Citrus Sinensis ID: 011479

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----
MATQPPAPRQWFRLPSIGRPAPPVTPTPEPPAPQPRPPMIRAPFRPMGQPPLESIPAPAAVGVSSVPTSPIRRTSVPSSPVPRESPSPPSPPATTSPPKPQVSSPSPTKLPSTSSMPTSPPKPAVTTSPPKPLATTFSVPTSPAKPAPTTFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPPKPAPTTFRVPTSPPKPAPSTFSVPTSPAKPKPAVTAAISTTTSPPRVPSPAPVGPRTLLSDGTPPQSPYKKATAPPPSPLTLPPPQFTSKAETQPTIPAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKEVAKNGKVHRKQFSSDSDEVGMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLHNKGSLKTQSDGTGWHSFSSSSDEEKSKKDKNYKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDKGNGHHS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHcccccccccccccccccccEEccEEEEEccccccccccEEEEcccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHEEccccEEEccEEEEEcccccccccEEEEEEEccccccEEEEEccccccc
matqppaprqwfrlpsigrpappvtptpeppapqprppmirapfrpmgqpplesipapaavgvssvptspirrtsvpsspvprespsppsppattsppkpqvsspsptklpstssmptsppkpavttsppkplattfsvptspakpapttfpvittsppkpapttfpgitrsppkpaptvfpvittsppkpapttfrvptsppkpapstfsvptspakpkpavtaaistttspprvpspapvgprtllsdgtppqspykkatapppspltlpppqftskaetqptipaeteQKTVLVQTrsekpkswfngtgnhfdethkpssyahrgnheVHKEVAkngkvhrkqfssdsdevGMRVITIAGENKGAFMEVIRsplkhtfdgtphtlhnkgslktqsdgtgwhsfssssdeekskkdknykakaamlpppmgafmnsnvqgvnNSIVFHsscshhdpgvhlslsrkpsgngfhvkdkgnghhs
matqppaprqwfrlpsigrpaPPVTPTPEPPAPQPRPPMIRAPFRPMGQPPLESIPAPAAVGVSSVPTSPIrrtsvpsspvprespsppsppattsppkpqvsspsPTKLPSTSSMPTSPPKPAVTTSPPKPLATTFSVPTSPAKPAPttfpvittsppkPAPTTFPGITRSPPKPAPTVFPVITTSPPKPAPTTFRVPTSPPKPAPSTFSVPTSPAKPKPAVTAAistttspprvpspapVGPRTLLSDGTPPQSPYKKATAPPPSPLTLPPPQFTSKAETQPTIPAETEQKTVLVQTrsekpkswfngtgnhFDETHKPSSYAHRGNHEVHKevakngkvhrkqfssdsdevgMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLhnkgslktqsdgtgwhsfssssdeekskkdKNYKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSlsrkpsgngfhvkdkgnghhs
MATQPPAPRQWFRLPSIGrpappvtptpeppapqprppmirapFRPMGQPPLESIPAPAAVGVSSVptspirrtsvpsspvprespsppsppattsppkpqvsspsptklpstssmptsppkpAVTTSPPKPLATTFSVPTSPAKPAPTTFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPPKPAPTTFRVPTSPPKPAPSTFSVPTSPAKPKPAVTAAIstttspprvpspapvgprTLLSDGTPPQSPYKKatapppspltlpppQFTSKAETQPTIPAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKEVAKNGKVHRKQFSSDSDEVGMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLHNKGSLKTQSDGTGWHSFssssdeekskkdkNYKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDKGNGHHS
******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************GMRVITIAGENKGAFMEVIRSPLKH***************************************************************VNNSIVFH**********************************
**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************FMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSG**************
MATQPPAPRQWFRLPSIGRPAPP***********PRPPMIRAPFRPMGQPPLESIPAPAA**********************************************************************KPLATTFSVPTSPAKPAPTTFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPP***************************************************PVGPRTLLSD****************SPLTLPPPQF**********PAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKEVAKNGKVH*********EVGMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLHNK*****************************YKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDKGNGHHS
*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VGMRVITIAGENKGAFMEVIR******************************************************PPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATQPPAPRQWFRLPSIGRPAPPVTPTPEPPAPQPRPPMIRAPFRPMGQPPLESIPAPAAVGVSSVPTSPIRRTSVPSSPVPRESPSPPSPPATTSPPKPQVSSPSPTKLPSTSSMPTSPPKPAVTTSPPKPLATTFSVPTSPAKPAPTTFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPPKPAPTTFRVPTSPPKPAPSTFSVPTSPAKPKPAVTAAISTTTSPPRVPSPAPVGPRTLLSDGTPPQSPYKKATAPPPSPLTLPPPQFTSKAETQPTIPAETEQKTVLVQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKEVAKNGKVHRKQFSSDSDEVGMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLHNKGSLKTQSDGTGWHSFSSSSDEEKSKKDKNYKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDKGNGHHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
255585261502 conserved hypothetical protein [Ricinus 0.911 0.878 0.443 1e-69
224127999447 predicted protein [Populus trichocarpa] 0.863 0.935 0.450 1e-62
224068030454 predicted protein [Populus trichocarpa] 0.900 0.960 0.444 7e-59
357512591371 hypothetical protein MTR_7g117980 [Medic 0.502 0.654 0.446 1e-36
297824745385 hypothetical protein ARALYDRAFT_904132 [ 0.287 0.361 0.524 1e-23
147864007277 hypothetical protein VITISV_008152 [Viti 0.378 0.660 0.381 4e-22
315653992 2148 conserved hypothetical protein [Lactobac 0.495 0.111 0.305 2e-21
357514507207 hypothetical protein MTR_8g027290 [Medic 0.227 0.531 0.440 3e-20
296088979 585 unnamed protein product [Vitis vinifera] 0.338 0.280 0.443 4e-18
449445712397 PREDICTED: uncharacterized protein LOC10 0.361 0.440 0.352 3e-17
>gi|255585261|ref|XP_002533331.1| conserved hypothetical protein [Ricinus communis] gi|223526836|gb|EEF29052.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  270 bits (691), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 241/543 (44%), Positives = 294/543 (54%), Gaps = 102/543 (18%)

Query: 1   MATQPPAPRQWFRLPSIGRPAPPVTPTPEPPAP------QPRPPMIRAPFRPMGQPPLES 54
           MA QP   R W RL SI RPAPP +  P PPA       QPR  + R   RP+ QP L +
Sbjct: 1   MANQPSQSRPWSRLYSIARPAPPES-IPTPPAAPESAPGQPRAVLARPSLRPVTQPTLPT 59

Query: 55  IP-----------------------------APA----AVGVSSVPTSPIRRTSVPSSPV 81
            P                             +PA      GV+SVP+SP+ R SVP++ +
Sbjct: 60  RPQEPTQAPQPPVATVPPPVAAPPPATPTQRSPAKPSGGGGVASVPSSPVLRASVPTASL 119

Query: 82  PRESPSPPSPPATTSP----------PKPQVSSPSPTKLPSTSSMPTSPPKPAVTTSPPK 131
           P+   SP        P          P+P+VS+P       TSS+P+SP          K
Sbjct: 120 PK---SPVQTATAVGPVTTSSSVQSSPRPRVSAP-------TSSLPSSPVL--------K 161

Query: 132 PLATTFSVPTSPA-KPAPTTFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPPK 190
           P   TFSVPTSPA KP PTT  + T+      P T         KP PT   V T+   K
Sbjct: 162 P-TQTFSVPTSPATKPMPTTVSLPTS------PAT---------KPMPTTVSVPTSPATK 205

Query: 191 PAPTTFRVPTSP-PKPAPSTFSVPTSPAKPKPAVTAAISTTTSPPR-VPSPAPVGPRTLL 248
           P PTT  VPTSP PKPAP+T SVPTSPA    + T   ++T   P  V  P  + P    
Sbjct: 206 PMPTTISVPTSPLPKPAPATSSVPTSPANRAVSTTTTATSTARVPSPVQYPRTINPVVQ- 264

Query: 249 SDGTPPQSPYKKATAPPPSPLTLPPPQFTSKAETQPTIPAETEQKTVLVQTRSEKPKSWF 308
              +PP+SP    TAPPPSPL LPP +  S AET+  IP   EQKTV+VQ   +KPK W 
Sbjct: 265 ---SPPRSPKLNPTAPPPSPLILPPAKIKSDAETEAKIPLVAEQKTVVVQKTIDKPKPWL 321

Query: 309 NGTGNHFDETHKP--SSYAHRGNHEVHKEVAK-NGKVHRKQFSSDSDEVGMRVITIAGEN 365
              GN   +      SS    G  E  K+  +   KV  K+  S S++ GMRVIT+AGEN
Sbjct: 322 TNGGNSERDLVNAVKSSIGLNGKQETTKDHGETKEKVLHKKIFSGSEDGGMRVITVAGEN 381

Query: 366 KGAFMEVIRSP-LKHTFDGTPHTLHNKGSLKTQSDGTGWHSFSSSSDEEKSK-----KDK 419
           KGAFMEVIRSP  KH F+G+PH LH K +   +SDG  W S+SS+    + +     KDK
Sbjct: 382 KGAFMEVIRSPNKKHVFEGSPHHLHKKDN-DPKSDGIKWISYSSNGSSSEGEGKPKMKDK 440

Query: 420 NYKAKAAMLPPPMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSRKPSGNGFHVKDKG 479
           N+K K  M   PM AFMNSNVQGVNNSIV++SSC+HHDPGVHL+LSRK +G GFHVKD+ 
Sbjct: 441 NHKGKG-MNSLPMTAFMNSNVQGVNNSIVYNSSCTHHDPGVHLALSRKSAGGGFHVKDRS 499

Query: 480 NGH 482
           NGH
Sbjct: 500 NGH 502

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127999|ref|XP_002320216.1| predicted protein [Populus trichocarpa] gi|222860989|gb|EEE98531.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224068030|ref|XP_002302653.1| predicted protein [Populus trichocarpa] gi|222844379|gb|EEE81926.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357512591|ref|XP_003626584.1| hypothetical protein MTR_7g117980 [Medicago truncatula] gi|355501599|gb|AES82802.1| hypothetical protein MTR_7g117980 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297824745|ref|XP_002880255.1| hypothetical protein ARALYDRAFT_904132 [Arabidopsis lyrata subsp. lyrata] gi|297326094|gb|EFH56514.1| hypothetical protein ARALYDRAFT_904132 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147864007|emb|CAN78958.1| hypothetical protein VITISV_008152 [Vitis vinifera] Back     alignment and taxonomy information
>gi|315653992|ref|ZP_07906908.1| conserved hypothetical protein [Lactobacillus iners ATCC 55195] gi|315488688|gb|EFU78334.1| conserved hypothetical protein [Lactobacillus iners ATCC 55195] Back     alignment and taxonomy information
>gi|357514507|ref|XP_003627542.1| hypothetical protein MTR_8g027290 [Medicago truncatula] gi|355521564|gb|AET02018.1| hypothetical protein MTR_8g027290 [Medicago truncatula] Back     alignment and taxonomy information
>gi|296088979|emb|CBI38682.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445712|ref|XP_004140616.1| PREDICTED: uncharacterized protein LOC101216647 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
TAIR|locus:2039987394 AT2G46630 [Arabidopsis thalian 0.702 0.862 0.328 1.5e-35
TAIR|locus:2008895744 LRX1 "AT1G12040" [Arabidopsis 0.196 0.127 0.412 5.4e-16
UNIPROTKB|J3KP74 854 PRG4 "Proteoglycan 4" [Homo sa 0.363 0.206 0.345 3.2e-13
UNIPROTKB|Q92954 1404 PRG4 "Proteoglycan 4" [Homo sa 0.363 0.125 0.345 6.2e-13
TAIR|locus:2824488248 AGP19 "AT1G68725" [Arabidopsis 0.190 0.370 0.440 1.6e-11
TAIR|locus:2161043350 ACA8 "alpha carbonic anhydrase 0.181 0.251 0.436 8.4e-11
UNIPROTKB|F1MDS0 1337 F1MDS0 "Uncharacterized protei 0.194 0.070 0.449 1.8e-10
RGD|1308976 963 Prg4 "proteoglycan 4, (megakar 0.192 0.096 0.441 2e-10
UNIPROTKB|F1LRG9 1010 Prg4 "Protein Prg4" [Rattus no 0.192 0.092 0.441 2.1e-10
UNIPROTKB|F1LRA5 1060 Prg4 "Protein Prg4" [Rattus no 0.192 0.087 0.441 2.2e-10
TAIR|locus:2039987 AT2G46630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 1.5e-35, Sum P(2) = 1.5e-35
 Identities = 123/375 (32%), Positives = 166/375 (44%)

Query:   129 PPKPLATTFS--VPTSPAK-PAPTTFPVITTSPPK----PAPTTFPGITRSPPKP-APTV 180
             PP+P  T+ S  V   PAK P+P        SPP+    P+P        +PP+  AP  
Sbjct:    26 PPQPRPTSRSSLVVRPPAKQPSPPRQRQ-PRSPPRQQDPPSPPRQQQQPLTPPRQKAPPT 84

Query:   181 FPVITTSPPKPAPTTFRVPTSPPK----PAPSTFSVPTSPAKPKPAVTAAIXXXXXXXXX 236
              P    SP    P+    P +PPK    P P   S  TSP  PK  V  A+         
Sbjct:    85 SPPQERSPYHSPPSRHMSPPTPPKAATPPPPPPRSSYTSPPSPKE-VQEALPPRKPNSPP 143

Query:   237 XXXXXXXXXTLLSDGTPPQSPYKKXXXXXXXXXXXXXXQFTSKAETQPTIPAETEQKTVL 296
                      T  S+    +SP  +               ++  A    +   ET QK +L
Sbjct:   144 SPAHSSRSTT--SESVKTRSP-SESENHRKAPSPRVLSPYSLPASLLHS-ERETTQKNIL 199

Query:   297 VQTRSEKPKSWFNGTGNHFDETHKPSSYAHRGNHEVHKEVAKNG--KVHRKQFSSDSDEV 354
                ++ +     +   NH  + ++  +Y    ++  ++    N   K+HR+  SSDS+ +
Sbjct:   200 TAEKTSQTHETNHHNQNHNHDYNQNHNYNQNHSYNQNQNHQGNNPKKMHRQPSSSDSENI 259

Query:   355 -GMRVITIAGENKGAFMEVIRSPLKHTFDGTPHTLHNKGSLKTQSDGTGWHSFXXXXXXX 413
                RVITIAGENKGA ME++RSP  +   G+    H+       S GTG           
Sbjct:   260 MSTRVITIAGENKGAVMEILRSPQGNKTGGSG--THSS----RVSHGTGEKGRRLQSSSS 313

Query:   414 XXXXXXNYKAKAAMLPP-------PMGAFMNSNVQGVNNSIVFHSSCSHHDPGVHLSLSR 466
                     K K     P       PM AFMNSNVQ +NNSIV++S+ SHHDPGVHL +SR
Sbjct:   314 SSSDEGEGKKKTTKNVPNKGNSNLPMKAFMNSNVQMINNSIVYNSTASHHDPGVHLKISR 373

Query:   467 KP-SGNGFHVKDKGN 480
             KP S NGFHV D GN
Sbjct:   374 KPGSDNGFHVSDYGN 388
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP74 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q92954 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2824488 AGP19 "AT1G68725" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161043 ACA8 "alpha carbonic anhydrase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDS0 F1MDS0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308976 Prg4 "proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRG9 Prg4 "Protein Prg4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRA5 Prg4 "Protein Prg4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00140481
hypothetical protein (447 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-20
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-18
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-16
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-14
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 9e-11
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-11
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-10
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-10
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-09
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 3e-09
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-09
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-08
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-07
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-07
PRK12727 559 PRK12727, PRK12727, flagellar biosynthesis regulat 2e-07
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 7e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-06
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-06
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 3e-06
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 4e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-06
PRK12727559 PRK12727, PRK12727, flagellar biosynthesis regulat 8e-06
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-06
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 1e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-05
pfam04652315 pfam04652, DUF605, Vta1 like 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-05
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 3e-05
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 3e-05
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 3e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 3e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 4e-05
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 4e-05
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 4e-05
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 4e-05
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 5e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-05
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 6e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 1e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 2e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-04
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 3e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 4e-04
pfam04652315 pfam04652, DUF605, Vta1 like 4e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 4e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-04
pfam04652315 pfam04652, DUF605, Vta1 like 5e-04
pfam04484313 pfam04484, DUF566, Family of unknown function (DUF 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 7e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 7e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 7e-04
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 9e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.001
pfam04652315 pfam04652, DUF605, Vta1 like 0.001
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.002
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
pfam04652315 pfam04652, DUF605, Vta1 like 0.002
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
COG3889872 COG3889, COG3889, Predicted solute binding protein 0.002
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
pfam04652315 pfam04652, DUF605, Vta1 like 0.003
pfam04652315 pfam04652, DUF605, Vta1 like 0.003
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.003
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 0.003
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.003
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.004
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.004
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.004
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.004
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.004
PRK11907 814 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl 0.004
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information 
 Score = 93.8 bits (233), Expect = 5e-20
 Identities = 82/331 (24%), Positives = 104/331 (31%), Gaps = 31/331 (9%)

Query: 5    PPAPRQWFRLPSIGRPAPPVTPTPEPPAPQPRPPMIRAPF-RPMGQPPLESIPAPAAVGV 63
            P   R   R P+   P PP T  P+PP P P P         P   PP E      A G 
Sbjct: 2601 PVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGR 2660

Query: 64   SSVPTSPIRRTSVPSSPVPRESPSPPSPPATTSP------PKPQVSSPSPTKLPSTSSMP 117
             S P    R      +  P + P   +   T         P P   +P P      S+ P
Sbjct: 2661 VSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATP 2720

Query: 118  TSP-PKPAVTTSPPKPLA----TTFSVPTSPAKPAPTTFPVITTSPPKPAPTTFPGITRS 172
              P P  A   SP  P A       + P +P  PA    P  T  PP PAP   P     
Sbjct: 2721 LPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPP 2780

Query: 173  PPKPAPTVFPVITTSPPKPAPTTFRVPTSPPKPAPSTFSVPTSPAKPKPAVTAAISTTTS 232
                 P V  +  +    P+P     P +      +      SPA P P  T+A  T   
Sbjct: 2781 RRLTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPP 2840

Query: 233  PPRVPSPAP------VGPRTLLSDGTPPQSPYKKATAP-------------PPSPLTLPP 273
            PP  P P        V P   +    P +SP  K  AP               S  +   
Sbjct: 2841 PPPGPPPPSLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLARPAVSRSTESFAL 2900

Query: 274  PQFTSKAETQPTIPAETEQKTVLVQTRSEKP 304
            P    +   QP  P   + +         +P
Sbjct: 2901 PPDQPERPPQPQAPPPPQPQPQPPPPPQPQP 2931

Length = 3151
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218107 pfam04484, DUF566, Family of unknown function (DUF566) Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

No hit with probability above 80.00

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-14
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-11
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-08
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-13
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-11
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 9e-08
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-06
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-06
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 8e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 4e-04
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-05
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-04
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 6e-05
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 4e-04
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 8e-04
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
 Score = 74.7 bits (183), Expect = 3e-14
 Identities = 64/258 (24%), Positives = 93/258 (36%), Gaps = 20/258 (7%)

Query: 22   PPVTPTPEPPAPQPRPPMIRAPFRPMGQPPLESIPAPAAVGVSSVPTSPIRRTSVPSSPV 81
            P    TP   +P      + +P      P ++                         SP 
Sbjct: 1479 PEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFGDYGLLGAASPYKGVQSPG 1538

Query: 82   PRESPSPPSPPATTSPPKPQVSSPSPTKLPSTSSMPTSPPKPAVTTSPPKPLATTFSVPT 141
                 S    P       P  S  SP    S + MP+SP      TSP     +    PT
Sbjct: 1539 YTSPFSSAMSPGY-GLTSPSYSPSSPGYSTSPAYMPSSPS--YSPTSPSYSPTSPSYSPT 1595

Query: 142  SPAKPAPT------TFPVITTSPPKPAPTTFPGITRSPPKPAPTVFPVITTSPPKPAPTT 195
            SP+  +PT      T P  + + P  +PT+ P  + + P  +PT  P  + + P  +PT+
Sbjct: 1596 SPS-YSPTSPSYSATSPSYSPTSPSYSPTS-PSYSPTSPSYSPTS-PSYSPTSPSYSPTS 1652

Query: 196  FRVPT-SPPKPAPSTFSVPTSPAKPKPAVTAAISTTTSPPRVPSPAPVGPRTLLSDGTPP 254
               P+ SP  P+ S  S   SP  P  + T+   + TSP   P+     P +     T P
Sbjct: 1653 ---PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP 1709

Query: 255  Q----SPYKKATAPPPSP 268
                 SP    T+P  SP
Sbjct: 1710 SYSPTSPSYSPTSPSYSP 1727
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00