Citrus Sinensis ID: 011535

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480---
MYKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVAT
ccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEcEEEcccccHHHHHHcccEEEEccccccccccccccccccccEEccccccHHHccccccccccccccccEEEEEccccHHHHHHHHccccccccccccccHHHHHHHHccccEEEEEEEEcccHHHcccHHHHHHHHcccccEEEEcccccccccccHHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccEEEccccccccEEEEEEEEEEEcccccccEEEcccccEEEEEccEEEEEccccccccccccccccccccccccccEEcccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHcc
cHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccHHHHccccccccHHHHHHHHHHHHccccEEEEEcccEcccEcHHHHHHHccEEEEcccccEEccccccccccccEEEHHHHHHHHHccHHHccccccccccEEEEEEcccHHHHHHHHHHHccHHHHccccccHHHHHHHHHccccEEEEEccccHHHccccHHHHHHHHcccccEEEEcHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccEEEccccccccEEEEEEEEEEEEccccccEEEEEEEEEEEEEEcccEEEcccEEcccccccccccccccEcccccEEEEccccccccccccEEEccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHc
MYKARAWLSRSFtalssnplrvcvvgsgpagfyTAEKTLKAHQEAQVDIidrlptpfglvrsgvapdhpetkIVINQFSRVVQHERcsffgnvtlgssvslseLRQLYHVVVLAYgaesdralgipgedligvhsAREFVWwynghpdgknlspdlkstdTAVILGQGNVALDVARIllrpteelattDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYvhireddliksptdeeemkNSRIQRRVYELLSKAAasassqpmlgqreLHFVffrkpdsflesnersghvsgvhfektalkgggpgkqyavgtgefedldcgmvlksigyksvpvnglpfdnhkgivpnirgrvlknisgdssqvenglyvcgwlkrgptgiiatnlycaEETVASISEDLEQGvlasssglpkpgregllqlldnrnvrpvpfsaweKIDSEEKRlgslrnkpkeklTTYEDLLKVAT
mykarawlsrsftalssnplrVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELReilgiknlyvhireddliksptdeeemknSRIQRRVYELLSKAAAsassqpmlgQRELHFVFFRKPDSFLESNERSGHVSGVHFektalkgggpgKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLqlldnrnvrpvpfsawekidseekrlgslrnkpkeklttyedllkvat
MYKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLskaaasassQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVAT
*****AWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDG******LKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDL***************************************ELHFVFFRK****************VHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASIS************************LL*******V*F***********************************
*********************VCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEE*****RIQRRVYELLS****************LHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASS*****P*REGLLQLLDNRNVRPVPFSAWEKIDS**************KLTTYEDLLKVA*
********SRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSP*********RIQRRVYELLSK********PMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVAT
MYKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSL*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVAT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query483 2.2.26 [Sep-21-2011]
P82861498 NADPH:adrenodoxin oxidore N/A no 0.939 0.911 0.484 1e-119
Q61578494 NADPH:adrenodoxin oxidore yes no 0.937 0.917 0.459 1e-107
P22570491 NADPH:adrenodoxin oxidore yes no 0.933 0.918 0.472 1e-106
P08165492 NADPH:adrenodoxin oxidore yes no 0.937 0.920 0.453 1e-105
P56522494 NADPH:adrenodoxin oxidore yes no 0.935 0.914 0.452 1e-105
Q9V3T9466 NADPH:adrenodoxin oxidore yes no 0.896 0.929 0.427 7e-96
O05783456 NADPH-ferredoxin reductas yes no 0.917 0.971 0.392 4e-83
O32886456 NADPH-ferredoxin reductas yes no 0.910 0.964 0.387 1e-78
P65528575 Probable ferredoxin/ferre no no 0.892 0.749 0.381 2e-76
P65529575 Probable ferredoxin/ferre no no 0.892 0.749 0.381 2e-76
>sp|P82861|ADRO_SALFO NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Salvelinus fontinalis GN=fdxr PE=2 SV=1 Back     alignment and function desciption
 Score =  429 bits (1104), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 232/479 (48%), Positives = 312/479 (65%), Gaps = 25/479 (5%)

Query: 11  SFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPE 70
           S +  +S+P +VC+VG GPAGFYTA+  +K   + QVDI +RLP PFGLVR GVAPDHPE
Sbjct: 36  STSTPASSP-KVCIVGGGPAGFYTAQHLVKTRTDVQVDIYERLPVPFGLVRFGVAPDHPE 94

Query: 71  TKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDL 130
            K VIN F++  +H RCSF GNV +G  V++ EL++ YH VVL+YGAE +R +G+PGEDL
Sbjct: 95  VKNVINTFTQTARHARCSFHGNVRVGKDVTVEELQEAYHAVVLSYGAEGNRTMGVPGEDL 154

Query: 131 IGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDI 190
            GV+SA++FV WYNG P  + L PDL S +TAVILGQGNVALDVAR+LL P + L  TDI
Sbjct: 155 AGVYSAKDFVGWYNGLPRNRELRPDL-SCETAVILGQGNVALDVARMLLSPVDILKKTDI 213

Query: 191 ASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEE 250
             +A  AL  SS+R+V +VGRRGP+Q ACT KELRE++ +      +   +        E
Sbjct: 214 TQHALDALAESSVRRVLIVGRRGPLQVACTIKELREMVNLPGTRPEMEASEF---EGIAE 270

Query: 251 EMKN-SRIQRRVYELLSKAAASASSQPML-----GQRELHFVFFRKPDSFLESNERSGHV 304
            +K+ +R ++R+ ELL KAA     +  L      +R   F F R+P   L S +     
Sbjct: 271 TLKSLARPRKRLTELLLKAAIETPGEEELEKRNKAERAWGFRFLRRPLEVLPSTDLI-RA 329

Query: 305 SGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVN-GLPFDNHKGIVPN 363
           +G+      L+G G G + AV TGE ED++CG+V+ SIGYKS+P++  +PFD  K I+PN
Sbjct: 330 AGIRLAVNRLEGDGEGVR-AVATGEVEDVECGLVISSIGYKSLPIDPAVPFDGRKAIIPN 388

Query: 364 IRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASS 423
             GRV         Q   GLY  GW+KRGPTG+IAT +  + +T  ++ +D+ +G L  S
Sbjct: 389 TMGRV---------QQTAGLYCSGWVKRGPTGVIATTMNDSFDTARTLLQDIGKGTLDVS 439

Query: 424 SGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVA 482
           S   KPG +G+  LL+ R V+PV FS WEKIDSEE R G  R KP+EK+    ++L+VA
Sbjct: 440 S--VKPGSQGVSALLEKRGVKPVSFSDWEKIDSEETRRGETRGKPREKMLDVGEMLQVA 496

Salvelinus fontinalis (taxid: 8038)
EC: 1EC: .EC: 1EC: 8EC: .EC: 1EC: .EC: 2
>sp|Q61578|ADRO_MOUSE NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Mus musculus GN=Fdxr PE=2 SV=1 Back     alignment and function description
>sp|P22570|ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens GN=FDXR PE=1 SV=3 Back     alignment and function description
>sp|P08165|ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus GN=FDXR PE=1 SV=3 Back     alignment and function description
>sp|P56522|ADRO_RAT NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Rattus norvegicus GN=Fdxr PE=1 SV=1 Back     alignment and function description
>sp|Q9V3T9|ADRO_DROME NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Drosophila melanogaster GN=dare PE=2 SV=1 Back     alignment and function description
>sp|O05783|FPRA_MYCTU NADPH-ferredoxin reductase FprA OS=Mycobacterium tuberculosis GN=fprA PE=1 SV=1 Back     alignment and function description
>sp|O32886|FPRA_MYCLE NADPH-ferredoxin reductase FprA OS=Mycobacterium leprae (strain TN) GN=fprA PE=3 SV=1 Back     alignment and function description
>sp|P65528|FPRB_MYCTU Probable ferredoxin/ferredoxin--NADP reductase OS=Mycobacterium tuberculosis GN=fprB PE=3 SV=1 Back     alignment and function description
>sp|P65529|FPRB_MYCBO Probable ferredoxin/ferredoxin--NADP reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fprB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query483
255573812492 NADPH:adrenodoxin oxidoreductase, mitoch 0.997 0.979 0.809 0.0
225445178486 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.989 0.983 0.822 0.0
224065242496 predicted protein [Populus trichocarpa] 0.964 0.939 0.830 0.0
356513151484 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.991 0.989 0.776 0.0
449432374486 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.997 0.991 0.761 0.0
449487548486 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.997 0.991 0.761 0.0
356553385484 PREDICTED: NADPH:adrenodoxin oxidoreduct 0.991 0.989 0.770 0.0
297802792484 hypothetical protein ARALYDRAFT_913213 [ 0.989 0.987 0.723 0.0
357520949452 NADPH:adrenodoxin oxidoreductase [Medica 0.919 0.982 0.782 0.0
22329089483 ferredoxin--NADP+ reductase [Arabidopsis 0.987 0.987 0.728 0.0
>gi|255573812|ref|XP_002527825.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] gi|223532749|gb|EEF34528.1| NADPH:adrenodoxin oxidoreductase, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/482 (80%), Positives = 433/482 (89%)

Query: 2   YKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVR 61
           YKA  WLSR F+ L+S+PLRVCVVGSGPAGFYTAEK LKAH+EA++DIIDRLPTPFGLVR
Sbjct: 10  YKAMKWLSRRFSNLTSHPLRVCVVGSGPAGFYTAEKMLKAHREAEIDIIDRLPTPFGLVR 69

Query: 62  SGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDR 121
           SGVAPDHPETKIVINQFSR+VQ+ERCSFFGNVTLGSS+SL+ELR LYHVVVLAYGAESDR
Sbjct: 70  SGVAPDHPETKIVINQFSRLVQNERCSFFGNVTLGSSISLAELRDLYHVVVLAYGAESDR 129

Query: 122 ALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRP 181
           ALGIPGEDL+G+HSAREFVWWYNGHPD KNL+PDLK TDTAVILGQGNVALD  RILLRP
Sbjct: 130 ALGIPGEDLLGIHSAREFVWWYNGHPDCKNLNPDLKGTDTAVILGQGNVALDATRILLRP 189

Query: 182 TEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDD 241
           T ELA TDIA +A  ALE S IRKVYLVGRRGPVQAACTAKELRE+LGIK+L++HI+E D
Sbjct: 190 TAELARTDIACHALAALEQSCIRKVYLVGRRGPVQAACTAKELREVLGIKDLFIHIKEAD 249

Query: 242 LIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERS 301
           L+KS  DEEE+K SRIQRR+Y+LLSKAAAS  S P  GQRELHFVFFRKPD FL+S  R 
Sbjct: 250 LLKSSDDEEELKGSRIQRRIYDLLSKAAASGPSHPSSGQRELHFVFFRKPDRFLDSEVRI 309

Query: 302 GHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIV 361
           GHV+GVHFEKT LKG  PGKQ AVGTG+FEDLDCGMVLKS+GYKSVPV+GLPFD+ KG+V
Sbjct: 310 GHVAGVHFEKTVLKGISPGKQVAVGTGKFEDLDCGMVLKSVGYKSVPVDGLPFDHQKGVV 369

Query: 362 PNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLA 421
           P++ GRVL   SGDS  +E GLYVCGWLKRGPTGIIATNLYCAEETVASI +DLEQG LA
Sbjct: 370 PSVGGRVLTEASGDSKLLEKGLYVCGWLKRGPTGIIATNLYCAEETVASILQDLEQGALA 429

Query: 422 SSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKV 481
           +++ LPKPG+EGL QLL +RNVR VPFS+WEKIDSEEKRLGS RNKP+EKLT++EDLLKV
Sbjct: 430 AATSLPKPGKEGLRQLLGDRNVRVVPFSSWEKIDSEEKRLGSSRNKPREKLTSWEDLLKV 489

Query: 482 AT 483
           AT
Sbjct: 490 AT 491

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225445178|ref|XP_002280736.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial [Vitis vinifera] gi|297738792|emb|CBI28037.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224065242|ref|XP_002301734.1| predicted protein [Populus trichocarpa] gi|222843460|gb|EEE81007.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513151|ref|XP_003525277.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449432374|ref|XP_004133974.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487548|ref|XP_004157681.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553385|ref|XP_003545037.1| PREDICTED: NADPH:adrenodoxin oxidoreductase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|297802792|ref|XP_002869280.1| hypothetical protein ARALYDRAFT_913213 [Arabidopsis lyrata subsp. lyrata] gi|297315116|gb|EFH45539.1| hypothetical protein ARALYDRAFT_913213 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357520949|ref|XP_003630763.1| NADPH:adrenodoxin oxidoreductase [Medicago truncatula] gi|355524785|gb|AET05239.1| NADPH:adrenodoxin oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|22329089|ref|NP_194962.2| ferredoxin--NADP+ reductase [Arabidopsis thaliana] gi|17481351|dbj|BAB79228.1| MFDR [Arabidopsis thaliana] gi|28192433|gb|AAL82814.1| NADP adrenodoxin-like ferredoxin reductase [Arabidopsis thaliana] gi|332660646|gb|AEE86046.1| ferredoxin--NADP+ reductase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query483
TAIR|locus:2127811483 AT4G32360 [Arabidopsis thalian 0.987 0.987 0.715 1.5e-184
MGI|MGI:104724494 Fdxr "ferredoxin reductase" [M 0.937 0.917 0.467 5.4e-102
UNIPROTKB|F1NRB1466 FDXR "NADPH:adrenodoxin oxidor 0.942 0.976 0.456 2.1e-100
UNIPROTKB|P22570491 FDXR "NADPH:adrenodoxin oxidor 0.933 0.918 0.472 3.4e-100
UNIPROTKB|E7EQC1522 FDXR "NADPH:adrenodoxin oxidor 0.917 0.848 0.477 7.1e-100
UNIPROTKB|J3QQX3463 FDXR "NADPH:adrenodoxin oxidor 0.432 0.451 0.606 4.7e-99
RGD|621648494 Fdxr "ferredoxin reductase" [R 0.937 0.917 0.457 6.4e-99
UNIPROTKB|P56522494 Fdxr "NADPH:adrenodoxin oxidor 0.937 0.917 0.457 6.4e-99
UNIPROTKB|P08165492 FDXR "NADPH:adrenodoxin oxidor 0.933 0.916 0.461 1.3e-98
UNIPROTKB|E2RDC3492 FDXR "NADPH:adrenodoxin oxidor 0.923 0.906 0.462 3.5e-98
TAIR|locus:2127811 AT4G32360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1790 (635.2 bits), Expect = 1.5e-184, P = 1.5e-184
 Identities = 345/482 (71%), Positives = 400/482 (82%)

Query:     2 YKARAWLSRSFTALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVR 61
             Y AR  +SR F++ SS PL VC+VGSGPAGFYTA+K LKAH+ A VDIIDRLPTPFGLVR
Sbjct:     4 YLARYMVSRYFSSASSRPLHVCIVGSGPAGFYTADKVLKAHEGAHVDIIDRLPTPFGLVR 63

Query:    62 SGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDR 121
             SGVAPDHPETKI INQFSRV QHERCSF GNV LGS +SLSELR LYHVVVLAYGAESD+
Sbjct:    64 SGVAPDHPETKIAINQFSRVAQHERCSFIGNVKLGSDLSLSELRDLYHVVVLAYGAESDK 123

Query:   122 ALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRP 181
              LGIPGE L G++SAREFVWWYNGHPD  +L PDLK++D+AVILGQGNVALDVARILLRP
Sbjct:   124 DLGIPGESLSGIYSAREFVWWYNGHPDYSSLKPDLKTSDSAVILGQGNVALDVARILLRP 183

Query:   182 TEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDD 241
             T ELA+TDIA++A +AL+ SSIRKVYL+GRRGPVQAA TAKELRE+LGIKNL++ I++ D
Sbjct:   184 TTELASTDIATHALSALKESSIRKVYLIGRRGPVQAALTAKELREVLGIKNLHIRIKQTD 243

Query:   242 LIKSPTDEEEMKNSRIQRRVYELLXXXXXXX-XXQPMLGQRELHFVFFRKPDSFLESNER 300
             L  +P DEEEMK SR ++R+YELL          +    QRELHFVFFR+PD FLES+ER
Sbjct:   244 LSVTPADEEEMKTSRARKRIYELLSKAAAAAKTSEADPDQRELHFVFFRQPDQFLESDER 303

Query:   301 SGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGI 360
              GHVSGV+ +KT L+  G GKQ AVGTGEFEDL+C MVLK+IGYKSVPVNGLPFD+ KG+
Sbjct:   304 KGHVSGVNLQKTILESVGTGKQIAVGTGEFEDLNCSMVLKAIGYKSVPVNGLPFDHKKGV 363

Query:   361 VPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVL 420
             VPN++GRV+ + SGD SQ E GLYVCGWLKRGP GIIATNLYCAEETV SISED+E+GV 
Sbjct:   364 VPNVKGRVVSHTSGDISQTEPGLYVCGWLKRGPVGIIATNLYCAEETVGSISEDIEEGVW 423

Query:   421 ASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLK 480
              SS    K G +GL+QLL+ R V+ V FS WEKID++EK++G  RNKP+EKL T+EDLL 
Sbjct:   424 KSS----KAGSKGLMQLLEKRKVKKVEFSGWEKIDAKEKQMGIERNKPREKLVTWEDLLA 479

Query:   481 VA 482
              A
Sbjct:   480 AA 481
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0009055 "electron carrier activity" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
MGI|MGI:104724 Fdxr "ferredoxin reductase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRB1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P22570 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQC1 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QQX3 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621648 Fdxr "ferredoxin reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P56522 Fdxr "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P08165 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDC3 FDXR "NADPH:adrenodoxin oxidoreductase, mitochondrial" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V3T9ADRO_DROME1, ., 1, 8, ., 1, ., 20.42760.89640.9291yesno
P08165ADRO_BOVIN1, ., 1, 8, ., 1, ., 20.45340.93780.9207yesno
O32886FPRA_MYCLE1, ., 1, 8, ., 1, ., 20.38700.91090.9649yesno
Q61578ADRO_MOUSE1, ., 1, 8, ., 1, ., 20.45960.93780.9170yesno
Q54KG7ADRO_DICDI1, ., 1, 8, ., 1, ., 20.36210.95650.8970yesno
P48360ADRO_YEAST1, ., 1, 8, ., 1, ., 20.30950.90060.8823yesno
P56522ADRO_RAT1, ., 1, 8, ., 1, ., 20.45240.93580.9149yesno
P22570ADRO_HUMAN1, ., 1, 8, ., 1, ., 20.47260.93370.9185yesno
O05783FPRA_MYCTU1, ., 1, 8, ., 1, ., 20.39270.91710.9714yesno
O59710ADRO_SCHPO1, ., 1, 8, ., 1, ., 20.34700.92540.9530yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.18.1.20.914
3rd Layer1.18.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
PLN02852491 PLN02852, PLN02852, ferredoxin-NADP+ reductase 0.0
PTZ00188506 PTZ00188, PTZ00188, adrenodoxin reductase; Provisi 1e-51
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 2e-39
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 2e-25
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 2e-20
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 8e-16
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 2e-15
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 3e-15
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 4e-15
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 1e-14
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 2e-13
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 5e-13
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 2e-12
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 1e-11
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 7e-11
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 7e-11
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 7e-11
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 1e-10
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 2e-08
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 3e-08
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 4e-07
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-05
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 0.001
>gnl|CDD|215457 PLN02852, PLN02852, ferredoxin-NADP+ reductase Back     alignment and domain information 
 Score =  865 bits (2237), Expect = 0.0
 Identities = 348/489 (71%), Positives = 397/489 (81%), Gaps = 8/489 (1%)

Query: 1   MYKARAWLSRSF-----TALSSNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPT 55
             +AR WLSR+      ++ +S PL VCVVGSGPAGFYTA+K LKAH  A+VDII+RLPT
Sbjct: 3   RLRARTWLSRALSFSNSSSSTSEPLHVCVVGSGPAGFYTADKLLKAHDGARVDIIERLPT 62

Query: 56  PFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAY 115
           PFGLVRSGVAPDHPETK V NQFSRV   +R SFFGNVTLG  VSLSELR LYHVVVLAY
Sbjct: 63  PFGLVRSGVAPDHPETKNVTNQFSRVATDDRVSFFGNVTLGRDVSLSELRDLYHVVVLAY 122

Query: 116 GAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVA 175
           GAESDR LGIPGEDL GV SAREFVWWYNGHPD  +L PDLKS+DTAV+LGQGNVALD A
Sbjct: 123 GAESDRRLGIPGEDLPGVLSAREFVWWYNGHPDCVHLPPDLKSSDTAVVLGQGNVALDCA 182

Query: 176 RILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYV 235
           RILLRPT+ELA+TDIA +A  AL GSS+RKVYLVGRRGPVQAACTAKELRE+LG+KN+ V
Sbjct: 183 RILLRPTDELASTDIAEHALEALRGSSVRKVYLVGRRGPVQAACTAKELRELLGLKNVRV 242

Query: 236 HIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFL 295
            I+E DL  SP DEEE+K SR +RRVYELLSKAAA+    P  GQRELHFVFFR P  FL
Sbjct: 243 RIKEADLTLSPEDEEELKASRPKRRVYELLSKAAAAGKCAPSGGQRELHFVFFRNPTRFL 302

Query: 296 ESNERSGHVSGVHFEKTALKG-GGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPF 354
           +S + +GHV+GV  E+T L+G  G GKQ AVGTGEFEDL CG+VLKSIGYKS+PV+GLPF
Sbjct: 303 DSGDGNGHVAGVKLERTVLEGAAGSGKQVAVGTGEFEDLPCGLVLKSIGYKSLPVDGLPF 362

Query: 355 DNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISED 414
           D+ +G+VPN+ GRVL + SG  +  E GLYV GWLKRGPTGII TNL CAEETVASI+ED
Sbjct: 363 DHKRGVVPNVHGRVLSSASG--ADTEPGLYVVGWLKRGPTGIIGTNLTCAEETVASIAED 420

Query: 415 LEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTT 474
           LEQG L   +  PKPGR+GLL+LL++R VR VPFS WEKIDS EK  G  R KP+EK+T+
Sbjct: 421 LEQGRLRGVASPPKPGRDGLLELLESRGVRVVPFSGWEKIDSAEKEAGRARGKPREKITS 480

Query: 475 YEDLLKVAT 483
            E++LK A 
Sbjct: 481 IEEMLKAAN 489

Length = 491
>gnl|CDD|240308 PTZ00188, PTZ00188, adrenodoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 483
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 100.0
PLN02852491 ferredoxin-NADP+ reductase 100.0
PTZ00188506 adrenodoxin reductase; Provisional 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 100.0
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 100.0
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 100.0
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PRK12770352 putative glutamate synthase subunit beta; Provisio 100.0
PRK13984604 putative oxidoreductase; Provisional 100.0
PRK12771564 putative glutamate synthase (NADPH) small subunit; 100.0
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 100.0
PRK06370463 mercuric reductase; Validated 100.0
KOG03992142 consensus Glutamate synthase [Amino acid transport 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK06116450 glutathione reductase; Validated 99.98
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.98
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.97
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.97
PLN02507499 glutathione reductase 99.97
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.97
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.97
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.97
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.97
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.97
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.97
PLN02546558 glutathione reductase 99.97
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.97
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.97
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.97
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.97
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.97
PRK13512438 coenzyme A disulfide reductase; Provisional 99.97
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.97
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.97
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.97
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.97
PTZ00058561 glutathione reductase; Provisional 99.97
PRK07846451 mycothione reductase; Reviewed 99.97
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.97
PRK13748561 putative mercuric reductase; Provisional 99.97
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.97
PRK14694468 putative mercuric reductase; Provisional 99.97
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.97
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.97
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.97
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.96
PRK14727479 putative mercuric reductase; Provisional 99.96
PTZ00052499 thioredoxin reductase; Provisional 99.96
PTZ00153659 lipoamide dehydrogenase; Provisional 99.96
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.95
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.95
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.95
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.94
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.94
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.93
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.93
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.92
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.92
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.92
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.89
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.88
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.78
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.77
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.76
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.73
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.7
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.65
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.57
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.56
KOG2755334 consensus Oxidoreductase [General function predict 99.53
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.48
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.39
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.37
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.29
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.28
PRK09897534 hypothetical protein; Provisional 99.13
COG2081408 Predicted flavoproteins [General function predicti 98.9
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.81
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.79
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.74
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.66
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.58
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.57
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.51
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.49
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.44
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.43
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.42
PLN02463447 lycopene beta cyclase 98.41
PLN02661357 Putative thiazole synthesis 98.41
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.39
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.34
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.32
PRK10157428 putative oxidoreductase FixC; Provisional 98.3
PRK10015429 oxidoreductase; Provisional 98.27
PRK06847375 hypothetical protein; Provisional 98.26
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.2
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.2
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.17
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.17
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.13
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.11
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.11
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.09
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.06
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.04
PRK06834488 hypothetical protein; Provisional 98.04
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.03
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.03
PRK06184502 hypothetical protein; Provisional 98.02
COG3349485 Uncharacterized conserved protein [Function unknow 98.0
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.99
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.99
PLN02697529 lycopene epsilon cyclase 97.97
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.96
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.95
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.94
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.94
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.94
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.93
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.93
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.92
PRK08244493 hypothetical protein; Provisional 97.91
TIGR02053463 MerA mercuric reductase. This model represents the 97.91
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.91
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.9
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.89
PRK13512438 coenzyme A disulfide reductase; Provisional 97.88
PRK07208479 hypothetical protein; Provisional 97.87
PRK06370463 mercuric reductase; Validated 97.85
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.84
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.84
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.83
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.83
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.82
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.82
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.82
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.81
PRK14694468 putative mercuric reductase; Provisional 97.78
PRK13977576 myosin-cross-reactive antigen; Provisional 97.78
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.78
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.77
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.77
PRK07233434 hypothetical protein; Provisional 97.76
PRK06116450 glutathione reductase; Validated 97.75
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.75
PLN02576496 protoporphyrinogen oxidase 97.74
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.73
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.73
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.72
PRK07045388 putative monooxygenase; Reviewed 97.72
PRK12416463 protoporphyrinogen oxidase; Provisional 97.71
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.71
PRK14727479 putative mercuric reductase; Provisional 97.7
PLN02507499 glutathione reductase 97.7
PLN02268435 probable polyamine oxidase 97.7
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.69
PRK07846451 mycothione reductase; Reviewed 97.69
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.69
PRK13748561 putative mercuric reductase; Provisional 97.69
PLN02661357 Putative thiazole synthesis 97.67
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.66
PRK07236386 hypothetical protein; Provisional 97.65
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.64
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.64
PRK06753373 hypothetical protein; Provisional 97.63
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.63
COG2081 408 Predicted flavoproteins [General function predicti 97.63
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.63
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.62
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.62
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.62
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 97.62
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.6
PRK08163396 salicylate hydroxylase; Provisional 97.59
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.59
PTZ00058561 glutathione reductase; Provisional 97.58
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.58
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.58
PRK08013400 oxidoreductase; Provisional 97.58
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.58
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.57
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.56
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.56
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.56
PRK09126392 hypothetical protein; Provisional 97.55
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.54
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.53
PLN02546558 glutathione reductase 97.53
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.53
PRK07190487 hypothetical protein; Provisional 97.53
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.52
PRK05868372 hypothetical protein; Validated 97.51
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.51
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.5
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.49
PRK07538413 hypothetical protein; Provisional 97.49
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.49
PTZ00052499 thioredoxin reductase; Provisional 97.48
PLN02568539 polyamine oxidase 97.48
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.47
PRK07588391 hypothetical protein; Provisional 97.47
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.46
PRK06126545 hypothetical protein; Provisional 97.45
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.45
PRK06475400 salicylate hydroxylase; Provisional 97.45
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.44
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.43
PTZ00153659 lipoamide dehydrogenase; Provisional 97.42
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.42
PLN02529 738 lysine-specific histone demethylase 1 97.42
PRK06185407 hypothetical protein; Provisional 97.42
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.41
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.4
PLN02487569 zeta-carotene desaturase 97.39
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.38
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.36
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.34
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.33
PLN02676487 polyamine oxidase 97.33
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.33
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.32
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.32
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.32
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.32
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.31
PRK10262321 thioredoxin reductase; Provisional 97.31
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.29
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.29
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.29
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.27
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.27
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.26
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 97.26
PLN02612567 phytoene desaturase 97.25
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.24
PLN02985514 squalene monooxygenase 97.24
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.23
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.22
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.21
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.21
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.18
PRK11445351 putative oxidoreductase; Provisional 97.18
PTZ00367567 squalene epoxidase; Provisional 97.18
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.16
PRK08294 634 phenol 2-monooxygenase; Provisional 97.16
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.15
PRK11728393 hydroxyglutarate oxidase; Provisional 97.14
PRK06996398 hypothetical protein; Provisional 97.12
PRK08274466 tricarballylate dehydrogenase; Validated 97.12
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.12
PRK05257494 malate:quinone oxidoreductase; Validated 97.09
PRK07121492 hypothetical protein; Validated 97.09
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.08
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.07
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.05
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.03
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.02
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.02
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.01
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.0
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 96.97
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.97
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.96
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.96
PRK08401466 L-aspartate oxidase; Provisional 96.95
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.92
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.91
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.9
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.9
PLN03000 881 amine oxidase 96.89
COG0579429 Predicted dehydrogenase [General function predicti 96.89
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 96.89
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 96.88
PTZ00383497 malate:quinone oxidoreductase; Provisional 96.88
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.87
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.87
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 96.86
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.86
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.86
PRK07804541 L-aspartate oxidase; Provisional 96.85
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 96.85
PLN02976 1713 amine oxidase 96.84
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.84
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.83
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.81
PRK12839 572 hypothetical protein; Provisional 96.8
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.8
PRK08275554 putative oxidoreductase; Provisional 96.79
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 96.79
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 96.78
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.78
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.76
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.74
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 96.73
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.73
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.69
PRK06847375 hypothetical protein; Provisional 96.69
PRK13339497 malate:quinone oxidoreductase; Reviewed 96.69
PLN02464627 glycerol-3-phosphate dehydrogenase 96.69
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.68
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.68
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.67
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.66
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.65
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.65
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.65
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 96.64
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.63
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.62
PRK07045388 putative monooxygenase; Reviewed 96.61
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.61
PRK12831464 putative oxidoreductase; Provisional 96.6
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.6
PRK06175433 L-aspartate oxidase; Provisional 96.6
PRK08071510 L-aspartate oxidase; Provisional 96.56
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.56
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.54
PRK07395553 L-aspartate oxidase; Provisional 96.52
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 96.52
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.51
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.49
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.49
PLN02815 594 L-aspartate oxidase 96.44
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.44
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.41
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.4
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.39
PLN02463447 lycopene beta cyclase 96.38
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.36
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.36
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 96.35
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.32
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.32
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 96.31
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.3
PLN02852 491 ferredoxin-NADP+ reductase 96.28
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.27
PRK09077536 L-aspartate oxidase; Provisional 96.27
PRK06184 502 hypothetical protein; Provisional 96.26
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.25
PRK06185 407 hypothetical protein; Provisional 96.25
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.25
PRK11445351 putative oxidoreductase; Provisional 96.24
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.22
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.2
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.16
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 96.14
PRK10157428 putative oxidoreductase FixC; Provisional 96.12
PRK05868372 hypothetical protein; Validated 96.1
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.09
PRK10015429 oxidoreductase; Provisional 96.09
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.09
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.06
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.06
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 95.98
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.94
PRK02106560 choline dehydrogenase; Validated 95.94
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 95.93
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.93
PRK07588391 hypothetical protein; Provisional 95.87
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 95.86
PRK07512513 L-aspartate oxidase; Provisional 95.86
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 95.85
PRK06126 545 hypothetical protein; Provisional 95.85
PLN02697529 lycopene epsilon cyclase 95.84
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 95.84
PRK06475400 salicylate hydroxylase; Provisional 95.83
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 95.81
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.81
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.81
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.79
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 95.78
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.78
PRK08244 493 hypothetical protein; Provisional 95.76
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 95.71
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 95.71
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 95.61
PRK09126392 hypothetical protein; Provisional 95.59
KOG1298509 consensus Squalene monooxygenase [Lipid transport 95.59
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 95.58
PRK07538 413 hypothetical protein; Provisional 95.56
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.55
PRK07236386 hypothetical protein; Provisional 95.54
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 95.52
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 95.51
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.49
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 95.49
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.46
PRK06753373 hypothetical protein; Provisional 95.43
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.43
PRK06834 488 hypothetical protein; Provisional 95.42
PRK08274 466 tricarballylate dehydrogenase; Validated 95.39
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 95.39
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.38
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.36
PRK08132 547 FAD-dependent oxidoreductase; Provisional 95.36
KOG2852380 consensus Possible oxidoreductase [General functio 95.33
PRK09897 534 hypothetical protein; Provisional 95.3
PRK06996398 hypothetical protein; Provisional 95.19
PRK08163396 salicylate hydroxylase; Provisional 95.17
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.17
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 95.16
PTZ00188 506 adrenodoxin reductase; Provisional 95.16
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 95.16
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.15
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 95.12
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 95.1
PRK07190 487 hypothetical protein; Provisional 95.1
TIGR00275400 flavoprotein, HI0933 family. The model when search 95.09
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 95.05
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 94.99
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 94.94
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 94.92
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 94.91
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 94.88
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.87
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 94.87
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 94.86
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 94.85
PRK12814652 putative NADPH-dependent glutamate synthase small 94.84
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 94.83
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 94.81
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 94.81
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 94.79
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 94.74
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.7
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 94.63
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 94.62
COG3573552 Predicted oxidoreductase [General function predict 94.61
PLN02785587 Protein HOTHEAD 94.59
PLN02985 514 squalene monooxygenase 94.59
KOG4716503 consensus Thioredoxin reductase [Posttranslational 94.58
PRK06719157 precorrin-2 dehydrogenase; Validated 94.5
PRK08013400 oxidoreductase; Provisional 94.45
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.4
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 94.39
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 94.36
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 94.31
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.23
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 94.2
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.1
COG2303542 BetA Choline dehydrogenase and related flavoprotei 94.07
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.03
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.02
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.94
PLN02353473 probable UDP-glucose 6-dehydrogenase 93.83
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 93.8
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.79
PRK13984604 putative oxidoreductase; Provisional 93.75
PRK06567 1028 putative bifunctional glutamate synthase subunit b 93.73
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 93.66
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 93.47
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.43
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.43
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 93.41
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.25
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 93.17
KOG03992142 consensus Glutamate synthase [Amino acid transport 93.08
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 93.02
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 92.98
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.93
KOG2853509 consensus Possible oxidoreductase [General functio 92.85
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 92.77
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 92.69
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.65
KOG2755334 consensus Oxidoreductase [General function predict 92.62
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 92.56
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.56
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.52
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 92.46
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 92.46
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.45
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.4
PRK08294 634 phenol 2-monooxygenase; Provisional 92.38
KOG2404 477 consensus Fumarate reductase, flavoprotein subunit 92.34
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 92.33
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 92.28
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 92.04
PRK08275554 putative oxidoreductase; Provisional 91.79
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-82  Score=592.37  Aligned_cols=444  Identities=53%  Similarity=0.856  Sum_probs=399.7

Q ss_pred             CCCCeEEEECccHHHHHHHHHHHhcCCCCeEEEEecCCCCCCceecccCCCCCChHHHHHHHHHHHhcCCeEEEeCeEEc
Q 011535           17 SNPLRVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGNVTLG   96 (483)
Q Consensus        17 ~~~~~vvIIG~G~aGl~aA~~l~~~~~~~~v~lie~~~~~ggl~~~g~~p~~~~~~~~~~~~~~~~~~~~v~~~~~~~v~   96 (483)
                      ++.++|+|||+||||+|+|..|.++.++++|+|+|+.|.|+|+++||++|+|++.+++.+.|.+.+++.++.|+.|+.+|
T Consensus        18 s~~p~vcIVGsGPAGfYtA~~LLk~~~~~~Vdi~Ek~PvPFGLvRyGVAPDHpEvKnvintFt~~aE~~rfsf~gNv~vG   97 (468)
T KOG1800|consen   18 SSTPRVCIVGSGPAGFYTAQHLLKRHPNAHVDIFEKLPVPFGLVRYGVAPDHPEVKNVINTFTKTAEHERFSFFGNVKVG   97 (468)
T ss_pred             cCCceEEEECCCchHHHHHHHHHhcCCCCeeEeeecCCcccceeeeccCCCCcchhhHHHHHHHHhhccceEEEecceec
Confidence            34559999999999999999999987789999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEecceeeccCEEEEccCCCCCCCCCCCCCCCCCeeecceeeeeecCCCCCCCCCCCCCCCCeEEEEcCCchHHHHHH
Q 011535           97 SSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVAR  176 (483)
Q Consensus        97 ~~~~~~~~~~~yd~vvlAtG~~~~~~~~ipg~~~~~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~vvVIG~G~~g~e~A~  176 (483)
                      +++++.+++..||+||||+|+..++.++|||+++.+|+++++|+.|||++|++..+.+|+ .+++|+|||+||+++|+|+
T Consensus        98 ~dvsl~eL~~~ydavvLaYGa~~dR~L~IPGe~l~~V~Sarefv~Wyng~P~~~~le~dl-s~~~vvIvG~GNVAlDvAR  176 (468)
T KOG1800|consen   98 RDVSLKELTDNYDAVVLAYGADGDRRLDIPGEELSGVISAREFVGWYNGLPENQNLEPDL-SGRKVVIVGNGNVALDVAR  176 (468)
T ss_pred             ccccHHHHhhcccEEEEEecCCCCcccCCCCcccccceehhhhhhhccCCCcccccCccc-ccceEEEEccCchhhhhhh
Confidence            999999999999999999999889999999999999999999999999999999999999 5999999999999999999


Q ss_pred             HHhcCCcccc-ccccchHHHHHHhcCCccEEEEEeecCcccccCCHHHHHHHhcCCCeeEEeccccccCCCCcHHHhhcc
Q 011535          177 ILLRPTEELA-TTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNS  255 (483)
Q Consensus       177 ~L~~~~~~l~-~~di~~~~~~~l~~~~~~~V~li~r~~~~~~~f~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  255 (483)
                      .|..+...|. .|||+..+|..|+.+.+++|+|++||++.+++||++||||++++|+++..+++.++.............
T Consensus       177 iLls~~~~l~~~TDi~~~aL~~L~~s~VkdV~lvgRRgp~~~aFTiKELRE~~~l~~~~~r~~~~~~~~~~~~~~~~~~~  256 (468)
T KOG1800|consen  177 ILLSPQGPLFRRTDIPKLALNLLKRSNVKDVKLVGRRGPLQVAFTIKELREVLELPGARPRLDPVDFSGKWMDESETPQH  256 (468)
T ss_pred             hhhCCccccccccCCcHHHHhhhhcCCcceEEEEeccCccceeeeHHHHHHHhCCCCcccccCchhccceeCCccccccc
Confidence            9999888777 999999999999999999999999999999999999999999999999999988776544444444446


Q ss_pred             HHHHHHHHHHHHHHHhc---CCCCCCCcceEEEeecCCcceeecccCCCCceEEEEEeeeeeeCCCCCceeeccCCceEE
Q 011535          256 RIQRRVYELLSKAAASA---SSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFED  332 (483)
Q Consensus       256 ~~~~r~~~~l~~~~~~~---~~~~~~~~~~i~~~~~~~~~~v~~~~~~~g~v~~v~~~~~~l~~~~~g~~~~~~~g~~~~  332 (483)
                      |.++|+.+.+.+.+...   ........+.+.++|...|.+|.  . +++.+.++.+..+.+..    . +.+++|+.++
T Consensus       257 RpRkrl~ell~k~~~e~~~~~~~~~~~~k~w~~~f~r~P~~i~--~-~~~~v~~~~~~~t~l~~----~-~~~~tg~~e~  328 (468)
T KOG1800|consen  257 RPRKRLTELLLKWAREHRAKASEEAGGSKQWHLRFFRTPGAIL--P-GADGVSGVRFQVTILEG----T-QAVPTGAFET  328 (468)
T ss_pred             CchhHHHHHHHHHHHhhhhccccccCccchhHHHHhcCHHHhc--c-CcccccceEEEeeeehh----h-cccccCceEe
Confidence            89999999999887642   12334556789999999999998  3 34458888888877652    1 2456888899


Q ss_pred             EecCeEEEeeecCCCCCC-CCCccCCCCcccCCCCeeeecCCCCCCcccCceeeeccCCCCCcchhHhhHHHHHHHHHHH
Q 011535          333 LDCGMVLKSIGYKSVPVN-GLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASI  411 (483)
Q Consensus       333 i~~D~vi~a~G~~~~~~~-~l~~~~~~g~~~~~~G~v~v~~~~~~~t~~p~vya~Gd~~~g~~~~~~~a~~~g~~~a~~I  411 (483)
                      ++|+++|.++||+..+++ ++||+...|+..|.+|++.+..      ..|+||++|||++||.|+++++|++|..+|+.|
T Consensus       329 ~p~~l~i~sIGYks~pv~~gipFd~~kgvv~n~~GrV~~s~------~~pglY~sGW~k~GP~GvIattm~dAf~v~d~I  402 (468)
T KOG1800|consen  329 LPCGLLIRSIGYKSVPVDSGIPFDDKKGVVPNVNGRVLVSG------CSPGLYASGWVKHGPTGVIATTMQDAFEVADTI  402 (468)
T ss_pred             eccceeEeeeeecccccCCCCCcccccCcccCCCceEEeec------cCCceEEEeeeccCCcceeeehhhhHHHHHHHH
Confidence            999999999999998877 8999999999999999998432      459999999999999999999999999999999


Q ss_pred             HHHHhcCcCCCCCCCCCCChhhHHHHHhcCCCcccchhhHHhhhHHHHHccccCCCCcccccCHHHHHhhh
Q 011535          412 SEDLEQGVLASSSGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVA  482 (483)
Q Consensus       412 ~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~w~~id~~e~~~g~~~~~~r~k~~~~~~~~~~~  482 (483)
                      .+++..+-+..       ...++..++..+++++++|.||++||+.|+.+|+..||+||||+++||||+.+
T Consensus       403 ~qD~~~~~~~s-------s~~~l~~~l~~~~v~~v~w~dWe~I~~~E~~~Gk~~~k~reKf~t~Eeml~~~  466 (468)
T KOG1800|consen  403 VQDLKIQFLDS-------SSAGLEALLESRGVRVVSWSDWEKIDAKEVARGKGTGKPREKFVTFEEMLRLL  466 (468)
T ss_pred             HHHHHHhhccc-------hHHHHHHhhhccCCceecchhHHHhhHHHHhhccccCCchHhcCCHHHHHHHh
Confidence            99998553333       35789999999999999999999999999999999999999999999999875

>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
1cjc_A460 Structure Of Adrenodoxin Reductase Of Mitochondrial 1e-105
1lqt_A456 A Covalent Modification Of Nadp+ Revealed By The At 3e-83
2c7g_A456 Fpra From Mycobacterium Tuberculosis: His57gln Muta 2e-82
>pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductase Of Mitochondrial P450 Systems Length = 460 Back     alignment and structure 
Iteration: 1

 Score =  378 bits (971), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 216/467 (46%), Positives = 286/467 (61%), Gaps = 23/467 (4%)
Query: 21  RVCVVGSGPAGFYTAEKTLKAHQEAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSR 80
           ++CVVGSGPAGFYTA+  LK H  A VDI ++   PFGLVR GVAPDHPE K VIN F++
Sbjct: 8   QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQ 67
Query: 81  VVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFV 140
             + +RC+F+GNV +G  V++ EL+  YH VVL+YGAE  +AL IPGE+L GV SAR FV
Sbjct: 68  TARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFV 127
Query: 141 WWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALEG 200
            WYNG P+ + L+PDL S DTAVILGQGNVALDVARILL P + L  TDI   A  AL  
Sbjct: 128 GWYNGLPENRELAPDL-SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQ 186
Query: 201 SSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRR 260
           S ++ V++VGRRGP+Q A T KELRE++ +      +   D +     +   + +R ++R
Sbjct: 187 SRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLG--LQDRIKEAARPRKR 244
Query: 261 VYELLXXXXXXX-----XXQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALK 315
           + ELL              +     R     FFR P   L S +     +G+    T L+
Sbjct: 245 LMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPD-GRRAAGIRLAVTRLE 303
Query: 316 GGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVN-GLPFDNHKGIVPNIRGRVLKNISG 374
           G G   + AV TG+ EDL CG+VL SIGYKS P++  +PFD   G+VPN+ GRV+     
Sbjct: 304 GIGEATR-AVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDV--- 359
Query: 375 DSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSSGLPKPGREGL 434
                  GLY  GW+KRGPTG+I T +  +  T   + +DL+ G L S    P+PG   +
Sbjct: 360 ------PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSG---PRPGSAFI 410
Query: 435 LQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKV 481
             LLD+R V PV FS WEK+D+EE   G    KP+EKL   +++L++
Sbjct: 411 KALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQEMLRL 457
>pdb|1LQT|A Chain A, A Covalent Modification Of Nadp+ Revealed By The Atomic Resolution Structure Of Fpra, A Mycobacterium Tuberculosis Oxidoreductase Length = 456 Back     alignment and structure
>pdb|2C7G|A Chain A, Fpra From Mycobacterium Tuberculosis: His57gln Mutant Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query483
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 0.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 0.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 3e-21
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 3e-20
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 8e-06
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
 Score =  532 bits (1373), Expect = 0.0
 Identities = 180/470 (38%), Positives = 259/470 (55%), Gaps = 24/470 (5%)

Query: 19  PLRVCVVGSGPAGFYTAEKTLKAHQEA-----QVDIIDRLPTPFGLVRSGVAPDHPETKI 73
           P  + +VGSGP+ F+ A   LKA          VD+++ LPTP+GLVRSGVAPDHP+ K 
Sbjct: 3   PYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKS 62

Query: 74  VINQFSRVVQHERCSFFGNVTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGV 133
           +  QF +  +  R  FFGNV +G  V   EL + Y  V+ A GA+SDR L IPGEDL G 
Sbjct: 63  ISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGS 122

Query: 134 HSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASY 193
            +A +FV WYN HP  + +SPDL S   AV++G GNVALDVARILL   + LA TDIA +
Sbjct: 123 IAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILLTDPDVLARTDIADH 181

Query: 194 AWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMK 253
           A  +L    I++V +VGRRGP+QAA T  ELRE+  +  + V I   + +   TDE+   
Sbjct: 182 ALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAE-LDGITDEDAAA 240

Query: 254 NSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTA 313
             ++ ++  ++L   A     +P  G R + F F   P            V  +   +  
Sbjct: 241 VGKVCKQNIKVLRGYAD---REPRPGHRRMVFRFLTSPIEIKG----KRKVERIVLGRNE 293

Query: 314 LKGGGPGKQYAVGTGEFEDLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNIS 373
           L   G G+  A  TGE E+L   +V++S+GY+ VP  GLPFD+  G +PN+ GR+     
Sbjct: 294 LVSDGSGRVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRING--- 350

Query: 374 GDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASISEDLEQGVLASSS-GLPKPGRE 432
                     YV GW+KRGPTG+I TN   A++TV ++ ++L      +     P+   +
Sbjct: 351 ------SPNEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKSFPEDHAD 404

Query: 433 GLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVA 482
            +   L  R  + V  + W+ ID+ E+  G    +P+ KL +  +LL++ 
Sbjct: 405 QVADWLAARQPKLVTSAHWQVIDAFERAAGEPHGRPRVKLASLAELLRIG 454
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query483
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 100.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.98
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.98
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.98
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.97
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.97
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.97
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.97
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.97
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.97
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.97
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.97
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.97
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.97
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.97
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.97
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.97
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.97
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.97
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.97
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.97
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.97
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.97
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.97
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.97
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.97
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.97
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.97
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.97
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.97
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.97
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.97
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.97
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.97
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.97
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.97
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.97
4dna_A463 Probable glutathione reductase; structural genomic 99.97
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.97
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.97
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.97
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.97
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.97
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.96
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.96
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.96
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.96
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.96
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.96
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.96
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.96
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.96
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.96
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.96
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.95
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.95
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.95
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.95
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.95
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.94
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.94
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.94
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.94
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.94
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.92
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.91
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.89
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.88
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.87
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.82
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.69
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.69
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.29
2cul_A232 Glucose-inhibited division protein A-related PROT 99.21
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.87
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.83
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.66
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.64
2cul_A232 Glucose-inhibited division protein A-related PROT 98.62
2bry_A497 NEDD9 interacting protein with calponin homology a 98.62
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.6
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.56
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.52
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.47
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.4
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.38
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.37
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.36
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.35
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.33
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.33
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.33
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.32
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.29
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.27
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.24
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.23
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.21
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.2
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.2
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.2
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.19
3dme_A369 Conserved exported protein; structural genomics, P 98.18
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.18
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.18
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.17
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.17
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.17
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.17
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.15
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.14
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.12
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.12
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.1
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.1
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.1
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.08
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.08
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.06
3atr_A453 Conserved archaeal protein; saturating double bond 98.06
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.04
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.03
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.01
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.99
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.97
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.97
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.97
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.94
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.93
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.91
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.91
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.89
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.89
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.88
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.88
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.88
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.88
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.87
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.87
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.86
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.86
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.85
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.83
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.82
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.82
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.8
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.8
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.8
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.79
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.78
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.78
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.78
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.77
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.77
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.76
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.76
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.76
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.76
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.75
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.75
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.75
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.75
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.75
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.75
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.74
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.74
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.74
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.74
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.72
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.72
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.71
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.7
4dna_A463 Probable glutathione reductase; structural genomic 97.69
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.68
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.67
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.67
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.66
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.64
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.64
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.64
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.64
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.63
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.63
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.62
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.61
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.61
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.6
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.6
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.6
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.58
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.57
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.57
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.56
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.56
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.54
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.54
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.54
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.5
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.5
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.47
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.47
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.46
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.46
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.46
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.43
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.41
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.41
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.41
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.38
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.37
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.37
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.36
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.36
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.35
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.35
2bry_A 497 NEDD9 interacting protein with calponin homology a 97.34
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.32
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.31
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.3
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.29
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.29
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.27
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.26
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.26
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.26
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.25
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.25
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.25
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.2
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.19
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.19
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.18
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.17
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.17
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.17
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.16
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.16
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.15
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.15
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.13
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.11
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.11
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.1
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.1
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.1
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.1
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.09
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.06
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.06
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.04
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.02
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.0
3atr_A 453 Conserved archaeal protein; saturating double bond 96.99
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.98
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 96.97
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.95
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.93
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 96.92
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 96.9
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 96.9
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.9
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.89
2gqf_A401 Hypothetical protein HI0933; structural genomics, 96.86
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.86
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.86
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 96.8
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.79
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.78
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.75
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 96.74
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.72
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.7
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.68
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 96.68
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.63
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.61
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.55
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 96.49
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.47
3dme_A369 Conserved exported protein; structural genomics, P 96.43
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.41
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.41
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.39
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.32
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.31
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.29
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.27
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.27
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.26
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.24
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 96.21
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.18
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.17
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.16
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.14
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.13
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.12
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.1
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.08
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 95.97
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 95.94
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 95.9
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 95.89
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.84
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.8
4fk1_A304 Putative thioredoxin reductase; structural genomic 95.8
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 95.79
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 95.78
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.77
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 95.74
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.67
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.59
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.59
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 95.57
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.54
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.53
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 95.51
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 95.37
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.36
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.35
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.33
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.31
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 95.24
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.21
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.2
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 95.19
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 95.17
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.15
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.09
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 95.01
4hb9_A 412 Similarities with probable monooxygenase; flavin, 94.89
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 94.85
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 94.8
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 94.76
4g65_A461 TRK system potassium uptake protein TRKA; structur 94.71
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 94.7
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 94.48
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.46
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.44
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 94.42
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 94.35
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 94.3
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 94.19
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.96
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.96
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 93.95
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 93.84
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 93.83
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.62
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 93.57
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.36
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 93.28
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 93.21
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.1
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 92.97
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.92
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 92.71
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 92.68
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.61
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.25
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 92.2
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.08
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 91.94
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 91.58
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 91.57
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.55
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.41
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.21
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.18
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.12
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 91.04
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 91.01
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.0
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 90.93
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 90.76
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.76
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.75
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.69
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.67
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.62
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 90.58
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.55
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 90.54
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.52
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 90.47
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 90.37
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.31
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.01
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 89.98
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 89.97
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 89.95
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 89.9
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 89.89
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.77
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.69
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 89.64
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.56
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.55
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.53
3ius_A286 Uncharacterized conserved protein; APC63810, silic 89.52
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 89.46
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 89.44
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.28
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.28
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 89.26
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.25
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.25
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.24
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 89.18
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.15
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.11
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.08
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 89.0
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 88.93
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 88.89
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.78
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 88.55
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.44
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 88.4
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 88.29
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 88.21
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 88.02
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 88.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 87.89
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.84
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.74
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 87.72
2rir_A300 Dipicolinate synthase, A chain; structural genomic 87.71
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 87.67
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.66
3qha_A296 Putative oxidoreductase; seattle structural genomi 87.56
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 87.5
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 87.43
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 87.39
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 87.36
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 87.33
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 87.32
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 87.3
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 87.28
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 87.28
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 87.27
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 87.23
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 87.23
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 87.19
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 87.11
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.1
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 87.01
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 87.01
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 87.01
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 87.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 86.93
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 86.92
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.86
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 86.83
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.8
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 86.77
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 86.75
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 86.75
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 86.6
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 86.45
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 86.37
3l6d_A306 Putative oxidoreductase; structural genomics, prot 86.34
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 86.21
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.21
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 86.21
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 86.15
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 86.15
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 86.12
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 86.08
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 86.05
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 85.94
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 85.87
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 85.85
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 85.76
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-66  Score=532.64  Aligned_cols=447  Identities=39%  Similarity=0.644  Sum_probs=367.3

Q ss_pred             CCCeEEEECccHHHHHHHHHHHh-cCC----CCeEEEEecCCCCCCceecccCCCCCChHHHHHHHHHHHhcCCeEEEeC
Q 011535           18 NPLRVCVVGSGPAGFYTAEKTLK-AHQ----EAQVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVVQHERCSFFGN   92 (483)
Q Consensus        18 ~~~~vvIIG~G~aGl~aA~~l~~-~~~----~~~v~lie~~~~~ggl~~~g~~p~~~~~~~~~~~~~~~~~~~~v~~~~~   92 (483)
                      .+++|+||||||||+++|..|++ ..+    +++|+|||+.+.+||+++|+++|+++..+++..++.+++...+++|+.+
T Consensus         2 ~~~~VvIIG~G~aGl~aA~~L~~~~~~~~~~g~~V~lie~~~~~gg~~~~gv~p~~~~~~~~~~~~~~~~~~~~v~~~~~   81 (456)
T 1lqt_A            2 RPYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDPRFRFFGN   81 (456)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHHHHHHHSTTCCEEEEEEESSSSCSTHHHHTSCTTCTGGGGGHHHHHHHHTSTTEEEEES
T ss_pred             CCCEEEEECcCHHHHHHHHHHHhhCccccCCCCeEEEEecCCCCCCccccccCCCCCCHHHHHHHHHHHHhcCCCEEEee
Confidence            35799999999999999999999 722    3999999999999999999999999988899999999999899999999


Q ss_pred             eEEceEEEecceeeccCEEEEccCCCCCCCCCCCCCCCCCeeecceeeeeecCCCCC-CCCCCCCCCCCeEEEEcCCchH
Q 011535           93 VTLGSSVSLSELRQLYHVVVLAYGAESDRALGIPGEDLIGVHSAREFVWWYNGHPDG-KNLSPDLKSTDTAVILGQGNVA  171 (483)
Q Consensus        93 ~~v~~~~~~~~~~~~yd~vvlAtG~~~~~~~~ipg~~~~~v~~a~~~~~~~~~~~~~-~~~~~~~~~~~~vvVIG~G~~g  171 (483)
                      +.++++++++++...||+||||||+..++++++||.++++++++.+++.||++++++ .+.. ++ .+++|+|||+|++|
T Consensus        82 v~v~~~v~~~~~~~~~d~lViAtG~~~~~~~~ipG~~~~gv~~~~~~~~~~~~~~d~~~~~~-~~-~~~~vvVIG~G~~g  159 (456)
T 1lqt_A           82 VVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSP-DL-SGARAVVIGNGNVA  159 (456)
T ss_dssp             CCBTTTBCHHHHHHHSSEEEECCCCCEECCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCC-CC-CSSEEEEECCSHHH
T ss_pred             EEECCEEEECCCeEeCCEEEEeeCCCCCCCCCCCCCCCCCcEEHHHHHhhhhcCcccccchh-hc-CCCEEEEECCCHHH
Confidence            776655655555567999999999954788899999889999999999999998876 3332 34 67999999999999


Q ss_pred             HHHHHHHhcCCccccccccchHHHHHHhcCCccEEEEEeecCcccccCCHHHHHHHhcCCCeeEEeccccccCCCCcHHH
Q 011535          172 LDVARILLRPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEE  251 (483)
Q Consensus       172 ~e~A~~L~~~~~~l~~~di~~~~~~~l~~~~~~~V~li~r~~~~~~~f~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (483)
                      +|+|..|++..++|..|||+.++++.|+.++.++|+++.|+++++..|+.+|+|++.++|++++.+++.++. .+.....
T Consensus       160 ~e~A~~L~~~~~~l~~tdi~~~~~~~l~~~g~~~V~lv~r~~~~~~~f~~~elrel~~lp~~~~~~~~~~~~-~~~~~~~  238 (456)
T 1lqt_A          160 LDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAELD-GITDEDA  238 (456)
T ss_dssp             HHHHHHHHSCHHHHTTSCCCHHHHHHHTTCCCCEEEEECSSCGGGCCCCHHHHHHGGGCTTEEEECCGGGGT-TCCHHHH
T ss_pred             HHHHHHHHhhhhhhcCCCccHHHHHHHHHCCCcEEEEEecCChhhhccChHHHHHhhcCCCceeeeChHHhc-cchhhhh
Confidence            999999999888899999999999999999999999999999999999999999999999999998877763 2222223


Q ss_pred             hhccHHHHHHHHHHHHHHHhcCCCCCCCcceEEEeecCCcceeecccCCCCceEEEEEeeeeeeCCCCCceeeccCCceE
Q 011535          252 MKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFE  331 (483)
Q Consensus       252 ~~~~~~~~r~~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~~~v~~~~~~~g~v~~v~~~~~~l~~~~~g~~~~~~~g~~~  331 (483)
                      ...++..+++.+.|.+++..   ......++|+++++..+.++.  +  ++++.++++..++++.++.|+.....+|+.+
T Consensus       239 ~~~~~~~~~~~~~l~~~~~~---~~~~~~~gv~i~~~~~~~~i~--~--~~~v~~v~~~~~~~~~~~~~~~~~~~~g~~~  311 (456)
T 1lqt_A          239 AAVGKVCKQNIKVLRGYADR---EPRPGHRRMVFRFLTSPIEIK--G--KRKVERIVLGRNELVSDGSGRVAAKDTGERE  311 (456)
T ss_dssp             HHHCHHHHHHHHHHHHHHTC---C-CTTSEEEEEECSEEEEEEE--C--SSSCCEEEEEEEEEEECSSSSEEEEEEEEEE
T ss_pred             hhccHHHHHHHHHHHHHhhc---CCCCCCceEEEEeCCCCeEEe--c--CCcEeEEEEEEEEecCCCcccccccCCCceE
Confidence            33467777778888776541   011223899999999999998  5  5678889888777654433333333456657


Q ss_pred             EEecCeEEEeeecCCCCCCCCCccCCCCcccCCCCeeeecCCCCCCcccCceeeeccCCCCCcchhHhhHHHHHHHHHHH
Q 011535          332 DLDCGMVLKSIGYKSVPVNGLPFDNHKGIVPNIRGRVLKNISGDSSQVENGLYVCGWLKRGPTGIIATNLYCAEETVASI  411 (483)
Q Consensus       332 ~i~~D~vi~a~G~~~~~~~~l~~~~~~g~~~~~~G~v~v~~~~~~~t~~p~vya~Gd~~~g~~~~~~~a~~~g~~~a~~I  411 (483)
                      +++||+||+|+|++|+++.++        ..+++|.+.+++.+ +.++.|+|||+|||+++|.++++.|+.+|..+|.+|
T Consensus       312 ~i~~d~vi~a~G~~p~~l~gl--------~~d~~g~i~vn~~~-rvt~~pgvya~GD~~~gp~~~i~~a~~~g~~~a~~i  382 (456)
T 1lqt_A          312 ELPAQLVVRSVGYRGVPTPGL--------PFDDQSGTIPNVGG-RINGSPNEYVVGWIKRGPTGVIGTNKKDAQDTVDTL  382 (456)
T ss_dssp             EEECSEEEECSCEECCCCTTS--------CCBTTTTBCCEETT-EETTCSSEEECTHHHHCSCSCTTHHHHHHHHHHHHH
T ss_pred             EEEcCEEEEccccccCCCCCC--------cccCCCCeeECCCC-cCCCCCCEEEEeccCCCCchhHHHHHHHHHHHHHHH
Confidence            899999999999999875443        34445666666653 336889999999999999987768999999999999


Q ss_pred             HHHHhcCcCCCC-CCCCCCChhhHHHHHhcCCCcccchhhHHhhhHHHHHccccCCCCcccccCHHHHHhhhC
Q 011535          412 SEDLEQGVLASS-SGLPKPGREGLLQLLDNRNVRPVPFSAWEKIDSEEKRLGSLRNKPKEKLTTYEDLLKVAT  483 (483)
Q Consensus       412 ~~~l~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~~~~~~~w~~id~~e~~~g~~~~~~r~k~~~~~~~~~~~~  483 (483)
                      +.++.++.+... .....+.+..+..+|+.+++.+++|.+|++||++|+.+|+..||+|+||++++|||+++.
T Consensus       383 ~~~l~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~w~~id~~e~~~g~~~g~~r~k~~~~~~m~~~~~  455 (456)
T 1lqt_A          383 IKNLGNAKEGAECKSFPEDHADQVADWLAARQPKLVTSAHWQVIDAFERAAGEPHGRPRVKLASLAELLRIGL  455 (456)
T ss_dssp             HHHHHHHHHTTCSCCC--CHHHHHHHHHHHHCTTCEEHHHHHHHHHHHHHHHGGGTSSCCCCCSHHHHHHHHC
T ss_pred             HHHHHhCcccccccCCCCCchHHHHHHHHHcCCCeecHHHHHHHHHHHHHhhhhcCCCceeeCCHHHHHHHhc
Confidence            999987655310 001245778899999999999999999999999999999999999999999999999874
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 483
d1lqta1216 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA 8e-57
d1cjca1225 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitoc 1e-56
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 6e-28
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 1e-13
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 3e-23
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 5e-20
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 4e-09
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 6e-09
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 6e-07
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 5e-06
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 2e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-04
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 5e-04
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 7e-04
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.001
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 0.002
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 0.002
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 0.004
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Ferredoxin:NADP reductase FprA
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  185 bits (471), Expect = 8e-57
 Identities = 89/225 (39%), Positives = 125/225 (55%), Gaps = 9/225 (4%)

Query: 120 DRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILL 179
           DR L IPGEDL G  +A +FV WYN HP  + +SPDL S   AV++G GNVALDVARILL
Sbjct: 1   DRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILL 59

Query: 180 RPTEELATTDIASYAWTALEGSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIRE 239
              + LA TDIA +A  +L    I++V +VGRRGP+QAA T  ELRE+  +  + V I  
Sbjct: 60  TDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDP 119

Query: 240 DDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLGQRELHFVFFRKPDSFLESNE 299
            + +   TDE+     ++ ++  ++L      A  +P  G R + F F   P       +
Sbjct: 120 AE-LDGITDEDAAAVGKVCKQNIKVLRGY---ADREPRPGHRRMVFRFLTSP----IEIK 171

Query: 300 RSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGY 344
               V  +   +  L   G G+  A  TGE E+L   +V++S+GY
Sbjct: 172 GKRKVERIVLGRNELVSDGSGRVAAKDTGEREELPAQLVVRSVGY 216
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query483
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.98
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 99.97
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.93
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.9
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.79
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.68
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.66
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.64
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.62
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.62
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.6
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.58
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.52
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.52
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.51
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.51
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.51
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.49
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.49
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.47
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.45
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 99.38
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.36
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.36
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.35
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.34
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.32
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.32
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.28
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.28
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.28
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.25
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.25
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.24
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.24
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.22
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.22
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.22
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.2
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.18
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.15
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.15
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.14
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.14
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.14
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.14
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.13
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.13
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.12
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.12
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.1
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.1
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.09
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.06
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.05
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.04
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.03
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.01
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.01
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.99
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.99
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.98
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.97
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.94
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.94
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.92
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.92
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.91
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.91
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.88
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.86
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.86
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.85
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.85
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.85
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.82
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.81
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.81
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.8
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.78
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.76
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.74
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.72
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.7
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.69
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.68
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.68
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.66
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.66
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.63
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.61
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.58
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.58
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.57
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.55
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.54
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.52
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.52
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.51
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.48
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.46
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.45
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.45
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.43
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.42
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.42
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.4
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.38
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.37
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.31
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.3
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.27
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.27
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.24
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.24
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.23
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.22
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.21
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.19
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.17
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.12
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.05
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.0
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.96
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.95
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.91
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.91
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.87
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.85
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.66
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.63
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.61
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.59
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.58
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.47
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.4
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.38
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.37
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.26
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.24
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.09
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.08
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.08
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.06
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.96
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 96.95
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.9
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.86
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 96.69
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.67
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.57
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.56
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.53
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.51
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.43
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.36
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.35
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.24
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.22
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 96.22
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.13
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.12
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.01
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.92
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.84
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.82
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.72
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.69
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.63
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.55
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.18
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 95.17
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.09
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.89
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 94.84
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.76
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.69
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.51
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.31
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.28
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.15
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.05
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.93
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.81
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.79
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.78
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.74
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.53
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 93.39
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.28
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.22
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.15
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.14
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 93.09
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.07
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.99
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.89
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.81
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.59
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 92.57
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.52
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.51
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.5
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 92.42
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.41
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.26
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.86
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.85
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.71
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.65
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.62
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.61
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 91.51
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.4
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.19
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.97
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 90.85
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.76
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.48
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.37
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 90.37
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 90.27
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.0
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 89.8
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.78
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.77
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 89.76
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.55
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 89.52
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 89.25
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 89.23
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 89.16
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 88.95
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.89
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 88.68
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 88.65
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.56
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 88.38
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.33
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.0
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.95
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.75
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.62
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.53
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 87.45
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 87.11
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 86.89
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 86.67
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 86.03
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.8
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 85.72
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 85.67
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 85.41
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 85.34
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 85.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 85.23
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.88
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.76
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.74
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.5
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 84.39
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 84.32
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 83.88
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 83.47
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.4
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 83.4
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.36
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 83.35
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.32
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 83.11
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.08
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 82.93
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 82.85
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 82.46
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 82.44
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 82.39
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 82.36
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 82.21
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 81.9
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 81.49
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.42
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 81.39
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 81.33
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.25
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 81.04
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 81.01
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 80.89
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 80.88
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 80.7
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 80.35
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 80.23
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 80.22
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.19
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.09
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Ferredoxin:NADP reductase FprA
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.98  E-value=7.1e-32  Score=246.90  Aligned_cols=216  Identities=40%  Similarity=0.625  Sum_probs=187.0

Q ss_pred             CCCCCCCCCCCCCeeecceeeeeecCCCCCCCCCCCCCCCCeEEEEcCCchHHHHHHHHhcCCccccccccchHHHHHHh
Q 011535          120 DRALGIPGEDLIGVHSAREFVWWYNGHPDGKNLSPDLKSTDTAVILGQGNVALDVARILLRPTEELATTDIASYAWTALE  199 (483)
Q Consensus       120 ~~~~~ipg~~~~~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~vvVIG~G~~g~e~A~~L~~~~~~l~~~di~~~~~~~l~  199 (483)
                      ++.++|||.+++||++|.+|+.|||++|++....+++ .+++|+|||+||+|+|||+.|++++++|..|||++++++.+.
T Consensus         1 dR~L~IPGedl~gV~~A~dfl~~~N~~p~~~~~~~~~-~gk~VvVIGgGNvAlD~AR~ll~~~~~l~~tdi~~~~l~~l~   79 (216)
T d1lqta1           1 DRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPDL-SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLR   79 (216)
T ss_dssp             ECCCCCTTTTSTTEEEHHHHHHHHTTCGGGTTCCCCC-CSSEEEEECCSHHHHHHHHHHHSCHHHHTTSCCCHHHHHHHT
T ss_pred             CCCCCCCCCCCCCcEeHHHHHHHHhCCccccccCccc-cCceEEEECCCchhHhhhhhhccCHhhhccCCCcHHHHHHHh
Confidence            3678999999999999999999999999988777777 689999999999999999999999999999999999999999


Q ss_pred             cCCccEEEEEeecCcccccCCHHHHHHHhcCCCeeEEeccccccCCCCcHHHhhccHHHHHHHHHHHHHHHhcCCCCCCC
Q 011535          200 GSSIRKVYLVGRRGPVQAACTAKELREILGIKNLYVHIREDDLIKSPTDEEEMKNSRIQRRVYELLSKAAASASSQPMLG  279 (483)
Q Consensus       200 ~~~~~~V~li~r~~~~~~~f~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~~~~~~~~~~~~~~  279 (483)
                      .+++++|++++||++.+++||.+|+||+.+++++.+.+++.++........ ....+..++..+.+.++...   .....
T Consensus        80 r~~~~~V~iv~RRg~~~~~ft~~Elre~~~l~~~~~~~~~~~~~~~~~e~~-~~~~~~~~~~~~~~~~~~~~---~~~~~  155 (216)
T d1lqta1          80 PRGIQEVVIVGRRGPLQAAFTTLELRELADLDGVDVVIDPAELDGITDEDA-AAVGKVCKQNIKVLRGYADR---EPRPG  155 (216)
T ss_dssp             TCCCCEEEEECSSCGGGCCCCHHHHHHGGGCTTEEEECCGGGGTTCCHHHH-HHHCHHHHHHHHHHHHHHTC---C-CTT
T ss_pred             hcCCceEEEEEECChHhCCCChhhhhhhcccCCCCccCCHHHccchhhhhh-hhhccchhHHHHHHHHhhhh---ccccC
Confidence            999999999999999999999999999999999999999887654433222 22355666677777766542   34556


Q ss_pred             cceEEEeecCCcceeecccCCCCceEEEEEeeeeeeCCCCCceeeccCCceEEEecCeEEEeeec
Q 011535          280 QRELHFVFFRKPDSFLESNERSGHVSGVHFEKTALKGGGPGKQYAVGTGEFEDLDCGMVLKSIGY  344 (483)
Q Consensus       280 ~~~i~~~~~~~~~~v~~~~~~~g~v~~v~~~~~~l~~~~~g~~~~~~~g~~~~i~~D~vi~a~G~  344 (483)
                      .+.+.++|...+.++.  +  ++++.++++..+++..+++|+..++++|+..+|+||+||.|+||
T Consensus       156 ~~~~~~~~~~~~~~~~--~--~~~v~~l~~~~~~~~~d~~g~~~~~~~g~~~~i~~dlvi~AIGy  216 (216)
T d1lqta1         156 HRRMVFRFLTSPIEIK--G--KRKVERIVLGRNELVSDGSGRVAAKDTGEREELPAQLVVRSVGY  216 (216)
T ss_dssp             SEEEEEECSEEEEEEE--C--SSSCCEEEEEEEEEEECSSSSEEEEEEEEEEEEECSEEEECSCE
T ss_pred             cceeeeeecccccccc--c--cCceeEEEEEEEEEeeCCCCCeeeecCCcEEEEECCEEEECCCC
Confidence            7789999999988887  4  88999999999999888888877777888889999999999997
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure