Citrus Sinensis ID: 011492

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----
MPSAAAAHTLSSSISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRSLSPSNDAVSSSNDDAFEDSPFEDEDDDAEYEDVDDESDGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
ccHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHccccEEEccccccccccccEEEEEccEEEEEEEcccccccccccccHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEccccccHHHHHHHHHccccEEEccccccccccccccEEcccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHccc
cccHHHHHHHHHHHHHHHcccccccccccccccHHHccccHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHcccccEEEEccccccHHHHHHHHHHHcccccccccccccccccEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEcccEEEccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHHHHHHHcc
mpsaaaahTLSSSISLisaipklpfsssfsssfpilrsfspqllslslhkhyplplpltrhlrslspsndavsssnddafedspfededddaeyedvddesdgqdfgidVDALEREAKDAVREYSSLLSRQLIIQdetddrkdsgkkqkkrkttignvpehllprvaivgrpnvgksalfnrlvggnraivvdepgvtrdrmygrsfwgeHEFMLVDtggvlnvsksqpnimedLAITttigmegiplATREAAVARMPSMIERQATAAIEESCVIIFLVdgqagltaADEEIADWLRKNYMDKFIILAVNkcesprkgimqvsefwslgfsplpisaisgtgtGELLDLVCSELKkvegtedlveeenripaiaivgrpnvgkssilnalvgedrtivspisgttrdaidteftgpegqkfrlidTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQadwrdhrwgm
MPSAAAAHTLSSSISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRSLSPsndavsssnddafedsPFEDEDDDAeyedvddesdgqdfgiDVDALEREAKDAVREyssllsrqliiqdetddrkdsgkkqkkrkttignvpehllprvaiVGRPNVGKSAlfnrlvggnraivvdepgvtrDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEgtedlveeenripaiaivgrpnvgkSSILNalvgedrtivspisgttrdaidteftgpegqkfrlidtaGIRKRAaiassgsttealsvnrafrAIRRSDVVALVIEAMACIteqadwrdhrwgm
MpsaaaahtlsssislisaipklpfsssfsssfpilrsfspQLLSLSLHKHYPLPLPLTRHLRslspsndavsssnddafedspfededddaeyedvddesdGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDETddrkdsgkkqkkrkTTIGNVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
********************************FPILRSFSPQLLSLSLHKHYPLPLP***************************************************************************************************NVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIA****TTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRD*****
**********SSSISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRS*************DAFEDSPFEDEDDDAEYEDVDDESDGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDE*DDRKDS***************EHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELK**************IPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
***********SSISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRSL************************************DGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDE****************TIGNVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
*************ISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRS****************************EYEDVDDESDGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVE**EDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSAAAAHTLSSSISLISAIPKLPFSSSFSSSFPILRSFSPQLLSLSLHKHYPLPLPLTRHLRSLSPSNDAVSSSNDDAFEDSPFEDEDDDAEYEDVDDESDGQDFGIDxxxxxxxxxxxxxxxxxxxxxQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHRWGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query484 2.2.26 [Sep-21-2011]
B2J1L2 456 GTPase Der OS=Nostoc punc yes no 0.561 0.596 0.536 4e-79
Q8YZH7 453 GTPase Der OS=Nostoc sp. yes no 0.561 0.600 0.549 6e-78
Q3M929 453 GTPase Der OS=Anabaena va yes no 0.561 0.600 0.543 1e-77
B8HQE1 453 GTPase Der OS=Cyanothece yes no 0.557 0.596 0.512 3e-75
B7KHD2 452 GTPase Der OS=Cyanothece yes no 0.561 0.601 0.520 5e-74
B0JFL6 452 GTPase Der OS=Microcystis yes no 0.561 0.601 0.504 5e-73
Q8DKI1 449 GTPase Der OS=Thermosynec yes no 0.561 0.605 0.511 1e-71
B7K1S0 452 GTPase Der OS=Cyanothece yes no 0.561 0.601 0.498 2e-71
B1XLH8 453 GTPase Der OS=Synechococc yes no 0.561 0.600 0.504 2e-71
Q119L7 453 GTPase Der OS=Trichodesmi yes no 0.561 0.600 0.501 3e-71
>sp|B2J1L2|DER_NOSP7 GTPase Der OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=der PE=3 SV=1 Back     alignment and function desciption
 Score =  295 bits (756), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 168/313 (53%), Positives = 208/313 (66%), Gaps = 41/313 (13%)

Query: 163 LPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVL 222
           LP VAI+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  +FW   EF++VDTGG+ 
Sbjct: 3   LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPAFWNGREFLVVDTGGL- 61

Query: 223 NVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDG 282
                   +  D         E +PL             I +QA  A+ E+C  IF+VDG
Sbjct: 62  --------VFND-------DTEFLPL-------------IRQQAMTALAEACAAIFVVDG 93

Query: 283 QAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFS-PLPISAISG 341
           Q G T+AD+EIA+W+R+  +   ++LAVNKCESP +G+MQ +EFW LG   P PISAI G
Sbjct: 94  QTGPTSADQEIAEWMRQQRVP--VLLAVNKCESPDQGLMQAAEFWELGLGEPYPISAIHG 151

Query: 342 TGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSP 401
           +GTGELLD + + +  VE     + E N I  +AIVGRPNVGKSS+LNA VGE+R IVSP
Sbjct: 152 SGTGELLDELVNHIPAVED----IPETNEI-KVAIVGRPNVGKSSLLNAFVGEERAIVSP 206

Query: 402 ISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVV 461
           ISGTTRDAIDT     +GQ +RLIDTAGIRK+  I      TE  S+NRAF+AIRR+DVV
Sbjct: 207 ISGTTRDAIDT-VIERDGQTYRLIDTAGIRKKKHIEYG---TEFFSINRAFKAIRRADVV 262

Query: 462 ALVIEAMACITEQ 474
            LV++A+  +TEQ
Sbjct: 263 LLVLDAVDGVTEQ 275
GTPase that plays an essential role in the late steps of ribosome biogenesis.
Nostoc punctiforme (strain ATCC 29133 / PCC 73102) (taxid: 63737)
>sp|Q8YZH7|DER_NOSS1 GTPase Der OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q3M929|DER_ANAVT GTPase Der OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B8HQE1|DER_CYAP4 GTPase Der OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B7KHD2|DER_CYAP7 GTPase Der OS=Cyanothece sp. (strain PCC 7424) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B0JFL6|DER_MICAN GTPase Der OS=Microcystis aeruginosa (strain NIES-843) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q8DKI1|DER_THEEB GTPase Der OS=Thermosynechococcus elongatus (strain BP-1) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B7K1S0|DER_CYAP8 GTPase Der OS=Cyanothece sp. (strain PCC 8801) GN=der PE=3 SV=1 Back     alignment and function description
>sp|B1XLH8|DER_SYNP2 GTPase Der OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=der PE=3 SV=1 Back     alignment and function description
>sp|Q119L7|DER_TRIEI GTPase Der OS=Trichodesmium erythraeum (strain IMS101) GN=der PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
255544860 624 GTP-binding protein enga, putative [Rici 0.776 0.602 0.815 1e-177
359478737 676 PREDICTED: GTPase Der-like [Vitis vinife 0.783 0.560 0.800 1e-175
449448728 660 PREDICTED: GTPase Der-like [Cucumis sati 0.811 0.595 0.798 1e-173
356542027 632 PREDICTED: GTPase Der-like [Glycine max] 0.772 0.591 0.815 1e-170
297829768 661 EMB2738 [Arabidopsis lyrata subsp. lyrat 0.747 0.547 0.752 1e-155
145332365 587 GTP-binding protein [Arabidopsis thalian 0.747 0.616 0.755 1e-155
30682040 663 GTP-binding protein [Arabidopsis thalian 0.747 0.546 0.755 1e-155
224106171489 predicted protein [Populus trichocarpa] 0.663 0.656 0.872 1e-155
414591757 653 TPA: hypothetical protein ZEAMMB73_01204 0.752 0.557 0.710 1e-154
226503143 653 uncharacterized protein LOC100279896 [Ze 0.752 0.557 0.707 1e-153
>gi|255544860|ref|XP_002513491.1| GTP-binding protein enga, putative [Ricinus communis] gi|223547399|gb|EEF48894.1| GTP-binding protein enga, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  629 bits (1622), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 309/379 (81%), Positives = 352/379 (92%), Gaps = 3/379 (0%)

Query: 101 SDGQDFGIDVDALEREAKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPE 160
           SD  D+ ID+DALE+EA+D VREYS+ LSRQL I+D++DD+K++ +KQK++K TI ++P+
Sbjct: 79  SDSDDYAIDIDALEQEAEDVVREYSTSLSRQLRIEDDSDDKKET-RKQKRQKFTIPDIPD 137

Query: 161 HLLPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGG 220
           +LLPRVAIVGRPNVGKSALFNRLVGGN+AIVVDEPGVTRDR+YGRSFWG+ EFM+VDTGG
Sbjct: 138 NLLPRVAIVGRPNVGKSALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDFEFMVVDTGG 197

Query: 221 VLNVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLV 280
           VL +S+SQ N+MEDLAITTTIGM+GIPLA+REAAVARMPSMIERQA AA+EES VIIFLV
Sbjct: 198 VLTISQSQDNVMEDLAITTTIGMDGIPLASREAAVARMPSMIERQAAAAVEESSVIIFLV 257

Query: 281 DGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAIS 340
           DGQAGL AAD EIADWLRKNY +KFIILAVNKCESP+KGIMQ +EFWSLG SP+PISA+S
Sbjct: 258 DGQAGLIAADIEIADWLRKNYSNKFIILAVNKCESPKKGIMQAAEFWSLGLSPIPISALS 317

Query: 341 GTGTGELLDLVCSELKKVEGTEDL-VEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIV 399
           GTGTGELLDLVCS+L KVE ++ L  EE+N +PAIAIVGRPNVGKSSILNALVGEDRTIV
Sbjct: 318 GTGTGELLDLVCSQLAKVEVSKHLDNEEQNYVPAIAIVGRPNVGKSSILNALVGEDRTIV 377

Query: 400 SPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSD 459
           SPISGTTRDAIDTEF+GP+GQKFRLIDTAGIR+RAA+ASSGS TEALSVNRAFRAIRRSD
Sbjct: 378 SPISGTTRDAIDTEFSGPDGQKFRLIDTAGIRRRAAVASSGSLTEALSVNRAFRAIRRSD 437

Query: 460 VVALVIEAMACITEQADWR 478
           VVALVIEAMACITEQ D+R
Sbjct: 438 VVALVIEAMACITEQ-DFR 455

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359478737|ref|XP_002282837.2| PREDICTED: GTPase Der-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449448728|ref|XP_004142117.1| PREDICTED: GTPase Der-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356542027|ref|XP_003539473.1| PREDICTED: GTPase Der-like [Glycine max] Back     alignment and taxonomy information
>gi|297829768|ref|XP_002882766.1| EMB2738 [Arabidopsis lyrata subsp. lyrata] gi|297328606|gb|EFH59025.1| EMB2738 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145332365|ref|NP_001078139.1| GTP-binding protein [Arabidopsis thaliana] gi|332641626|gb|AEE75147.1| GTP-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30682040|ref|NP_187815.2| GTP-binding protein [Arabidopsis thaliana] gi|209529777|gb|ACI49783.1| At3g12080 [Arabidopsis thaliana] gi|332641625|gb|AEE75146.1| GTP-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224106171|ref|XP_002314070.1| predicted protein [Populus trichocarpa] gi|222850478|gb|EEE88025.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|414591757|tpg|DAA42328.1| TPA: hypothetical protein ZEAMMB73_012049 [Zea mays] Back     alignment and taxonomy information
>gi|226503143|ref|NP_001146320.1| uncharacterized protein LOC100279896 [Zea mays] gi|219886617|gb|ACL53683.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
TAIR|locus:2099277 663 emb2738 "embryo defective 2738 0.766 0.559 0.739 1.2e-143
UNIPROTKB|Q3Z6P5 441 der "GTPase Der" [Dehalococcoi 0.413 0.453 0.426 1.1e-48
TIGR_CMR|DET_1395 441 DET_1395 "GTP-binding protein" 0.413 0.453 0.426 1.1e-48
GENEDB_PFALCIPARUM|PFL0835w 874 PFL0835w "GTP-binding protein, 0.347 0.192 0.451 5.1e-48
UNIPROTKB|Q8I5N5 874 PFL0835w "GTP binding protein, 0.347 0.192 0.451 5.1e-48
UNIPROTKB|Q2GGW4 442 engA "GTPase Der" [Ehrlichia c 0.425 0.466 0.407 2.9e-44
TIGR_CMR|ECH_0504 442 ECH_0504 "GTP-binding protein 0.425 0.466 0.407 2.9e-44
UNIPROTKB|Q2GKV6 440 der "GTPase Der" [Anaplasma ph 0.475 0.522 0.348 4.6e-42
TIGR_CMR|APH_0390 440 APH_0390 "putative GTP-binding 0.475 0.522 0.348 4.6e-42
UNIPROTKB|Q81SW9 436 der "GTPase Der" [Bacillus ant 0.421 0.467 0.453 1.2e-40
TAIR|locus:2099277 emb2738 "embryo defective 2738" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1404 (499.3 bits), Expect = 1.2e-143, P = 1.2e-143
 Identities = 276/373 (73%), Positives = 321/373 (86%)

Query:   104 QDFGIDVDALEREAKDAVREYSSLLSRQLIIQDETXXXXXXXXXXXXXXTTIGNVPEHLL 163
             +D  ID+  LE+EA+D VR+Y++ LSR+L I+DET                   +PEHLL
Sbjct:    99 EDDSIDISVLEKEARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLL 158

Query:   164 PRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLN 223
              RVAIVGRPNVGKSALFNRLVG NRAIVVDEPGVTRDR+YGRS+WG+ EF++VDTGGV+ 
Sbjct:   159 QRVAIVGRPNVGKSALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMT 218

Query:   224 VSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQ 283
             VSKS   +ME+L ++TTIGMEGIPL++REAA+ARMPSMIE+QATAA++ES VIIF+VDGQ
Sbjct:   219 VSKSPSGVMEELNVSTTIGMEGIPLSSREAAIARMPSMIEKQATAAVDESAVIIFVVDGQ 278

Query:   284 AGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFSPLPISAISGTG 343
             AG + AD EIADWLRK Y  K+IILAVNKCESPRKG+MQ SEFWSLGF+P+PISA+SGTG
Sbjct:   279 AGPSGADVEIADWLRKYYSHKYIILAVNKCESPRKGLMQASEFWSLGFTPIPISALSGTG 338

Query:   344 TGELLDLVCSELKKVEGTEDLVEEE--NRIPAIAIVGRPNVGKSSILNALVGEDRTIVSP 401
             TGELLDLVCS L K+E  E++ EEE  N IPAIAI+GRPNVGKSSILNALV EDRTIVSP
Sbjct:   339 TGELLDLVCSGLIKLEIMENIEEEEEENYIPAIAIIGRPNVGKSSILNALVREDRTIVSP 398

Query:   402 ISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVV 461
             +SGTTRDAID EFTGP+G+KFRLIDTAGIRK++++ASSGSTTEA+SVNRAFRAIRRSDVV
Sbjct:   399 VSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRAFRAIRRSDVV 458

Query:   462 ALVIEAMACITEQ 474
             ALVIEAMACITEQ
Sbjct:   459 ALVIEAMACITEQ 471
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009507 "chloroplast" evidence=IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
UNIPROTKB|Q3Z6P5 der "GTPase Der" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1395 DET_1395 "GTP-binding protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL0835w PFL0835w "GTP-binding protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I5N5 PFL0835w "GTP binding protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GGW4 engA "GTPase Der" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0504 ECH_0504 "GTP-binding protein EngA" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
UNIPROTKB|Q2GKV6 der "GTPase Der" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0390 APH_0390 "putative GTP-binding protein EngA" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
UNIPROTKB|Q81SW9 der "GTPase Der" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IX.3521.1
hypothetical protein; GTPase of unknown physiological role (By similarity) (489 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.4400.1
hypothetical protein (451 aa)
  ••  • 0.881
gw1.VII.3631.1
hypothetical protein (351 aa)
• ••  ••0.802
eugene3.27090001
Predicted protein (198 aa)
•       0.799
gw1.XIII.3227.1
hypothetical protein (366 aa)
•       0.795
estExt_fgenesh4_pg.C_LG_VIII0269
hypothetical protein (397 aa)
• ••  • 0.764
eugene3.00012981
hypothetical protein (370 aa)
      • 0.720
eugene3.00031274
aminoacyl-tRNA ligase (EC-6.1.1.2) (404 aa)
•  •    0.720
estExt_fgenesh4_pg.C_LG_I2552
hypothetical protein (640 aa)
  •   • 0.713
gw1.X.1153.1
hypothetical protein; Excises uracil residues from the DNA which can arise as a result of misin [...] (216 aa)
•     • 0.678
gw1.28.724.1
histidine-tRNA ligase (EC-6.1.1.21) (441 aa)
•     • 0.661

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 1e-132
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 1e-127
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 1e-112
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Revie 2e-70
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 3e-69
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase 8e-66
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 1e-48
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 2e-30
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 9e-29
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 4e-28
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 3e-27
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 3e-27
PRK05291 449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 4e-27
COG0486 454 COG0486, ThdF, Predicted GTPase [General function 5e-25
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 8e-25
PRK00089292 PRK00089, era, GTPase Era; Reviewed 2e-22
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 4e-22
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 7e-22
cd00880161 cd00880, Era_like, E 1e-21
TIGR00450 442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 2e-21
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 3e-20
cd04163168 cd04163, Era, E 6e-20
COG0486454 COG0486, ThdF, Predicted GTPase [General function 2e-19
cd00880161 cd00880, Era_like, E 2e-19
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 5e-18
COG1159298 COG1159, Era, GTPase [General function prediction 5e-18
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 8e-18
cd04163168 cd04163, Era, E 3e-17
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 6e-17
COG1159 298 COG1159, Era, GTPase [General function prediction 1e-15
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-15
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 7e-15
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 5e-14
TIGR00436 270 TIGR00436, era, GTP-binding protein Era 6e-14
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 1e-13
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-12
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 2e-12
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 3e-12
TIGR00436270 TIGR00436, era, GTP-binding protein Era 4e-12
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 4e-12
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 1e-11
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 2e-11
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 2e-11
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Revie 3e-11
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 3e-11
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 3e-11
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 4e-11
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 4e-11
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 9e-11
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 7e-10
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 1e-09
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 1e-09
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 1e-09
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 5e-09
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 8e-09
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 2e-08
cd11383140 cd11383, YfjP, YfjP GTPase 7e-08
PRK15494 339 PRK15494, era, GTPase Era; Provisional 9e-08
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 1e-07
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 3e-07
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 1e-06
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 1e-06
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 1e-06
PRK15494339 PRK15494, era, GTPase Era; Provisional 2e-06
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 2e-06
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 2e-06
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 4e-06
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 5e-06
COG1100 219 COG1100, COG1100, GTPase SAR1 and related small G 1e-05
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 1e-05
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 2e-05
cd01878204 cd01878, HflX, HflX GTPase family 2e-05
COG1163 365 COG1163, DRG, Predicted GTPase [General function p 2e-05
cd01896 233 cd01896, DRG, Developmentally Regulated GTP-bindin 3e-05
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-05
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 4e-05
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 5e-05
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 5e-05
pfam03193161 pfam03193, DUF258, Protein of unknown function, DU 5e-05
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 8e-05
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 8e-05
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 8e-05
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 1e-04
COG2262 411 COG2262, HflX, GTPases [General function predictio 1e-04
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 1e-04
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 2e-04
COG1162301 COG1162, COG1162, Predicted GTPases [General funct 3e-04
pfam08477116 pfam08477, Miro, Miro-like protein 4e-04
cd01853 248 cd01853, Toc34_like, Translocon at the Outer-envel 4e-04
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; 5e-04
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 5e-04
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 6e-04
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 0.001
cd11383140 cd11383, YfjP, YfjP GTPase 0.001
COG0536369 COG0536, Obg, Predicted GTPase [General function p 0.002
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 0.003
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 0.003
cd01878204 cd01878, HflX, HflX GTPase family 0.004
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 0.004
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information 
 Score =  390 bits (1004), Expect = e-132
 Identities = 156/313 (49%), Positives = 192/313 (61%), Gaps = 42/313 (13%)

Query: 163 LPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVL 222
            P VAIVGRPNVGKS LFNRL G   AIV D PGVTRDR+YG + W   EF+L+DTGG+ 
Sbjct: 1   KPVVAIVGRPNVGKSTLFNRLTGKRDAIVADTPGVTRDRIYGEAEWLGREFILIDTGGI- 59

Query: 223 NVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDG 282
                                +G     RE            QA  AIEE+ VI+F+VDG
Sbjct: 60  -----------------EPDDDGFEKQIRE------------QAELAIEEADVILFVVDG 90

Query: 283 QAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGFS-PLPISAISG 341
           +AGLT ADEEIA  LRK+  +K +IL VNK + P        EF+SLG   P PISA  G
Sbjct: 91  RAGLTPADEEIAKILRKS--NKPVILVVNKVDGP-DEEADAYEFYSLGLGEPYPISAEHG 147

Query: 342 TGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSP 401
            G G+LLD +  EL +    E+  +EE+    IAI+GRPNVGKSS++NAL+GE+R IVS 
Sbjct: 148 RGIGDLLDAILEELPE----EEEEDEEDEPIKIAIIGRPNVGKSSLINALLGEERVIVSD 203

Query: 402 ISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVV 461
           I+GTTRD+IDT F   +GQK+ LIDTAGIR++  +       E  SV R  +AI R+DVV
Sbjct: 204 IAGTTRDSIDTPFE-RDGQKYTLIDTAGIRRKGKVTEG---VEKYSVIRTLKAIERADVV 259

Query: 462 ALVIEAMACITEQ 474
            LVI+A   ITEQ
Sbjct: 260 LLVIDATEGITEQ 272

Length = 435
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206652 cd01853, Toc34_like, Translocon at the Outer-envelope membrane of Chloroplasts 34-like (Toc34-like) Back     alignment and domain information
>gnl|CDD|236563 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 484
COG1160 444 Predicted GTPases [General function prediction onl 100.0
PRK03003 472 GTP-binding protein Der; Reviewed 100.0
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 100.0
PRK00093 435 GTP-binding protein Der; Reviewed 100.0
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 100.0
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.9
COG1159298 Era GTPase [General function prediction only] 99.88
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.87
COG0486454 ThdF Predicted GTPase [General function prediction 99.86
KOG1191 531 consensus Mitochondrial GTPase [Translation, ribos 99.86
PRK12289352 GTPase RsgA; Reviewed 99.86
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.86
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.85
PRK09563287 rbgA GTPase YlqF; Reviewed 99.85
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.85
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.85
COG1160444 Predicted GTPases [General function prediction onl 99.84
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.84
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.83
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.83
PRK12288347 GTPase RsgA; Reviewed 99.83
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.83
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.82
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.82
COG2262411 HflX GTPases [General function prediction only] 99.82
PRK15494339 era GTPase Era; Provisional 99.82
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.81
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.8
KOG1424 562 consensus Predicted GTP-binding protein MMR1 [Gene 99.8
PRK11058426 GTPase HflX; Provisional 99.79
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.79
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.78
COG0218200 Predicted GTPase [General function prediction only 99.78
PRK12299335 obgE GTPase CgtA; Reviewed 99.77
PRK00098298 GTPase RsgA; Reviewed 99.77
COG1159 298 Era GTPase [General function prediction only] 99.77
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.77
COG1162301 Predicted GTPases [General function prediction onl 99.77
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.77
PRK00089292 era GTPase Era; Reviewed 99.77
PRK03003472 GTP-binding protein Der; Reviewed 99.77
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.77
COG1161322 Predicted GTPases [General function prediction onl 99.76
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.76
PRK12296500 obgE GTPase CgtA; Reviewed 99.75
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.75
PRK12297424 obgE GTPase CgtA; Reviewed 99.75
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.75
COG0486 454 ThdF Predicted GTPase [General function prediction 99.75
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.75
PRK00093435 GTP-binding protein Der; Reviewed 99.75
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.74
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.74
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.74
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.74
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.73
KOG2423 572 consensus Nucleolar GTPase [General function predi 99.73
PRK12298390 obgE GTPase CgtA; Reviewed 99.73
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.72
PRK13796365 GTPase YqeH; Provisional 99.72
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.72
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.72
COG1163365 DRG Predicted GTPase [General function prediction 99.72
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.72
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.71
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.71
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.71
PRK04213201 GTP-binding protein; Provisional 99.7
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.7
KOG2484435 consensus GTPase [General function prediction only 99.7
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.7
COG1084346 Predicted GTPase [General function prediction only 99.7
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.7
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.7
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.69
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.69
cd00881189 GTP_translation_factor GTP translation factor fami 99.69
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.69
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.69
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.69
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.69
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.69
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.69
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.69
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.68
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.68
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.68
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.68
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.67
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.67
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.67
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.67
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.67
cd01896233 DRG The developmentally regulated GTP-binding prot 99.67
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.67
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.67
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.67
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.67
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.67
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.66
PTZ00369189 Ras-like protein; Provisional 99.66
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.66
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.66
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.66
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.66
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.66
PRK05306 787 infB translation initiation factor IF-2; Validated 99.66
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.66
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.66
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.66
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.65
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.65
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.65
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.65
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.65
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.65
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.65
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.65
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.65
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.65
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.65
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.65
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.65
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.65
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.65
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.65
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.65
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.65
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.65
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.65
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.65
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.65
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.65
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.64
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.64
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.64
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.64
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.64
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.64
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.64
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.64
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.64
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.64
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.64
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.63
PLN00223181 ADP-ribosylation factor; Provisional 99.63
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.63
PRK01889356 GTPase RsgA; Reviewed 99.63
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.63
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.63
PLN03118211 Rab family protein; Provisional 99.63
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.63
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.63
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.63
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.63
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.63
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.63
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.63
CHL00189 742 infB translation initiation factor 2; Provisional 99.63
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.63
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.63
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.62
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.62
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.62
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.62
PTZ00133182 ADP-ribosylation factor; Provisional 99.62
PLN03110216 Rab GTPase; Provisional 99.62
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.62
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.62
PF04548 212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.62
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.62
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.62
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.61
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.61
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.61
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.61
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.61
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.61
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.61
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.61
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.61
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.61
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.61
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.6
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.6
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.6
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.59
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.59
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.59
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.59
PRK12317425 elongation factor 1-alpha; Reviewed 99.59
COG0536369 Obg Predicted GTPase [General function prediction 99.59
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.58
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.58
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.58
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.58
KOG0394210 consensus Ras-related GTPase [General function pre 99.58
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.57
PLN03108210 Rab family protein; Provisional 99.57
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.57
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.57
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.57
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.57
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.56
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.56
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.56
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.56
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.56
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.56
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.56
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.55
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.55
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.55
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 99.55
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.55
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.54
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.54
PRK04004 586 translation initiation factor IF-2; Validated 99.53
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 99.53
COG3596296 Predicted GTPase [General function prediction only 99.53
PRK10218 607 GTP-binding protein; Provisional 99.53
PRK05433 600 GTP-binding protein LepA; Provisional 99.52
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.52
CHL00071409 tufA elongation factor Tu 99.52
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.51
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.51
PRK12736394 elongation factor Tu; Reviewed 99.5
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.5
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.5
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.5
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.49
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.49
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.49
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.48
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.48
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.48
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.48
PRK12735396 elongation factor Tu; Reviewed 99.47
PLN03127447 Elongation factor Tu; Provisional 99.46
KOG1145 683 consensus Mitochondrial translation initiation fac 99.46
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.46
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.45
PRK00089 292 era GTPase Era; Reviewed 99.45
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.45
PRK15494 339 era GTPase Era; Provisional 99.45
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.44
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.44
KOG0410410 consensus Predicted GTP binding protein [General f 99.44
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.44
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.44
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.44
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.44
PRK00049396 elongation factor Tu; Reviewed 99.44
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.43
PRK09866 741 hypothetical protein; Provisional 99.43
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.43
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 99.42
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 99.42
PLN03126478 Elongation factor Tu; Provisional 99.42
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.41
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.41
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.41
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.4
PRK00007 693 elongation factor G; Reviewed 99.39
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.39
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.39
PRK09602396 translation-associated GTPase; Reviewed 99.39
PTZ00141 446 elongation factor 1- alpha; Provisional 99.38
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.37
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.37
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.37
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.36
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.36
PRK12739 691 elongation factor G; Reviewed 99.36
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.36
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.36
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.34
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.34
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.33
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.33
PRK13351 687 elongation factor G; Reviewed 99.33
PRK11058 426 GTPase HflX; Provisional 99.33
PRK12298 390 obgE GTPase CgtA; Reviewed 99.32
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.31
COG2229187 Predicted GTPase [General function prediction only 99.31
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.31
KOG1423 379 consensus Ras-like GTPase ERA [Cell cycle control, 99.31
COG0218200 Predicted GTPase [General function prediction only 99.28
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.27
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.27
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.27
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.27
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.27
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.26
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.25
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 99.25
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.25
PLN00043 447 elongation factor 1-alpha; Provisional 99.25
cd04105203 SR_beta Signal recognition particle receptor, beta 99.24
cd01900 274 YchF YchF subfamily. YchF is a member of the Obg f 99.24
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.24
PRK09601 364 GTP-binding protein YchF; Reviewed 99.24
PTZ00258 390 GTP-binding protein; Provisional 99.24
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.23
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.22
PLN00023334 GTP-binding protein; Provisional 99.22
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.21
KOG0395196 consensus Ras-related GTPase [General function pre 99.21
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.21
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.21
PRK14845 1049 translation initiation factor IF-2; Provisional 99.2
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.2
PRK12299335 obgE GTPase CgtA; Reviewed 99.19
COG0488 530 Uup ATPase components of ABC transporters with dup 99.18
PRK12740 668 elongation factor G; Reviewed 99.18
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.17
COG1100219 GTPase SAR1 and related small G proteins [General 99.16
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.15
COG3596 296 Predicted GTPase [General function prediction only 99.15
COG0012372 Predicted GTPase, probable translation factor [Tra 99.14
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.14
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.14
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.14
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.13
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.12
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.12
PRK09601364 GTP-binding protein YchF; Reviewed 99.11
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.11
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.11
PTZ00258390 GTP-binding protein; Provisional 99.1
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.1
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.1
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.09
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.09
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.09
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.09
PRK12297 424 obgE GTPase CgtA; Reviewed 99.08
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.08
PRK13768253 GTPase; Provisional 99.08
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.07
PTZ00416 836 elongation factor 2; Provisional 99.07
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.07
PRK12296 500 obgE GTPase CgtA; Reviewed 99.07
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.07
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.07
COG1084346 Predicted GTPase [General function prediction only 99.06
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.05
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.05
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.05
COG2262 411 HflX GTPases [General function prediction only] 99.05
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.05
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.04
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.03
cd01896 233 DRG The developmentally regulated GTP-binding prot 99.02
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.01
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.01
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.01
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 99.01
KOG2486320 consensus Predicted GTPase [General function predi 99.0
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.0
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.0
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.98
PTZ00099176 rab6; Provisional 98.98
PRK04213201 GTP-binding protein; Provisional 98.98
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.97
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.97
PRK09435332 membrane ATPase/protein kinase; Provisional 98.96
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.96
PRK07560 731 elongation factor EF-2; Reviewed 98.96
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.95
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.95
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.95
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.95
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.94
CHL00071 409 tufA elongation factor Tu 98.93
PRK09602 396 translation-associated GTPase; Reviewed 98.92
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.9
cd00881189 GTP_translation_factor GTP translation factor fami 98.89
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.89
PRK12317 425 elongation factor 1-alpha; Reviewed 98.87
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.86
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.86
KOG0090238 consensus Signal recognition particle receptor, be 98.85
PLN03127 447 Elongation factor Tu; Provisional 98.85
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.85
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.84
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.84
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.84
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.83
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.83
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.83
KOG0458603 consensus Elongation factor 1 alpha [Translation, 98.83
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.82
KOG4252246 consensus GTP-binding protein [Signal transduction 98.82
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.82
COG1163 365 DRG Predicted GTPase [General function prediction 98.82
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.81
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.81
PRK12735 396 elongation factor Tu; Reviewed 98.8
PRK09866 741 hypothetical protein; Provisional 98.8
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.79
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.79
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.79
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.77
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.77
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.76
PRK00049 396 elongation factor Tu; Reviewed 98.76
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.75
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.75
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.74
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.74
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.74
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 98.74
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.74
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.74
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.73
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.73
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.73
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.73
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.73
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.72
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.72
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.72
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 98.71
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.71
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.71
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.71
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.7
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.7
PRK10938490 putative molybdenum transport ATP-binding protein 98.7
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 98.7
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.7
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.7
PRK00007 693 elongation factor G; Reviewed 98.69
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.69
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.69
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.68
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.68
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.68
PRK12736 394 elongation factor Tu; Reviewed 98.68
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 98.68
PRK12739 691 elongation factor G; Reviewed 98.68
TIGR00485 394 EF-Tu translation elongation factor TU. This align 98.67
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.67
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.67
COG0050394 TufB GTPases - translation elongation factors [Tra 98.66
KOG0410 410 consensus Predicted GTP binding protein [General f 98.66
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.66
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.66
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.66
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 98.65
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.65
CHL00189 742 infB translation initiation factor 2; Provisional 98.65
KOG1491391 consensus Predicted GTP-binding protein (ODN super 98.64
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.63
KOG0062 582 consensus ATPase component of ABC transporters wit 98.63
PRK05306 787 infB translation initiation factor IF-2; Validated 98.63
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.63
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.63
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.63
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.62
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.62
cd01851 224 GBP Guanylate-binding protein (GBP), N-terminal do 98.62
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.62
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.62
PLN03118211 Rab family protein; Provisional 98.62
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.62
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.61
KOG1143591 consensus Predicted translation elongation factor 98.61
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.6
PRK11147 635 ABC transporter ATPase component; Reviewed 98.6
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.59
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.59
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.59
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.58
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.58
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.57
PLN03126 478 Elongation factor Tu; Provisional 98.57
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.56
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.56
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.56
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.56
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.56
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 98.56
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.56
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.55
PRK09563287 rbgA GTPase YlqF; Reviewed 98.55
PLN03073 718 ABC transporter F family; Provisional 98.55
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.55
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.55
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.55
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.54
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.54
COG1161322 Predicted GTPases [General function prediction onl 98.54
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.54
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.53
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.53
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.53
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 98.53
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.53
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-46  Score=368.42  Aligned_cols=280  Identities=54%  Similarity=0.803  Sum_probs=243.8

Q ss_pred             CeEEEEcCCCCChhHHHHHHhCCcceeeecCCCceeeeeEEEEEeCCceeeEeeccccccccCCCchhhhhhhhhhhccc
Q 011492          164 PRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGM  243 (484)
Q Consensus       164 ~~V~l~G~~~~GKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~i~liDtpG~~~~~~~~~~~~~~~~~~~~~~~  243 (484)
                      +.|+|+|+||||||||+|+|+|+..+++.++||+|++..++...|.+..+.++||+|+.....  .              
T Consensus         4 ~~VAIVGRPNVGKSTLFNRL~g~r~AIV~D~pGvTRDr~y~~~~~~~~~f~lIDTgGl~~~~~--~--------------   67 (444)
T COG1160           4 PVVAIVGRPNVGKSTLFNRLTGRRIAIVSDTPGVTRDRIYGDAEWLGREFILIDTGGLDDGDE--D--------------   67 (444)
T ss_pred             CEEEEECCCCCcHHHHHHHHhCCeeeEeecCCCCccCCccceeEEcCceEEEEECCCCCcCCc--h--------------
Confidence            789999999999999999999999999999999999999999999999999999999975332  1              


Q ss_pred             CCCchhHHHHHHhhchHHHHHHHHHHhhhcCeEEEEeeCCCCCCcccHHHHHHHHhhcCCCeEEEEecccCCCchhhhhh
Q 011492          244 EGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQV  323 (484)
Q Consensus       244 ~G~~~~~~~~~v~~~~~~~~~~~~~~~~~~d~vilVvD~~~~~~~~~~~~~~~l~~~~~~~p~ilV~NK~Dl~~~~~~~~  323 (484)
                                   .+.+.+..++..++..+|+++||+|+..+.+..|..+.++|+..  ++|+++|+||+|.... ....
T Consensus        68 -------------~l~~~i~~Qa~~Ai~eADvilfvVD~~~Git~~D~~ia~~Lr~~--~kpviLvvNK~D~~~~-e~~~  131 (444)
T COG1160          68 -------------ELQELIREQALIAIEEADVILFVVDGREGITPADEEIAKILRRS--KKPVILVVNKIDNLKA-EELA  131 (444)
T ss_pred             -------------HHHHHHHHHHHHHHHhCCEEEEEEeCCCCCCHHHHHHHHHHHhc--CCCEEEEEEcccCchh-hhhH
Confidence                         13344567899999999999999999999999999999999964  7999999999998733 3345


Q ss_pred             HHHHhcCC-CceeeecccCCCCchhhHHHHHHhhhccCcchhhhhccCCCEEEEEcCCCCCchhHHHhhhcCcceeecCC
Q 011492          324 SEFWSLGF-SPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPI  402 (484)
Q Consensus       324 ~~~~~~~~-~~i~vSa~~g~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~i~lvG~~g~GKSTLiN~Llg~~~~~~~~~  402 (484)
                      .+++..|+ .++++||.+|.|+.+|++.+.+.++ ....... .......+|+++|+||+|||||+|+|+|..++.+++.
T Consensus       132 ~efyslG~g~~~~ISA~Hg~Gi~dLld~v~~~l~-~~e~~~~-~~~~~~ikiaiiGrPNvGKSsLiN~ilgeeR~Iv~~~  209 (444)
T COG1160         132 YEFYSLGFGEPVPISAEHGRGIGDLLDAVLELLP-PDEEEEE-EEETDPIKIAIIGRPNVGKSSLINAILGEERVIVSDI  209 (444)
T ss_pred             HHHHhcCCCCceEeehhhccCHHHHHHHHHhhcC-Ccccccc-cccCCceEEEEEeCCCCCchHHHHHhccCceEEecCC
Confidence            67888887 6899999999999999999999874 2211111 1112457999999999999999999999999999999


Q ss_pred             CCceecccceeeecCCCCcEEEEEcCCCccCccccCCCCchhHHHHHHHHHHhhcCcEEEEEEeCcccccHHhhhhhhh
Q 011492          403 SGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHR  481 (484)
Q Consensus       403 ~gtt~~~~~~~~~~~~g~~i~liDTPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~l~V~~~~~~~~~~d~~~~~~  481 (484)
                      +||||+.+...+. ++++.+.+|||.|++..+.+.   ...+.+.+.++.+++..+|++++|+|+..++++||++++..
T Consensus       210 aGTTRD~I~~~~e-~~~~~~~liDTAGiRrk~ki~---e~~E~~Sv~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~  284 (444)
T COG1160         210 AGTTRDSIDIEFE-RDGRKYVLIDTAGIRRKGKIT---ESVEKYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGL  284 (444)
T ss_pred             CCccccceeeeEE-ECCeEEEEEECCCCCcccccc---cceEEEeehhhHhHHhhcCEEEEEEECCCCchHHHHHHHHH
Confidence            9999999999987 689999999999999988765   45778889999999999999999999999999999999854

>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
4dcs_A 456 Crystal Structure Of B. Subtilis Enga In Complex Wi 3e-59
2hjg_A 436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 7e-58
1mky_A 439 Structural Analysis Of The Domain Interactions In D 2e-44
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 8e-22
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 1e-07
1xzp_A 482 Structure Of The Gtp-Binding Protein Trme From Ther 1e-15
3geh_A 462 Crystal Structure Of Mnme From Nostoc In Complex Wi 2e-12
3r9w_A307 Crystal Structure Of Era In Complex With Mggdpnp An 2e-12
3r9w_A 307 Crystal Structure Of Era In Complex With Mggdpnp An 2e-07
3iev_A308 Crystal Structure Of Era In Complex With Mggnp And 2e-12
3iev_A 308 Crystal Structure Of Era In Complex With Mggnp And 2e-07
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 7e-11
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 7e-11
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 2e-10
3gee_A 476 Crystal Structure Of Mnme From Chlorobium Tepidum I 5e-10
1x18_X292 Contact Sites Of Era Gtpase On The Thermus Thermoph 6e-08
1x18_X 292 Contact Sites Of Era Gtpase On The Thermus Thermoph 1e-04
1ega_A301 Crystal Structure Of A Widely Conserved Gtpase Era 7e-08
1ega_A 301 Crystal Structure Of A Widely Conserved Gtpase Era 1e-04
3pqc_A195 Crystal Structure Of Thermotoga Maritima Ribosome B 1e-06
1wf3_A301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 3e-06
1wf3_A 301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 8e-05
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 5e-06
3qq5_A 423 Crystal Structure Of The [fefe]-Hydrogenase Maturat 6e-06
2wjg_A188 Structure And Function Of The Feob G-Domain From Me 1e-05
2wjh_A166 Structure And Function Of The Feob G-Domain From Me 1e-05
2wji_A165 Structure And Function Of The Feob G-Domain From Me 1e-05
2wjj_A168 Structure And Function Of The Feob G-Domain From Me 1e-05
3iby_A256 Structure Of Cytosolic Domain Of L. Pneumophila Feo 2e-05
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 7e-05
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 8e-05
3hyr_A270 Structural Insight Into G Protein Coupling And Regu 2e-04
3i8s_A274 Structure Of The Cytosolic Domain Of E. Coli Feob, 2e-04
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 2e-04
3hyt_A270 Structural Basis Of Gdp Release And Gating In G Pro 2e-04
1puj_A282 Structure Of B. Subtilis Ylqf Gtpase Length = 282 2e-04
2wia_A267 Crystal Structures Of The N-Terminal Intracellular 4e-04
3a1s_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 5e-04
3cnl_A262 Crystal Structure Of Gnp-Bound Ylqf From T. Maritim 9e-04
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure 
Iteration: 1

 Score =  226 bits (575), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 191/312 (61%), Gaps = 42/312 (13%)
Query: 164 PRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLN 223
           P VAIVGRPNVGKS +FNR+ G   +IV D PGVTRDR+Y  + W  ++F L+DTGG+  
Sbjct: 24  PVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGGI-- 81
Query: 224 VSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQ 283
                            IG E  P   +          I +QA  A++E+ VIIF+V+G+
Sbjct: 82  ----------------DIGDE--PFLAQ----------IRQQAEIAMDEADVIIFMVNGR 113
Query: 284 AGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVSEFWSLGF-SPLPISAISGT 342
            G+TAADEE+A  L +    K ++LAVNK ++       + +F+SLGF  P PIS   G 
Sbjct: 114 EGVTAADEEVAKILYRT--KKPVVLAVNKLDNTEMR-ANIYDFYSLGFGEPYPISGTHGL 170
Query: 343 GTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPI 402
           G G+LLD V    K +  T+    EE  +    ++GRPNVGKSS++NA++GE+R IVS +
Sbjct: 171 GLGDLLDAVAEHFKNIPETK--YNEE--VIQFCLIGRPNVGKSSLVNAMLGEERVIVSNV 226
Query: 403 SGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVA 462
           +GTTRDA+DT FT  + Q+F ++DTAG+RK+  +     TTE  SV RA +AI RS+VVA
Sbjct: 227 AGTTRDAVDTSFTYNQ-QEFVIVDTAGMRKKGKVY---ETTEKYSVLRALKAIDRSEVVA 282
Query: 463 LVIEAMACITEQ 474
           +V++    I EQ
Sbjct: 283 VVLDGEEGIIEQ 294
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|3PQC|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Biogenesis Gtp- Binding Protein Engb (YsxcYIHA) IN COMPLEX WITH GDP Length = 195 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 Back     alignment and structure
>pdb|2WJG|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 188 Back     alignment and structure
>pdb|2WJH|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 166 Back     alignment and structure
>pdb|2WJI|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 165 Back     alignment and structure
>pdb|2WJJ|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 168 Back     alignment and structure
>pdb|3IBY|A Chain A, Structure Of Cytosolic Domain Of L. Pneumophila Feob Length = 256 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure
>pdb|3HYR|A Chain A, Structural Insight Into G Protein Coupling And Regulation Of Fe2+ Membrane Transport Length = 270 Back     alignment and structure
>pdb|3I8S|A Chain A, Structure Of The Cytosolic Domain Of E. Coli Feob, Nucleotide-Free Form Length = 274 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3HYT|A Chain A, Structural Basis Of Gdp Release And Gating In G Protein Coupled Fe2+ Transport Length = 270 Back     alignment and structure
>pdb|1PUJ|A Chain A, Structure Of B. Subtilis Ylqf Gtpase Length = 282 Back     alignment and structure
>pdb|2WIA|A Chain A, Crystal Structures Of The N-Terminal Intracellular Domain Of Feob From Klebsiella Pneumoniae In Apo Form Length = 267 Back     alignment and structure
>pdb|3A1S|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form I Length = 258 Back     alignment and structure
>pdb|3CNL|A Chain A, Crystal Structure Of Gnp-Bound Ylqf From T. Maritima Length = 262 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 1e-139
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 6e-26
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 1e-134
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 5e-26
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 1e-71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 5e-18
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 5e-47
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 4e-15
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 2e-31
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 7e-24
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-27
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-20
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-26
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 3e-22
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 2e-26
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 2e-21
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-26
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 1e-21
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 1e-24
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 1e-16
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 9e-22
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 5e-16
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 1e-20
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 3e-16
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-20
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-16
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 7e-20
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 1e-13
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 2e-19
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 4e-07
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 6e-15
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 2e-14
3cnl_A262 YLQF, putative uncharacterized protein; circular p 4e-14
3cnl_A262 YLQF, putative uncharacterized protein; circular p 2e-07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 1e-13
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 3e-07
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 3e-13
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 9e-13
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 1e-10
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 4e-10
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 1e-04
2wji_A165 Ferrous iron transport protein B homolog; membrane 1e-09
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-04
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 2e-09
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 2e-04
3iby_A256 Ferrous iron transport protein B; G protein, G dom 1e-08
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 3e-04
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 1e-08
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 7e-05
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 1e-08
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 3e-04
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 1e-08
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 7e-04
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 2e-08
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 1e-04
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 9e-08
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 1e-07
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 5e-05
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 2e-07
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 1e-04
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 6e-07
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 1e-06
3lxx_A239 GTPase IMAP family member 4; structural genomics c 1e-06
3lxx_A239 GTPase IMAP family member 4; structural genomics c 2e-06
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 1e-06
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 2e-06
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 3e-06
3lxw_A247 GTPase IMAP family member 1; immunity, structural 5e-05
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 8e-06
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 2e-05
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 1e-05
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 6e-05
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 2e-04
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 2e-04
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
 Score =  406 bits (1045), Expect = e-139
 Identities = 111/314 (35%), Positives = 167/314 (53%), Gaps = 36/314 (11%)

Query: 163 LPRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVL 222
           +  V IVGRPNVGKS LFN+LV   +AIV DE GVTRD +     W    F LVDT GV 
Sbjct: 1   MATVLIVGRPNVGKSTLFNKLVKKKKAIVEDEEGVTRDPVQDTVEWYGKTFKLVDTCGVF 60

Query: 223 NVSKSQPNIMEDLAITTTIGMEGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDG 282
           +  +                               +   ++      I E+ +++F+VDG
Sbjct: 61  DNPQDI-----------------------------ISQKMKEVTLNMIREADLVLFVVDG 91

Query: 283 QAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQ-VSEFWSLGFS-PLPISAIS 340
           + G+T  DE +AD+LRK+      IL  NK E+ R+   +   E +SLGF  P+P+SA  
Sbjct: 92  KRGITKEDESLADFLRKS--TVDTILVANKAENLREFEREVKPELYSLGFGEPIPVSAEH 149

Query: 341 GTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVS 400
                 +L+ +  +L++     +   E      +AIVGRPNVGKS++ NA++ ++R +VS
Sbjct: 150 NINLDTMLETIIKKLEEKGLDLESKPEITDAIKVAIVGRPNVGKSTLFNAILNKERALVS 209

Query: 401 PISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDV 460
           PI GTTRD +D E    +G+K+  +DTAG+R+++ +       E  S  R   +I ++DV
Sbjct: 210 PIPGTTRDPVDDEVF-IDGRKYVFVDTAGLRRKSRVEPRT--VEKYSNYRVVDSIEKADV 266

Query: 461 VALVIEAMACITEQ 474
           V +V++A   IT Q
Sbjct: 267 VVIVLDATQGITRQ 280
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Length = 695 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 100.0
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 100.0
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 100.0
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.87
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.84
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.81
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.8
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.8
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.8
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.8
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.79
3cnl_A262 YLQF, putative uncharacterized protein; circular p 99.78
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.78
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.77
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.77
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.77
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.77
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.77
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.77
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.77
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.77
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.77
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.76
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.76
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.76
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.76
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.76
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.76
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.76
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.75
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.74
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.74
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.73
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.73
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.73
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.73
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.73
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.73
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.73
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.73
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.73
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.72
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.72
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.72
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.72
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.72
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.72
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.72
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.72
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.72
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.72
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.72
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.72
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.72
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.72
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.72
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.72
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.71
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.71
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.71
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.71
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.71
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.71
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.71
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.71
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.71
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.71
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.71
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.7
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.7
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.7
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.7
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.7
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.7
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.7
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.7
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.7
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.7
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.7
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.7
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.7
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.7
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.7
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.7
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.7
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.7
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.7
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.69
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.69
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.69
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.69
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.69
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.69
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.69
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.69
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.69
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.69
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.69
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.68
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.68
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.68
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.68
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.68
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.68
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.68
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.68
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.68
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.68
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.68
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.68
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.68
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.68
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.68
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.68
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.67
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.67
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.67
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.67
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.67
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.67
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.67
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.67
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.67
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.66
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.66
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.66
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.66
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.66
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.65
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.65
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.65
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.65
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.65
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.65
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.65
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.65
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.65
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.65
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.64
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.64
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.64
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.64
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.44
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.64
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.64
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.63
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.63
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.63
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.62
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.62
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.62
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.62
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.6
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.6
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.59
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.59
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.58
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.58
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.58
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.57
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.57
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.57
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.57
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.56
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.55
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.55
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.55
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.54
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.53
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.53
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.53
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.52
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.5
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.5
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.49
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.49
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.49
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.48
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.48
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.47
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.47
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 99.47
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.46
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.46
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.46
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.46
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.46
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.45
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.45
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.45
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.45
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.44
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.42
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.42
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.4
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.4
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 99.39
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.39
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 99.39
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 99.39
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.38
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 99.38
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.37
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 99.37
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.36
2ged_A193 SR-beta, signal recognition particle receptor beta 99.35
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.35
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.31
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.3
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.29
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.28
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.26
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.26
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.26
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 99.25
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.25
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 99.24
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.24
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.23
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.23
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.22
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.22
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.2
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.19
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.18
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.16
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.15
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.15
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.13
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.12
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.12
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.11
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.11
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.11
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.08
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.06
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 99.06
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.06
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.05
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.02
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.0
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.97
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.97
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.97
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.97
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.96
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.96
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.96
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.95
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.94
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.94
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.93
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.93
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.93
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.9
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.89
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.89
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.89
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.87
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.87
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.85
2ged_A193 SR-beta, signal recognition particle receptor beta 98.85
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.85
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.85
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.84
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.83
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.83
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.82
2fh5_B 214 SR-beta, signal recognition particle receptor beta 98.82
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.82
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.81
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.81
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.8
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.78
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.78
1nrj_B 218 SR-beta, signal recognition particle receptor beta 98.77
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.77
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.77
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.77
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.75
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.75
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.75
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.75
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.75
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.75
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.74
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.74
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.74
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.74
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.74
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.74
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.73
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.72
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.72
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.72
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.71
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.71
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.71
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.69
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.69
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.69
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.69
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 98.69
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.68
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.68
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.68
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.67
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.67
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.67
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.67
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.67
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.66
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.66
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.66
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.66
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.65
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.65
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.65
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.65
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.65
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.64
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.64
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.64
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.64
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.64
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.64
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.64
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.63
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.63
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.62
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.62
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.62
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.62
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.61
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.6
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.6
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.6
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.59
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.59
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.59
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.59
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.59
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.58
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.58
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.58
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.58
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.58
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.58
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.57
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.57
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.57
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.57
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.56
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.56
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.56
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.56
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.56
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.55
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.55
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.54
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.54
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.53
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.52
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 98.52
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.52
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.52
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.51
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.5
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.5
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.5
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.5
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.5
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.49
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.49
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 98.48
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.48
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.48
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.48
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.47
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.47
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.46
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.46
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.46
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.45
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.45
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.45
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.45
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 98.44
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.44
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.44
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.43
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.43
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.43
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.42
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.42
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.42
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.41
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.41
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.39
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.39
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.39
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.39
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.36
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.36
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.36
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.35
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.35
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.35
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.35
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.33
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.68
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.32
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.32
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 98.29
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.28
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.28
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.28
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.27
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.25
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.23
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.22
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 98.19
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.19
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.18
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.13
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.07
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.06
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 98.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.0
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 97.99
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.98
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.97
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 97.97
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.95
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.93
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 97.93
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.93
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 97.93
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 97.88
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.87
1g6h_A257 High-affinity branched-chain amino acid transport 97.86
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 97.86
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.85
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.84
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.81
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.81
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 97.81
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 97.81
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.8
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.78
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.77
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.76
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 97.74
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 97.73
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.72
2ghi_A260 Transport protein; multidrug resistance protein, M 97.69
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.69
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.68
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 97.67
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.65
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.64
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.62
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.59
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.58
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.56
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.51
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.51
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.51
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.51
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.51
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.5
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.49
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.47
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.46
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.46
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.44
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.42
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.4
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.39
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.38
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.38
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.35
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.35
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.35
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.34
2xxa_A 433 Signal recognition particle protein; protein trans 97.33
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.32
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.32
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.25
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 97.25
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.25
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 97.24
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.23
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.16
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.16
2xxa_A433 Signal recognition particle protein; protein trans 97.15
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.15
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 97.12
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.06
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
Probab=100.00  E-value=4.7e-37  Score=316.18  Aligned_cols=284  Identities=40%  Similarity=0.617  Sum_probs=198.2

Q ss_pred             CeEEEEcCCCCChhHHHHHHhCCcceeeecCCCceeeeeEEEEEeCCceeeEeeccccccccCCCchhhhhhhhhhhccc
Q 011492          164 PRVAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLVDTGGVLNVSKSQPNIMEDLAITTTIGM  243 (484)
Q Consensus       164 ~~V~l~G~~~~GKSsl~n~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~i~liDtpG~~~~~~~~~~~~~~~~~~~~~~~  243 (484)
                      ++|+|+|.+|||||||+|+|++...+.+.+.+++|++...+.+.+.+..+.+|||||+.....  ..             
T Consensus         2 ~~v~ivG~pnvGKStL~nrl~~~~~~~v~~~~g~T~d~~~~~~~~~~~~~~l~DT~G~~~~~~--~~-------------   66 (439)
T 1mky_A            2 ATVLIVGRPNVGKSTLFNKLVKKKKAIVEDEEGVTRDPVQDTVEWYGKTFKLVDTCGVFDNPQ--DI-------------   66 (439)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHC--------------CCSEEEEEETTEEEEEEECTTTTSSGG--GC-------------
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCCceecCCCCCccceeeEEEEECCeEEEEEECCCcccccc--ch-------------
Confidence            689999999999999999999987777889999999999999999999999999999864211  00             


Q ss_pred             CCCchhHHHHHHhhchHHHHHHHHHHhhhcCeEEEEeeCCCCCCcccHHHHHHHHhhcCCCeEEEEecccCCCchhhhhh
Q 011492          244 EGIPLATREAAVARMPSMIERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQV  323 (484)
Q Consensus       244 ~G~~~~~~~~~v~~~~~~~~~~~~~~~~~~d~vilVvD~~~~~~~~~~~~~~~l~~~~~~~p~ilV~NK~Dl~~~~~~~~  323 (484)
                                    +...+..++..++..+|++++|+|++.+.+..+..+..++...  ++|+++|+||+|+........
T Consensus        67 --------------~~~~~~~~~~~~~~~ad~il~V~D~~~~~~~~d~~i~~~l~~~--~~p~ilv~NK~D~~~~~~~~~  130 (439)
T 1mky_A           67 --------------ISQKMKEVTLNMIREADLVLFVVDGKRGITKEDESLADFLRKS--TVDTILVANKAENLREFEREV  130 (439)
T ss_dssp             --------------CCHHHHHHHHHHHTTCSEEEEEEETTTCCCHHHHHHHHHHHHH--TCCEEEEEESCCSHHHHHHHT
T ss_pred             --------------HHHHHHHHHHHHHHhCCEEEEEEECCCCCCHHHHHHHHHHHHc--CCCEEEEEeCCCCccccHHHH
Confidence                          1122345677888999999999999988888887888888765  899999999999865411222


Q ss_pred             -HHHHhcCC-CceeeecccCCCCchhhHHHHHHhhhccCcchhhhhccCCCEEEEEcCCCCCchhHHHhhhcCcceeecC
Q 011492          324 -SEFWSLGF-SPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSP  401 (484)
Q Consensus       324 -~~~~~~~~-~~i~vSa~~g~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~i~lvG~~g~GKSTLiN~Llg~~~~~~~~  401 (484)
                       ..++..++ +++++||++|.|+.+|++.+.+.+.+...............+|+++|.||||||||+|+|+|.....+++
T Consensus       131 ~~~~~~lg~~~~~~iSA~~g~gv~~L~~~i~~~l~~~~~~~~~~~~~~~~~kvaivG~~gvGKSTLln~l~g~~~~~v~~  210 (439)
T 1mky_A          131 KPELYSLGFGEPIPVSAEHNINLDTMLETIIKKLEEKGLDLESKPEITDAIKVAIVGRPNVGKSTLFNAILNKERALVSP  210 (439)
T ss_dssp             HHHHGGGSSCSCEECBTTTTBSHHHHHHHHHHHHHHTTCCSSSCCCCCSCEEEEEECSTTSSHHHHHHHHHTSTTEEECC
T ss_pred             HHHHHhcCCCCEEEEeccCCCCHHHHHHHHHHhcccccccchhccccccCceEEEECCCCCCHHHHHHHHhCCcccccCC
Confidence             34555666 7899999999999999999988876432110000011234699999999999999999999998888999


Q ss_pred             CCCceecccceeeecCCCCcEEEEEcCCCccCccccCCCCchhHHHHHHHHHHhhcCcEEEEEEeCcccccHHhhhhhhh
Q 011492          402 ISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRAFRAIRRSDVVALVIEAMACITEQADWRDHR  481 (484)
Q Consensus       402 ~~gtt~~~~~~~~~~~~g~~i~liDTPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~l~V~~~~~~~~~~d~~~~~~  481 (484)
                      .+|+|++.....+. .+|..+.+|||||++.......  ...+.+....+...++.+|++++|+|+..+++.++.++.+.
T Consensus       211 ~~gtT~d~~~~~i~-~~g~~~~l~Dt~G~~~~~~~~~--~~~e~~~~~~~~~~i~~ad~vllv~d~~~~~~~~~~~i~~~  287 (439)
T 1mky_A          211 IPGTTRDPVDDEVF-IDGRKYVFVDTAGLRRKSRVEP--RTVEKYSNYRVVDSIEKADVVVIVLDATQGITRQDQRMAGL  287 (439)
T ss_dssp             CC------CCEEEE-ETTEEEEESSCSCC-------------CCSCCHHHHHHHHHCSEEEEEEETTTCCCHHHHHHHHH
T ss_pred             CCCCcCCceEEEEE-ECCEEEEEEECCCCccccccch--hhHHHHHHHHHHHHHhhCCEEEEEEeCCCCCCHHHHHHHHH
Confidence            99999998877665 4678899999999965432110  01122223345567889999999999999999888776543
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 484
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 4e-25
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 3e-09
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 3e-22
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 9e-19
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 1e-19
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 1e-13
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 3e-19
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 5e-10
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 4e-18
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 6e-16
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 6e-18
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 8e-12
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 8e-18
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 8e-17
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 2e-17
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 5e-11
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 5e-17
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 3e-11
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 3e-15
d1h65a_ 257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 6e-12
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 6e-15
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 3e-11
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 1e-14
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-08
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 1e-14
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 7e-09
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 2e-12
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 3e-12
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 5e-12
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 8e-11
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 2e-06
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-09
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-06
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 5e-09
d1g7sa4 227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 3e-04
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-08
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-05
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-08
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 4e-08
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-08
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 0.001
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 4e-08
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 0.004
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 1e-07
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 5e-06
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-07
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 3e-05
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-07
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-04
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 5e-07
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 0.001
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 6e-07
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-04
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 7e-07
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-06
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-05
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 8e-06
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 8e-04
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 8e-06
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 3e-04
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 1e-05
d1ni3a1 296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-04
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-05
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 3e-04
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 1e-05
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 4e-04
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 1e-05
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 0.002
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-05
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 6e-05
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 2e-05
d1wxqa1 319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 2e-04
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 2e-05
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 3e-05
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 9e-04
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 3e-05
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 9e-05
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 5e-05
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 4e-04
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 5e-05
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 0.002
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 6e-05
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 1e-04
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-04
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 1e-04
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 3e-04
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 3e-04
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 4e-04
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 5e-04
d1jala1 278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 5e-04
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 0.001
d1jwyb_ 306 c.37.1.8 (B:) Dynamin G domain {Dictyostelium disc 6e-04
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 8e-04
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 8e-04
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 8e-04
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 0.001
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 0.001
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 0.001
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 0.003
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 0.001
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 0.001
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 0.002
d2akab1 299 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus n 0.003
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 0.003
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 0.003
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

 Score =  102 bits (254), Expect = 4e-25
 Identities = 39/171 (22%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 263 ERQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQ 322
            R+ T  ++   ++  LVD +  +++ +  I D L+     K  I+ +NK +     + Q
Sbjct: 6   RREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKN----KPRIMLLNKADKADAAVTQ 61

Query: 323 --VSEFWSLGFSPLPISAISGTGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRP 380
                F + G   L I++++G G  +++      L++          + R     I+G P
Sbjct: 62  QWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIP 121

Query: 381 NVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIR 431
           NVGKS+++N L  ++        G T      +     G++  L+DT GI 
Sbjct: 122 NVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKV----GKELELLDTPGIL 168
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Length = 306 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.88
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.85
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.83
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.83
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.82
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.82
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.81
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.81
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.81
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.8
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.78
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.76
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.71
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.7
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.7
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.7
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.69
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.68
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.68
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.68
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.67
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.67
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.66
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.65
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.65
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.64
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.64
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.63
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.62
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.62
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.62
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.62
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.61
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.61
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.61
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.6
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.6
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.6
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.59
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 99.56
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.56
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.55
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.54
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.53
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.53
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.53
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.53
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.5
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.48
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.42
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.41
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.4
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.37
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.35
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.34
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.34
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.31
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.25
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.24
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.24
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.23
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.22
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.21
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.21
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.2
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.19
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.14
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.13
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.12
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.08
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.04
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 99.04
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.03
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.02
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.01
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.97
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.94
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 98.92
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.86
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 98.84
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.8
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.77
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.77
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.76
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.75
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.75
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.73
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.68
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 98.68
d2fh5b1 207 Signal recognition particle receptor beta-subunit 98.63
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.62
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.62
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 98.61
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.61
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.58
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.56
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.54
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.52
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.51
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.5
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.49
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.48
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.47
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.44
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.44
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.43
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.39
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.39
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.38
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.33
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.31
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.3
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.29
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.28
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.28
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 98.27
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.26
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.25
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.25
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.24
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.24
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.23
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.23
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.22
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.21
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.19
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.19
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.18
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.18
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.17
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.17
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.13
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.12
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.12
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.06
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.04
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.04
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.03
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.99
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.96
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.86
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.8
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.79
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.79
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.78
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.78
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.69
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.68
d2qy9a2211 GTPase domain of the signal recognition particle r 97.68
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.67
d1vmaa2213 GTPase domain of the signal recognition particle r 97.66
d1okkd2207 GTPase domain of the signal recognition particle r 97.66
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.61
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.6
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.59
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.59
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.56
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.48
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 97.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.33
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.31
d2qy9a2211 GTPase domain of the signal recognition particle r 97.25
d1vmaa2213 GTPase domain of the signal recognition particle r 97.23
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.23
d1okkd2207 GTPase domain of the signal recognition particle r 97.2
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.15
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 97.1
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.1
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.98
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.86
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.84
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.77
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.75
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.72
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.69
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.67
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.66
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.66
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.65
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.63
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.63
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.63
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.57
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.56
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.56
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.47
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.43
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.43
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.42
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.37
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.36
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.36
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.23
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.23
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.13
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.03
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.03
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.03
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.86
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.86
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.83
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.75
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.71
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.64
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.53
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.47
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.4
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.39
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.2
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.16
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.12
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.1
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.94
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.93
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.9
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.86
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.84
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.82
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.8
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.79
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.69
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.67
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.64
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.58
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.54
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.53
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.53
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.51
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.51
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.47
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.39
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.28
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.16
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.16
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.15
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.12
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.12
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.1
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.07
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.07
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.04
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.03
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.0
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.84
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.82
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.54
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.52
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.49
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.47
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.45
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.42
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.33
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.31
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.31
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.29
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.23
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.18
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.08
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.05
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.05
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.04
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.97
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.95
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.95
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.91
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.88
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.84
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.84
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.82
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.58
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.55
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.49
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.36
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.33
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.22
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.13
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.09
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.95
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.94
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.94
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.87
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 91.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.78
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.75
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 91.72
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.54
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 91.53
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.46
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.34
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.3
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.19
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.1
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.02
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 90.99
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.77
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.77
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.76
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.67
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.65
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.64
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.55
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 90.28
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.08
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.08
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.97
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.96
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.86
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.53
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 89.41
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.32
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.26
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.26
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.13
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.06
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.01
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.84
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 88.83
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.74
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.67
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.63
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.46
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 88.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.23
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.09
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.0
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.95
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.93
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 87.85
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 87.81
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 87.71
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.63
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 87.46
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.43
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 87.38
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.04
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.98
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.68
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 86.21
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.07
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.99
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 85.77
d1svma_362 Papillomavirus large T antigen helicase domain {Si 85.64
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.4
d1svma_362 Papillomavirus large T antigen helicase domain {Si 85.25
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.1
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 85.07
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 84.85
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 84.77
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.73
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.66
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 84.46
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 84.4
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.23
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.15
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 84.08
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.08
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.04
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 83.99
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 83.51
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.31
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 83.3
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 83.28
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.18
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.45
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 82.1
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 81.47
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 81.44
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.4
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 81.37
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 81.26
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 81.13
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 80.94
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 80.55
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

Probab=99.90  E-value=1.3e-23  Score=199.82  Aligned_cols=164  Identities=24%  Similarity=0.328  Sum_probs=119.6

Q ss_pred             HHHHHHhhhcCeEEEEeeCCCCCCcccHHHHHHHHhhcCCCeEEEEecccCCCchhhhhhH-H-HHhcCCCceeeecccC
Q 011492          264 RQATAAIEESCVIIFLVDGQAGLTAADEEIADWLRKNYMDKFIILAVNKCESPRKGIMQVS-E-FWSLGFSPLPISAISG  341 (484)
Q Consensus       264 ~~~~~~~~~~d~vilVvD~~~~~~~~~~~~~~~l~~~~~~~p~ilV~NK~Dl~~~~~~~~~-~-~~~~~~~~i~vSa~~g  341 (484)
                      +++...+..+|++|+|+|++.|.+..+..+.+++.    ++|.++|+||+|+.+......+ . +...+..++.+|+.++
T Consensus         7 r~i~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~~----~Kp~IlVlNK~DLv~~~~~~~w~~~f~~~~~~~i~isa~~~   82 (273)
T d1puja_           7 REVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK----NKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNG   82 (273)
T ss_dssp             HHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHCS----SSCEEEEEECGGGSCHHHHHHHHHHHHTTTCCEEECCTTTC
T ss_pred             HHHHHHHHhCCEEEEEEECCCCCCCCCHHHHHHHc----CCCeEEEEECccCCchHHHHHHHHHHHhcCCccceeecccC
Confidence            55667899999999999999999999988776653    7899999999999986654432 2 3345668899999999


Q ss_pred             CCCchhhHHHHHHhhhccCcchhhhhccCCCEEEEEcCCCCCchhHHHhhhcCcceeecCCCCceecccceeeecCCCCc
Q 011492          342 TGTGELLDLVCSELKKVEGTEDLVEEENRIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAIDTEFTGPEGQK  421 (484)
Q Consensus       342 ~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~i~lvG~~g~GKSTLiN~Llg~~~~~~~~~~gtt~~~~~~~~~~~~g~~  421 (484)
                      .|...+...+.+.+.................+|+++|.||||||||+|+|+|++++.|++.||+|++.+...    .+..
T Consensus        83 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~vvG~PNvGKSsliN~L~~~~~~~~~~~pG~Tr~~~~i~----~~~~  158 (273)
T d1puja_          83 QGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVK----VGKE  158 (273)
T ss_dssp             TTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHHHHHHHHTSCCC------------CCEE----ETTT
T ss_pred             CCccccchhhhhhhhhhhhhhhhccCCCCceEEEEEecCccchhhhhhhhhccceEEECCcccccccceEEE----CCCC
Confidence            999999888777665433222222233455689999999999999999999999999999999999987644    3568


Q ss_pred             EEEEEcCCCccCcc
Q 011492          422 FRLIDTAGIRKRAA  435 (484)
Q Consensus       422 i~liDTPG~~~~~~  435 (484)
                      +.++||||+..+..
T Consensus       159 ~~l~DTPGi~~p~~  172 (273)
T d1puja_         159 LELLDTPGILWPKF  172 (273)
T ss_dssp             EEEEECCCCCCSCC
T ss_pred             eEEecCCCccccCC
Confidence            99999999987643
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure