; structural genomic 1e-10
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 4e-10
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 6e-10
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 9e-10
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 1e-09
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 2e-09
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 2e-09
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 3e-09
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 4e-09
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 4e-09
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 6e-09
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 1e-08
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-08
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 4e-08
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 7e-08
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 1e-07
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1ojt_A482 Surface protein; redox-active center, glycolysis, 1e-06
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 1e-06
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 4e-05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-05
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-04
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 5e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 6e-04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 7e-04
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 8e-04
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 9e-04
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
 Score =  178 bits (454), Expect = 2e-51
 Identities = 62/328 (18%), Positives = 128/328 (39%), Gaps = 27/328 (8%)

Query: 59  KKVVVLGTGWAGTS---FLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEP 115
            KV+VLG  +   +    LK L     DV+VI+   +  F P LP V  G  +   +   
Sbjct: 2   TKVLVLGGRFGALTAAYTLKRLVGSKADVKVINKSRFSYFRPALPHVAIGVRDVDELKVD 61

Query: 116 VRNIVRKKNVDICFWEAECFKIDAENKKVYCRSSQNTNLNGKEEFCMDYDYLVIAMGARA 175
           +   + +K +   F E    KIDA++  VY       + +  E    +YDY+++ +GA  
Sbjct: 62  LSEALPEKGIQ--FQEGTVEKIDAKSSMVYYT---KPDGSMAE---EEYDYVIVGIGAHL 113

Query: 176 NTFNTPGVEENCNFLKEVEDAQRIRRNVIESFEK------ASLPNLSDEERKRILHFVIV 229
            T    G ++    + E E A ++R   +ESF+       +         + ++    + 
Sbjct: 114 ATELVKGWDKYGYSVCEPEFATKLREK-LESFQGGNIAIGSGPFYQGHNPKPKVPENFVP 172

Query: 230 GGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAEEKFS 289
                      E+   +     K    + D V +T+    +++ ++            ++
Sbjct: 173 NADSACEGPVFEMSLMLHGYFKKK--GMLDKVHVTVFSPGEYLSDL-SPNSRKAVASIYN 229

Query: 290 RDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTGIAPHAIIKDFMKQVGQT 349
           + GI +     + ++ + EI  +    G T  +P  + +       +  +K+    +   
Sbjct: 230 QLGIKLVHNFKIKEIREHEIVDE---KGNT--IPADITILLPPYTGNPALKNSTPDLVDD 284

Query: 350 NRRALATDEWLRVEGSDSIYALGDCATV 377
               + TD  +     D++YA+GD  ++
Sbjct: 285 GGF-IPTDLNMVSIKYDNVYAVGDANSM 311


>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.97
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.97
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.97
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.97
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.97
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.97
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.97
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.97
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.96
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.96
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.95
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.95
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.94
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.93
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.92
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.9
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.83
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.8
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.63
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.52
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.46
2cul_A232 Glucose-inhibited division protein A-related PROT 99.4
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.2
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.08
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.06
2cul_A232 Glucose-inhibited division protein A-related PROT 98.98
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.96
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.95
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.88
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.85
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.85
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.85
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.83
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.82
2bry_A497 NEDD9 interacting protein with calponin homology a 98.81
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.8
3dme_A369 Conserved exported protein; structural genomics, P 98.78
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.75
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.73
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.73
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.71
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.71
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.69
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.61
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.61
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.6
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.6
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.59
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.57
3atr_A453 Conserved archaeal protein; saturating double bond 98.56
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.55
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.55
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.55
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.54
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.54
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.53
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.53
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.51
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.51
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.5
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.49
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.49
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.49
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.48
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.48
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.47
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.47
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.46
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.46
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.45
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.45
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.44
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.44
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.43
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.42
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.42
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.41
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.41
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.4
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.39
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.38
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.37
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.36
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.36
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.36
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.35
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.35
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.33
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.33
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.33
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.33
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.32
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.32
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.31
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.31
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.31
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.3
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.29
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.29
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.29
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.29
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.29
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.29
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.28
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.27
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.27
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.27
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.27
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.26
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.26
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.26
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.26
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.24
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.24
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.24
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.24
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.22
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.22
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.21
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.21
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.21
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.21
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.2
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.2
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.2
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.2
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.2
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.2
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.2
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.19
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.19
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.18
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.18
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.17
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.16
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.16
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.16
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.15
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.15
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.14
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.14
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.14
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.13
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.13
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.13
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.13
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.12
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.12
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.11
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.11
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.11
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.1
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.1
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.09
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.08
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.08
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.08
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.07
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.07
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.07
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.06
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.06
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.06
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.04
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.04
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.03
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.03
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.03
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.01
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.01
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.01
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.0
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.98
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.98
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.98
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.97
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.96
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.96
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.94
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 97.94
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 97.93
4dna_A463 Probable glutathione reductase; structural genomic 97.93
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.92
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.91
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.91
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.89
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.89
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.88
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.88
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.87
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.85
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.84
3atr_A 453 Conserved archaeal protein; saturating double bond 97.84
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.83
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.83
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.82
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.82
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.81
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.8
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.79
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.79
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.78
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.77
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.75
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.75
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.72
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.71
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.71
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.7
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.7
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.7
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.69
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.67
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.66
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.66
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.66
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.66
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.65
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.65
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.63
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.63
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.63
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.61
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.6
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.59
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.58
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.56
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.56
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.53
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.53
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.52
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.52
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.52
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.52
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.51
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.51
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.5
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.47
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.46
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.46
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.45
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.44
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.44
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.43
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.43
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.43
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.43
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.42
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.42
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.41
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.41
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.38
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.33
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.3
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.29
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.28
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.27
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.25
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.24
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.24
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.2
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.17
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.12
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.12
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.11
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.06
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.02
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.96
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.94
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.92
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.88
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.85
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.7
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.59
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.57
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.54
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.52
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.51
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 96.38
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.36
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.32
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.29
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.23
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.11
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.02
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.9
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.85
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.84
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 95.75
4gut_A776 Lysine-specific histone demethylase 1B; histone de 95.66
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.58
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 95.53
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.36
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.35
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.34
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.94
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 94.76
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 94.76
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.67
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.64
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.6
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.48
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.46
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.42
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.41
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 93.93
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 93.75
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.68
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.42
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.41
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 93.34
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.34
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 93.29
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 93.26
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 93.23
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.08
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.97
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 92.89
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 92.69
3dme_A 369 Conserved exported protein; structural genomics, P 92.68
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.68
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 92.64
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 92.62
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 92.6
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 92.42
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 92.3
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.24
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 92.24
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.21
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 92.14
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 91.98
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 91.84
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 91.83
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 91.81
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.75
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 91.73
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 91.49
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 91.47
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 91.43
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.42
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 91.35
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 91.2
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.06
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 91.03
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 90.95
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 90.91
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 90.89
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 90.85
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 90.85
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.77
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 90.76
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 90.73
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 90.67
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 90.61
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 90.57
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 90.55
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 90.51
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 90.47
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 90.47
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 90.46
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.43
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 90.36
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 90.35
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 90.28
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 90.26
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 90.08
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.02
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 89.89
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 89.81
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 89.66
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 89.65
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 89.64
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 89.63
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.54
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 89.51
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 89.5
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 89.48
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.45
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 89.44
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 89.4
3qha_A296 Putative oxidoreductase; seattle structural genomi 89.38
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 89.35
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 89.34
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.26
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 89.24
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 89.18
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 89.17
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.02
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 88.99
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.96
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 88.91
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 88.91
3ius_A286 Uncharacterized conserved protein; APC63810, silic 88.87
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 88.82
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 88.79
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 88.72
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 88.72
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.56
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.55
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 88.49
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 88.43
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 88.4
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 88.34
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 88.27
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.24
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.14
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 88.09
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 88.01
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 88.0
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 87.99
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 87.87
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 87.76
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 87.76
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.72
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 87.66
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.53
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 87.49
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 87.46
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.43
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 87.42
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 87.4
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-49  Score=410.83  Aligned_cols=328  Identities=40%  Similarity=0.753  Sum_probs=283.8

Q ss_pred             CCCCeEEEECCcHHHHHHHHhcCCCCCcEEEEcCCCCcccCCCccccccCcccccccccchHHHHhhCCCeEEEEEeEEE
Q 011476           56 IKKKKVVVLGTGWAGTSFLKNLNNPSYDVQVISPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIVRKKNVDICFWEAECF  135 (485)
Q Consensus        56 ~~~~~vvIIG~G~aGl~aA~~L~~~g~~V~lie~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gv~v~~~~~~v~  135 (485)
                      ..+++|||||||+||+++|..|++.+++|||||+++++.|+|+++.+..|.++++++..+++.++....-+++|+.++|+
T Consensus        40 ~~KprVVIIGgG~AGl~~A~~L~~~~~~VtLId~~~~~~~~PlL~~va~G~l~~~~i~~p~~~~~~~~~~~v~~~~~~v~  119 (502)
T 4g6h_A           40 SDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEAT  119 (502)
T ss_dssp             CSSCEEEEECSSHHHHHHHHHSCTTTCEEEEEESSSEEECGGGGGGTTTTSSCGGGGEEEHHHHHTTCSSCEEEEEEEEE
T ss_pred             CCCCCEEEECCcHHHHHHHHHhhhCCCcEEEECCCCCcccccchhHHhhccccHHHhhhhHHHHHHhhcCCeEEEEEEEE
Confidence            45679999999999999999999999999999999999999999999999999999999988887554444668999999


Q ss_pred             EEecCCCEEEEecCCcc----------CCCCCceEEeecCEEEEccCCCCCCCCCCCCCCccccccChhHHHHHHHHHHH
Q 011476          136 KIDAENKKVYCRSSQNT----------NLNGKEEFCMDYDYLVIAMGARANTFNTPGVEENCNFLKEVEDAQRIRRNVIE  205 (485)
Q Consensus       136 ~id~~~~~v~~~~~~~~----------~~~~~~~~~~~yd~lviAtG~~~~~~~i~G~~~~~~~~~~~~~~~~~~~~~~~  205 (485)
                      .||++.+.|.+++....          .....+..++.||+||||||+.|+.+++||++++++++++++++.++++.+..
T Consensus       120 ~ID~~~k~V~l~~~~~~~~~~~~~~~~~~~~~~~~~i~YD~LViAtGs~~~~~~ipG~~e~a~~l~t~~dA~~ir~~l~~  199 (502)
T 4g6h_A          120 SINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAA  199 (502)
T ss_dssp             EEEGGGTEEEEEEEEEEEECSSSCCCCCCCTTCCEEEECSEEEECCCCEECCTTCTTHHHHCEECSSHHHHHHHHHHHHH
T ss_pred             EEEhhhCEEEEeecccceeecccccccccccCCceEEeCCEEEEcCCcccccCCccCcccccCCCCCHHHHHHHHHHHHH
Confidence            99999999988653210          00112234899999999999999999999998899999999999999999999


Q ss_pred             HHhhcCCCCCCHHHHhhcccEEEECCChhHHHHHHHHHHhhHHHHHhhCcCCCCCceEEEEecCccccccccHHHHHHHH
Q 011476          206 SFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPKVKDSVKITLLEAADHILNMFDKRITAFAE  285 (485)
Q Consensus       206 ~~~~~~~~~~~~~~~~~~~~vvVVGgG~~g~e~A~~l~~~~~~~~~~~~p~~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~  285 (485)
                      +++.+.++...+++++..++++|||||++|+|+|.+|++++.+.+.+.+|.+....+|+++++.+++++.+++++++.++
T Consensus       200 ~~e~a~~~~~~~~~~~~~~~vvVvGgG~tGvE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il~~~~~~~~~~~~  279 (502)
T 4g6h_A          200 NLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQ  279 (502)
T ss_dssp             HHHHHHHSCTTCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSSTTSCHHHHHHHH
T ss_pred             HHHHHhcccccchhhccccceEEECCCcchhhhHHHHHHHHHHHHHhhcccccccceeEEeccccccccCCCHHHHHHHH
Confidence            99998887777777788889999999999999999999999988888888877778999999999999999999999999


Q ss_pred             HHHHhCCcEEEcCceEEEEeCCcEEEEE-cCCCe--EEEEecCeEEEccCCCCCcchHHHHHHhCC--CCCCceeeCCCc
Q 011476          286 EKFSRDGIDVKLGSMVVKVTDKEIFTKV-RGNGE--TSSMPYGMVVWSTGIAPHAIIKDFMKQVGQ--TNRRALATDEWL  360 (485)
Q Consensus       286 ~~l~~~gV~v~~~~~v~~v~~~~v~~~~-~~~G~--~~~i~~D~vi~a~G~~~~p~~~~l~~~~g~--~~~g~i~vd~~l  360 (485)
                      +.|++.||+++++++|++++++++.... ..+|+  ..+|++|+||||+|+.++|.+.++...+++  +.+|+|.||++|
T Consensus       280 ~~L~~~GV~v~~~~~v~~v~~~~~~~~~~~~dg~~~~~~i~ad~viwa~Gv~~~~~~~~l~~~~~~~~~~~g~I~Vd~~l  359 (502)
T 4g6h_A          280 SHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFL  359 (502)
T ss_dssp             HHHHHTTCEEETTEEEEEECSSEEEEEEECTTSCEEEEEEECSEEEECCCEECCHHHHHHHHHSGGGTTCCSSEEBCTTS
T ss_pred             HHHHhcceeeecCceEEEEeCCceEEEEEecCcccceeeeccCEEEEccCCcCCHHHHhHHHhccccccCCCceeECCcc
Confidence            9999999999999999999998866543 34554  246999999999997666666677777765  667899999999


Q ss_pred             cccCCCCeEEeccccCCCCcchH
Q 011476          361 RVEGSDSIYALGDCATVNQRRVM  383 (485)
Q Consensus       361 ~t~~~~~Vya~GD~~~~~~~~~~  383 (485)
                      |+++.|||||+|||+..+.++.+
T Consensus       360 q~~~~~~IfAiGD~a~~~~p~~a  382 (502)
T 4g6h_A          360 QVKGSNNIFAIGDNAFAGLPPTA  382 (502)
T ss_dssp             BBTTCSSEEECGGGEESSSCCCH
T ss_pred             ccCCCCCEEEEEcccCCCCCCch
Confidence            99889999999999987655443



>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 2e-11
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 2e-10
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 2e-09
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 3e-09
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 2e-08
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 2e-06
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 7e-08
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 1e-07
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-05
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 3e-07
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 6e-07
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 7e-07
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 2e-06
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 8e-07
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 4e-06
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 7e-06
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 3e-05
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 1e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 2e-04
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 5e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 6e-04
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 7e-04
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 0.001
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.002
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.003
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.004
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 0.004
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 0.004
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Apoptosis-inducing factor (AIF)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.4 bits (143), Expect = 2e-11
 Identities = 24/155 (15%), Positives = 51/155 (32%), Gaps = 31/155 (20%)

Query: 181 PGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAA 240
             V+      +++ D + + +                 E K I    I+GGG  G E A 
Sbjct: 12  AEVKSRTTLFRKIGDFRSLEKIS--------------REVKSI---TIIGGGFLGSELAC 54

Query: 241 ELHDFVDEDLFKLYPKVKDSVKITLLEAADHIL-NMFDKRITAFAEEKFSRDGIDVKLGS 299
            L                   ++  L      +  +  + ++ +  EK  R+G+ V   +
Sbjct: 55  ALGRKARA----------LGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNA 104

Query: 300 MVVKVTDKEIFTKVR-GNGETSSMPYGMVVWSTGI 333
           +V  V        ++  +G    +    +V + G+
Sbjct: 105 IVQSVGVSSGKLLIKLKDGRK--VETDHIVAAVGL 137


>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.83
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.81
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.8
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.8
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.77
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.75
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.75
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.74
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.73
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.72
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.71
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.71
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.7
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.7
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.7
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.7
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.68
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.67
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.66
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.65
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.65
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.65
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.64
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.64
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.64
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.61
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.6
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.58
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.56
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.56
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.55
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.54
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.53
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.51
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.51
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.46
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.45
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.4
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.39
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.37
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.36
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.33
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.33
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.3
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.3
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.29
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.25
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.24
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.23
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.22
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.2
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.2
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.2
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.19
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.19
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.18
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.16
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.15
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.15
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.14
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.14
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.12
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.1
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.09
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.08
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.05
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 99.04
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.03
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.03
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.02
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.01
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.01
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.0
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.0
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.0
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.99
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.99
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.96
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.95
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.94
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.92
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.91
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.91
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.91
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.9
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.89
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.89
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.87
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.86
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.86
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.85
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.85
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.79
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.79
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.78
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.78
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.73
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.72
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 98.71
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.66
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.64
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.62
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.61
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.59
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.59
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.56
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.53
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.5
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.48
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.48
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.47
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.46
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.46
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.44
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.42
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.38
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.35
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.35
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.33
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.32
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.29
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.24
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.2
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.2
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.19
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.19
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.16
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.15
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.08
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.06
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.01
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.97
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.96
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.95
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.95
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.91
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.88
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.87
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.85
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.76
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.76
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.72
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.7
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.69
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.66
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.64
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.6
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.56
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.45
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.43
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.34
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.28
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.21
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.19
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.14
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.05
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.04
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.02
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.98
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.93
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.86
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.83
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.8
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.78
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.68
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 96.54
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.49
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.36
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.29
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.19
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.08
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.0
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.93
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.91
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.88
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.87
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.71
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.67
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.62
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.62
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.48
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.45
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.41
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.37
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.32
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 95.31
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.17
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 95.1
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.92
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.88
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 94.75
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.64
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.6
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.54
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.5
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.44
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.38
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.35
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.31
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.29
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.15
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.1
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.49
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 93.46
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.46
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.4
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.31
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.18
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.17
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.16
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.0
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.95
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.91
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.72
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.18
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.16
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.88
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.76
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.61
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.59
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.56
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.42
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 91.41
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.15
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.07
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.07
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.95
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 90.91
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 90.84
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 90.77
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 90.7
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.7
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 90.61
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.6
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.4
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 90.16
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.13
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.98
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 89.94
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 89.85
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.8
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.72
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.66
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.51
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.51
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 89.48
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.42
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.08
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.83
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 88.51
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 88.42
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 88.39
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 88.19
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 88.13
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 87.86
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.83
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.78
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.68
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.65
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.44
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 87.43
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 87.27
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.92
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 86.58
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 86.58
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 86.5
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.39
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 86.18
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 85.96
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 85.66
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.62
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 85.48
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 85.46
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 84.81
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 84.71
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.68
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.61
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 84.45
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 84.3
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.98
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 83.97
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.84
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.77
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.59
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.37
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 83.21
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 82.99
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 82.9
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 82.79
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.43
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 81.89
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 81.88
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 81.81
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 81.67
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 81.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 81.59
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 81.57
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 81.56
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 81.25
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 81.08
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 80.96
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.85
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 80.81
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 80.74
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.56
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 80.53
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 80.28
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 80.23
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 80.12
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH-dependent ferredoxin reductase, BphA4
species: Pseudomonas sp., KKS102 [TaxId: 306]
Probab=99.83  E-value=3e-20  Score=151.10  Aligned_cols=120  Identities=24%  Similarity=0.423  Sum_probs=107.4

Q ss_pred             CCCCCCCCCccccccChhHHHHHHHHHHHHHhhcCCCCCCHHHHhhcccEEEECCChhHHHHHHHHHHhhHHHHHhhCcC
Q 011476          177 TFNTPGVEENCNFLKEVEDAQRIRRNVIESFEKASLPNLSDEERKRILHFVIVGGGPTGVEFAAELHDFVDEDLFKLYPK  256 (485)
Q Consensus       177 ~~~i~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVVGgG~~g~e~A~~l~~~~~~~~~~~~p~  256 (485)
                      .|++||.+..++++++++|+.++++.+                 ..+++++|||||++|+|+|..|++.           
T Consensus         1 iP~ipG~~~~v~~lrtl~Da~~l~~~~-----------------~~~~~vvIIGgG~iG~E~A~~l~~~-----------   52 (121)
T d1d7ya2           1 LPTLQGATMPVHTLRTLEDARRIQAGL-----------------RPQSRLLIVGGGVIGLELAATARTA-----------   52 (121)
T ss_dssp             CGGGTTCSSCEEECCSHHHHHHHHHHC-----------------CTTCEEEEECCSHHHHHHHHHHHHT-----------
T ss_pred             CccCCCCCCCEEEeCCHHHHHHHHHhh-----------------hcCCeEEEECcchhHHHHHHHhhcc-----------
Confidence            378999987799999999999988775                 3457999999999999999999986           


Q ss_pred             CCCCceEEEEecCccccc-cccHHHHHHHHHHHHhCCcEEEcCceEEEEeCCcEEEEEcCCCeEEEEecCeEEEccC
Q 011476          257 VKDSVKITLLEAADHILN-MFDKRITAFAEEKFSRDGIDVKLGSMVVKVTDKEIFTKVRGNGETSSMPYGMVVWSTG  332 (485)
Q Consensus       257 ~~~g~~Vtlv~~~~~~l~-~~~~~~~~~~~~~l~~~gV~v~~~~~v~~v~~~~v~~~~~~~G~~~~i~~D~vi~a~G  332 (485)
                         |.+||++++.+++++ .+++++++.+++.++++||++++++.++++..+.+.+   ++|++  ++||+||+|+|
T Consensus        53 ---g~~Vtli~~~~~~l~~~~~~~~~~~~~~~l~~~GV~i~~~~~v~~~~~~~v~l---~dg~~--i~~D~vi~a~G  121 (121)
T d1d7ya2          53 ---GVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLL---DDGTR--IAADMVVVGIG  121 (121)
T ss_dssp             ---TCEEEEEESSSSTTTTTSCHHHHHHHHHHHHTTTCEEEESCCEEEEETTEEEE---TTSCE--EECSEEEECSC
T ss_pred             ---cceEEEEeeccccccccCCHHHHHHHHHHHHHCCcEEEeCCEEEEEeCCEEEE---CCCCE--EECCEEEEeeC
Confidence               799999999999997 6799999999999999999999999999998876543   57876  99999999998



>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure