Citrus Sinensis ID: 011558
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| 359487759 | 482 | PREDICTED: sucrose nonfermenting 4-like | 0.989 | 0.991 | 0.759 | 0.0 | |
| 225450904 | 488 | PREDICTED: sucrose nonfermenting 4-like | 0.987 | 0.977 | 0.746 | 0.0 | |
| 18390971 | 487 | sucrose nonfermenting 4-like protein [Ar | 0.991 | 0.983 | 0.729 | 0.0 | |
| 297849192 | 479 | hypothetical protein ARALYDRAFT_470981 [ | 0.985 | 0.993 | 0.732 | 0.0 | |
| 255542654 | 540 | AMP-activated protein kinase, gamma regu | 0.962 | 0.861 | 0.741 | 0.0 | |
| 312281727 | 487 | unnamed protein product [Thellungiella h | 0.991 | 0.983 | 0.716 | 0.0 | |
| 224123752 | 475 | predicted protein [Populus trichocarpa] | 0.981 | 0.997 | 0.704 | 0.0 | |
| 224123152 | 488 | predicted protein [Populus trichocarpa] | 0.977 | 0.967 | 0.684 | 0.0 | |
| 356556126 | 491 | PREDICTED: sucrose nonfermenting 4-like | 0.991 | 0.975 | 0.657 | 0.0 | |
| 356573006 | 478 | PREDICTED: sucrose nonfermenting 4-like | 0.983 | 0.993 | 0.684 | 0.0 |
| >gi|359487759|ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi|296088362|emb|CBI36807.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 742 bits (1915), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 369/486 (75%), Positives = 417/486 (85%), Gaps = 8/486 (1%)
Query: 1 MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ 60
M+ SG +GHENS + G++L+P RF+WP GGRRV LSGSFTRWSE +PMSP EGCP VFQ
Sbjct: 1 MFVSGAESGHENSAIPGTVLIPTRFVWPYGGRRVLLSGSFTRWSEHIPMSPIEGCPTVFQ 60
Query: 61 IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSG- 119
+I L PG+HQYKF+VDGEWRHDE+QP VSGNYGVVN +++ +PD+VP SP+T G
Sbjct: 61 VIWSLAPGYHQYKFFVDGEWRHDEHQPFVSGNYGVVNTIFLPR-EPDVVPAVFSPDTPGG 119
Query: 120 -NMEVD-DVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVK 177
NM++D D R E + SEADL++SR R+S FLSTH YELLP+SGKV ALDVNL VK
Sbjct: 120 SNMDLDNDPFPRGEVIPRISEADLEVSRHRVSEFLSTHIAYELLPESGKVIALDVNLPVK 179
Query: 178 QAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAW 237
QAFH LYEQG+P+ PLWD KG+FVGVLSALDFILILRELG +GSNLTEEELETHTISAW
Sbjct: 180 QAFHTLYEQGIPVAPLWDFCKGQFVGVLSALDFILILRELGNHGSNLTEEELETHTISAW 239
Query: 238 KVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSC 297
K GKL L RQ+DG+GR CPR LV AGPYDSLK+V LKILQNKVATVPIIHS GS
Sbjct: 240 KEGKLHL---RQIDGSGRLCPRHLVHAGPYDSLKDVTLKILQNKVATVPIIHSASQDGSF 296
Query: 298 QEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPT 357
++L+LASLS ILKCICRHF+HSSSSLPILQQP+ SI +GTWVP+IGE+NG+PFAMLRP
Sbjct: 297 PQLLHLASLSGILKCICRHFRHSSSSLPILQQPICSIPVGTWVPKIGESNGQPFAMLRPN 356
Query: 358 ASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQ 417
ASLG+AL+LLVQA+VSSIPIVDDNDSLLDIYSRSDITALAKD+AYAQIHLD M+IHQALQ
Sbjct: 357 ASLGAALSLLVQAEVSSIPIVDDNDSLLDIYSRSDITALAKDRAYAQIHLDNMSIHQALQ 416
Query: 418 LGQDANPSLGF-NGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDV 476
LGQDAN GF +GQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEG+ISLSDV
Sbjct: 417 LGQDANSPYGFISGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGVISLSDV 476
Query: 477 FRFLLG 482
FRFLLG
Sbjct: 477 FRFLLG 482
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225450904|ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18390971|ref|NP_563834.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] gi|75249553|sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; AltName: Full=CBS domain-containing protein CBSCBS3; AltName: Full=SNF1-related protein kinase regulatory subunit betagamma; Short=AKIN subunit betagamma; Short=AKINbetagamma gi|16612255|gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana] gi|23308443|gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana] gi|75037070|gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana] gi|332190262|gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297849192|ref|XP_002892477.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] gi|297338319|gb|EFH68736.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255542654|ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223548351|gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|312281727|dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|224123752|ref|XP_002330199.1| predicted protein [Populus trichocarpa] gi|222871655|gb|EEF08786.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224123152|ref|XP_002319007.1| predicted protein [Populus trichocarpa] gi|222857383|gb|EEE94930.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356556126|ref|XP_003546378.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356573006|ref|XP_003554656.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| TAIR|locus:2036079 | 487 | SNF4 "homolog of yeast sucrose | 0.991 | 0.983 | 0.731 | 1.7e-187 | |
| RGD|727782 | 326 | Prkag2 "protein kinase, AMP-ac | 0.405 | 0.601 | 0.285 | 1.4e-29 | |
| ZFIN|ZDB-GENE-060421-6938 | 342 | zgc:136850 "zgc:136850" [Danio | 0.337 | 0.476 | 0.327 | 3.2e-28 | |
| UNIPROTKB|F1LLY5 | 528 | Prkag2 "Protein Prkag2" [Rattu | 0.405 | 0.371 | 0.285 | 4.3e-28 | |
| UNIPROTKB|F1NXL4 | 565 | PRKAG2 "Uncharacterized protei | 0.403 | 0.345 | 0.284 | 4.9e-28 | |
| MGI|MGI:1336153 | 566 | Prkag2 "protein kinase, AMP-ac | 0.405 | 0.346 | 0.285 | 8.5e-28 | |
| UNIPROTKB|Q9UGJ0 | 569 | PRKAG2 "5'-AMP-activated prote | 0.405 | 0.344 | 0.285 | 2.5e-27 | |
| DICTYBASE|DDB_G0272542 | 577 | prkag "AMP-activated protein k | 0.341 | 0.285 | 0.311 | 1e-25 | |
| UNIPROTKB|F1P1P1 | 382 | PRKAG3 "Uncharacterized protei | 0.405 | 0.513 | 0.258 | 3.9e-24 | |
| CGD|CAL0001497 | 336 | SNF4 [Candida albicans (taxid: | 0.395 | 0.568 | 0.262 | 3.5e-18 |
| TAIR|locus:2036079 SNF4 "homolog of yeast sucrose nonfermenting 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1818 (645.0 bits), Expect = 1.7e-187, P = 1.7e-187
Identities = 359/491 (73%), Positives = 408/491 (83%)
Query: 1 MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQ 60
M+ S L++ NS G +L P RF+WP GGRRV LSGSFTRW+E +PMSP EGCP VFQ
Sbjct: 1 MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ 60
Query: 61 IICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSG- 119
+IC L PG+HQYKF+VDGEWRHDE+QP VSGN GVVN ++I PDMVP SPET G
Sbjct: 61 VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFIT--GPDMVPAGFSPETLGR 118
Query: 120 -NMEVDDVVMR---P--EGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVN 173
NM+VDDV +R P E + S DL+LSR RIS LST T YELLP+SGKV ALDVN
Sbjct: 119 SNMDVDDVFLRTADPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVN 178
Query: 174 LAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHT 233
L VKQAFH+LYEQG+P+ PLWD KG+FVGVL LDFILILRELGT+GSNLTEEELETHT
Sbjct: 179 LPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHT 238
Query: 234 ISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGP 293
I+AWK GK ++ RQ DG+GRP PRPLVQ GPYD+LK+VALKILQNKVA VP+I+S+
Sbjct: 239 IAAWKEGKAHIS--RQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQ 296
Query: 294 AGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAM 353
GS ++L+LASLS ILKCICR+F+HSSSSLPILQQP+ SI LGTWVPRIGE++ +P A
Sbjct: 297 DGSYPQLLHLASLSGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLAT 356
Query: 354 LRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIH 413
LRP ASLGSALALLVQA+VSSIP+VDDNDSL+DIYSRSDITALAKDKAYAQIHLD+M +H
Sbjct: 357 LRPHASLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVH 416
Query: 414 QALQLGQDANPSLG-FNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIIS 472
QALQLGQDA+P G FNGQRC MCLRSD L KVMERLANPGVRRLVIVEAGSKRVEGIIS
Sbjct: 417 QALQLGQDASPPYGIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIIS 476
Query: 473 LSDVFRFLLGV 483
LSDVF+FLLG+
Sbjct: 477 LSDVFQFLLGL 487
|
|
| RGD|727782 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060421-6938 zgc:136850 "zgc:136850" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LLY5 Prkag2 "Protein Prkag2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXL4 PRKAG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336153 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UGJ0 PRKAG2 "5'-AMP-activated protein kinase subunit gamma-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272542 prkag "AMP-activated protein kinase gamma subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1P1 PRKAG3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001497 SNF4 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after | 7e-37 | |
| cd02859 | 80 | cd02859, E_set_AMPKbeta_like_N, N-terminal Early s | 2e-27 | |
| cd04618 | 98 | cd04618, CBS_pair_5, The CBS domain, named after h | 3e-20 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 5e-11 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 1e-07 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 3e-07 | |
| cd07184 | 86 | cd07184, E_set_Isoamylase_like_N, N-terminal Early | 3e-07 | |
| cd02688 | 82 | cd02688, E_set, Early set domain associated with t | 9e-07 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 9e-06 | |
| cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c | 1e-05 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 1e-05 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 1e-05 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-05 | |
| cd04593 | 115 | cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con | 4e-05 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 5e-05 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 9e-05 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 2e-04 | |
| cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after | 5e-04 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 6e-04 | |
| cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tand | 8e-04 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 0.001 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 0.001 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 0.002 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 0.002 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 0.003 | |
| cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after | 0.004 | |
| cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after h | 0.004 |
| >gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Score = 131 bits (332), Expect = 7e-37
Identities = 52/134 (38%), Positives = 72/134 (53%), Gaps = 17/134 (12%)
Query: 349 RPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLD 408
+ A RP L L +LV+ VS++PIVD+N ++D+YSR D+ LAK+ AY + L
Sbjct: 1 KNIATARPDTPLIDVLDMLVERRVSALPIVDENGKVVDVYSRFDVINLAKEGAYNNLDLT 60
Query: 409 EMNIHQALQLGQDANPSLGFNG-QRCQ--MCLRSDPLHKVMERLANPGVRRLVIVEAGSK 465
+AL+ F G + C CLR+ V R V RLV+V+ K
Sbjct: 61 VG---EALERRSQ-----DFEGVRTCSPDDCLRTIFDLIVKAR-----VHRLVVVDEN-K 106
Query: 466 RVEGIISLSDVFRF 479
RVEGIISLSD+ +F
Sbjct: 107 RVEGIISLSDILQF 120
|
CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 120 |
| >gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 100.0 | |
| cd02859 | 79 | AMPKbeta_GBD_like AMP-activated protein kinase (AM | 99.92 | |
| cd02861 | 82 | E_set_proteins_like E or "early" set-like proteins | 99.78 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.74 | |
| KOG1616 | 289 | consensus Protein involved in Snf1 protein kinase | 99.68 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.63 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.62 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.62 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.61 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.59 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.55 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.55 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.55 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.51 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.51 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.51 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.51 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.5 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.49 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.49 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.48 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.48 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.47 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.46 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.46 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.46 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.46 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.45 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.45 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.44 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.44 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.44 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.44 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.44 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.44 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.43 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.43 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.43 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.43 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.43 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.43 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.43 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.43 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.43 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.42 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.42 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.42 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.42 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.41 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.41 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.41 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.41 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.4 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.4 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.4 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.4 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.4 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.4 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.4 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.4 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.4 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.39 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.39 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.39 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.39 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.39 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.39 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.38 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.38 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.38 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.38 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.38 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.37 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.36 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.36 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.35 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.35 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.35 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.35 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.35 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.35 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.34 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.33 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.33 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 99.32 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.32 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.32 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.32 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.32 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.31 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.31 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.31 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.31 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.31 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.3 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.3 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.3 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.3 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.3 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.3 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.29 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.29 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.29 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.29 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.28 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.28 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.28 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.27 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.27 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.27 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.27 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.27 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.27 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.27 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.25 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.25 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.25 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.25 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.25 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.25 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.24 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.24 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.24 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.24 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.23 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.23 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.23 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.23 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 99.23 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.23 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.22 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.22 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.22 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.22 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.22 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.21 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.21 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.21 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.21 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.2 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.2 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.2 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.2 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.2 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.18 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.18 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.18 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.18 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.18 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.18 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.17 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.17 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.17 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.16 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.16 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.16 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.14 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.14 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.14 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.13 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.13 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.13 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.12 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.12 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.11 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.11 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.1 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.1 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.1 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.09 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.08 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.07 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.05 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.03 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.01 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.0 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.97 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 98.96 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.92 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.92 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.9 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 98.89 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.88 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.87 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.86 | |
| cd02688 | 83 | E_set E or "early" set of sugar utilizing enzymes | 98.74 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.65 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.65 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.64 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.59 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 98.58 | |
| cd02854 | 99 | Glycogen_branching_enzyme_like_N_term Glycogen bra | 98.52 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.47 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.43 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.41 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.4 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.33 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.27 | |
| PF02922 | 85 | CBM_48: Carbohydrate-binding module 48 (Isoamylase | 98.24 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.13 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.94 | |
| cd05808 | 95 | CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 | 97.89 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.82 | |
| PF00686 | 96 | CBM_20: Starch binding domain; InterPro: IPR002044 | 97.77 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.74 | |
| cd02860 | 100 | Pullulanase_N_term Pullulanase domain N-terminus. | 97.74 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 97.71 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.58 | |
| cd05818 | 92 | CBM20_water_dikinase Phosphoglucan water dikinase | 97.55 | |
| cd05820 | 103 | CBM20_novamyl Novamyl (also known as acarviose tra | 97.53 | |
| cd05809 | 99 | CBM20_beta_amylase Beta-amylase, C-terminal CBM20 | 97.47 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.46 | |
| cd02855 | 106 | Glycogen_branching_enzyme_N_term Glycogen branchin | 97.46 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.46 | |
| cd05814 | 120 | CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- | 97.38 | |
| cd02856 | 103 | Glycogen_debranching_enzyme_N_term Glycogen_debran | 97.36 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 97.18 | |
| cd05811 | 106 | CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g | 97.12 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.11 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.0 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 96.97 | |
| cd05807 | 101 | CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat | 96.95 | |
| cd05813 | 95 | CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 | 96.94 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 96.83 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 96.76 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 96.74 | |
| cd02852 | 119 | Isoamylase_N_term Isoamylase N-terminus domain. Is | 96.74 | |
| cd05816 | 99 | CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP | 96.73 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.71 | |
| cd05817 | 100 | CBM20_DSP Dual-specificity phosphatase (DSP), N-te | 96.68 | |
| cd05810 | 97 | CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol | 96.62 | |
| cd05467 | 96 | CBM20 The family 20 carbohydrate-binding module (C | 96.59 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.53 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.48 | |
| cd02853 | 85 | MTHase_N_term Maltooligosyl trehalose synthase (MT | 96.41 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.25 | |
| cd05806 | 112 | CBM20_laforin Laforin protein tyrosine phosphatase | 96.04 | |
| PF03423 | 87 | CBM_25: Carbohydrate binding domain (family 25); I | 95.86 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 95.76 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 95.4 | |
| cd05815 | 101 | CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP | 95.03 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 94.15 | |
| PLN02316 | 1036 | synthase/transferase | 94.05 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 93.74 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 93.72 | |
| PF11806 | 122 | DUF3327: Domain of unknown function (DUF3327); Int | 93.39 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 93.08 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 92.83 | |
| PLN02316 | 1036 | synthase/transferase | 92.68 | |
| PLN02960 | 897 | alpha-amylase | 89.91 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 89.32 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 89.0 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 87.59 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 87.04 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 86.99 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 86.27 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 82.73 | |
| cd02857 | 116 | CD_pullulan_degrading_enzymes_N_term CD and pullul | 82.36 | |
| PF01357 | 82 | Pollen_allerg_1: Pollen allergen; InterPro: IPR007 | 80.04 |
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-35 Score=297.38 Aligned_cols=303 Identities=30% Similarity=0.543 Sum_probs=257.9
Q ss_pred HHHHHHHhhccccccccCCCCccEEEEccCcCHHHHHHHHHHcCCCeeeceeCCCCceeEEeeHHHHHHHHHHhccCCCC
Q 011558 144 SRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSN 223 (483)
Q Consensus 144 ~~~~~~~fl~~~~~~d~~p~s~kvi~l~~~~~v~~A~~~l~e~~i~s~PV~d~~~~~~vGilt~~D~i~il~~~~~~~~~ 223 (483)
....+..|++.++||+.+|.+++++++|..+++++||++|..++.+++|+||....+|+|++++.||+.++...+.....
T Consensus 55 ~~~~~~~~~~~~~~~~~~p~~~~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~~~~~~g~~~~~d~i~~~~~~~~~~~~ 134 (381)
T KOG1764|consen 55 AVDTLSKFMKSHTCYDLLPTSSKLVVFDTKLSVKKAFNALVQNGVRAAPLWDSKKQQFVGMLTITDFITVLLRYYKSKSS 134 (381)
T ss_pred hhHHHHHHHhccCcccccCCcceeEEeeCCCcHHHHHHHHHhhceeeeccccCccceeEEEEEHHHHHHHHHHhhccCCc
Confidence 45689999999999999999999999999999999999999999999999999999999999999999998887764211
Q ss_pred C-CHHHHhhccHHHHHHHHhhhhccccCCCCCCCCCCCeEEeCCCCCHHHHHHHHHhCCCceeEEEecCCCCCCcceEEE
Q 011558 224 L-TEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILY 302 (483)
Q Consensus 224 l-~~~~l~~~~i~~~~~~~~~~~~~~~~d~~g~~~~~~~v~v~~~~sl~~a~~~m~~~~~~~ipVvd~d~~~g~~~~l~G 302 (483)
. ..+.++...+..|++...... ....++++.+.|..++.+++..+.+++++++||.| .+.+ ++.+
T Consensus 135 ~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d--~~~~---~v~~ 200 (381)
T KOG1764|consen 135 LDNIEVLEDSQLSKRREVECLLK---------ETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVID--PETG---EVLY 200 (381)
T ss_pred HHHHhhhhhhhccccchhhhhhc---------cccCCCceeecCcHHHHHHHHHHHhCCccceeeec--cccc---ceee
Confidence 1 123344444555554422211 12345559999999999999999999999999995 4566 8999
Q ss_pred EechhhHHHHHHhhccCCCCCCcccccccccccccccccccccccCCCeeEecCCCCHHHHHHHHHhCCCCEEEEEcCCC
Q 011558 303 LASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDND 382 (483)
Q Consensus 303 iit~~dIl~~l~~~~~~~~~~~~~~~~~v~~l~i~~~~~~v~~~m~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g 382 (483)
++|++.|++++..+.+..+ +..++..++.++.+|+|. .+..+..++++.+|+++|..++++++||||++|
T Consensus 201 ilt~~rIl~~l~~~~~~~~-~~~~l~~s~~dl~ig~~~---------~i~~i~~~~~v~~al~~m~~~~is~lpvV~~~g 270 (381)
T KOG1764|consen 201 ILTQRRILKFLWLNGRLLP-LPSLLSKSLSDLGIGTWS---------NIASISEDTPVIEALKIMSERRISALPVVDENG 270 (381)
T ss_pred ehhHHHHHHHHHHhhcccc-cHHHhhCCHHHhCcchhh---------hheeecCCCcHHHHHHHHHhcCcCcceEEcCCC
Confidence 9999999999988776654 467789999999999996 688999999999999999999999999999999
Q ss_pred cEEEEEeHHHHHHHHhcccccccccCCcc-HHHHHhcCCCCCCCcccCCCcceEEeCCCCHHHHHHHHHcCCCCEEEEEe
Q 011558 383 SLLDIYSRSDITALAKDKAYAQIHLDEMN-IHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVE 461 (483)
Q Consensus 383 ~lvGiit~~di~~l~~~~~~~~~~l~~~~-v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tl~~~~~~m~~~~~~~l~VVd 461 (483)
..+|+++..|+..+...+.|.... .+ +.+++.... .-..++++|.+++||.+++++|..+++||+||||
T Consensus 271 ~~v~~~s~~Dv~~l~~~~~~~~~~---~~~l~~~~~~~~-------~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd 340 (381)
T KOG1764|consen 271 KKVGNYSRFDVIHLAREGTYNNLD---LSCLSEALSHRP-------IRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVD 340 (381)
T ss_pred ceecceehhhhhhhhhcCccCccc---hhHHHHHhhhcc-------cccCccEEEeecchHHHHHHHHHhcCceEEEEEc
Confidence 999999999999999888877653 45 777765533 2234689999999999999999999999999999
Q ss_pred CCCCeEEEEEehHHHHHHHh
Q 011558 462 AGSKRVEGIISLSDVFRFLL 481 (483)
Q Consensus 462 ~~~~~l~GiIs~~DIl~~l~ 481 (483)
++|+++|+||++||+.++.
T Consensus 341 -~~~~l~GvvSLsDil~~l~ 359 (381)
T KOG1764|consen 341 -EDGVLVGVISLSDILSYLV 359 (381)
T ss_pred -CCCcEEEEeeHHHHHHHHH
Confidence 5899999999999999985
|
|
| >cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) | Back alignment and domain information |
|---|
| >cd02861 E_set_proteins_like E or "early" set-like proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd02860 Pullulanase_N_term Pullulanase domain N-terminus | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02852 Isoamylase_N_term Isoamylase N-terminus domain | Back alignment and domain information |
|---|
| >cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain | Back alignment and domain information |
|---|
| >PF01357 Pollen_allerg_1: Pollen allergen; InterPro: IPR007117 Expansins are unusual proteins that mediate cell wall extension in plants [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 483 | ||||
| 2v8q_E | 330 | Crystal Structure Of The Regulatory Fragment Of Mam | 9e-34 | ||
| 2oox_G | 333 | Crystal Structure Of The Adenylate Sensor From Amp- | 8e-24 | ||
| 2qr1_G | 334 | Crystal Structure Of The Adenylate Sensor From Amp- | 9e-24 | ||
| 3t4n_C | 323 | Structure Of The Regulatory Fragment Of Saccharomyc | 6e-23 | ||
| 2qlv_C | 315 | Crystal Structure Of The Heterotrimer Core Of The S | 8e-23 | ||
| 1z0m_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 2e-14 | ||
| 1z0n_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 5e-14 | ||
| 2f15_A | 96 | Glycogen-Binding Domain Of The Amp-Activated Protei | 4e-13 | ||
| 2uv5_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 6e-13 | ||
| 2uv6_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 2e-12 | ||
| 2uv7_A | 152 | Crystal Structure Of A Cbs Domain Pair From The Reg | 6e-12 | ||
| 2qlv_B | 252 | Crystal Structure Of The Heterotrimer Core Of The S | 9e-11 | ||
| 2nyc_A | 144 | Crystal Structure Of The Bateman2 Domain Of Yeast S | 2e-08 | ||
| 2nye_A | 144 | Crystal Structure Of The Bateman2 Domain Of Yeast S | 3e-07 | ||
| 3nme_A | 294 | Structure Of A Plant Phosphatase Length = 294 | 2e-06 | ||
| 3fhm_A | 165 | Crystal Structure Of The Cbs-Domain Containing Prot | 7e-04 |
| >pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330 | Back alignment and structure |
|
| >pdb|2OOX|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-activated Protein Kinase Complexed With Amp Length = 333 | Back alignment and structure |
| >pdb|2QR1|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-Activated Protein Kinase In Complex With Adp Length = 334 | Back alignment and structure |
| >pdb|3T4N|C Chain C, Structure Of The Regulatory Fragment Of Saccharomyces Cerevisiae Ampk In Complex With Adp Length = 323 | Back alignment and structure |
| >pdb|2QLV|C Chain C, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 315 | Back alignment and structure |
| >pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 | Back alignment and structure |
| >pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 | Back alignment and structure |
| >pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 | Back alignment and structure |
| >pdb|2QLV|B Chain B, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 252 | Back alignment and structure |
| >pdb|2NYC|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 | Back alignment and structure |
| >pdb|2NYE|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 | Back alignment and structure |
| >pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 | Back alignment and structure |
| >pdb|3FHM|A Chain A, Crystal Structure Of The Cbs-Domain Containing Protein Atu1752 From Agrobacterium Tumefaciens Length = 165 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 4e-73 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 3e-65 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 7e-65 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 2e-35 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 8e-06 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 5e-31 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-05 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 2e-04 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 2e-29 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-27 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 7e-07 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 7e-26 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 4e-25 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-20 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 8e-12 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 1e-11 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 2e-10 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 5e-10 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 2e-05 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 7e-10 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 8e-10 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 9e-10 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 4e-04 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 1e-09 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-09 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 2e-09 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 1e-08 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 2e-08 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 3e-08 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 4e-05 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 1e-07 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 1e-07 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 2e-07 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 2e-07 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 4e-05 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 3e-07 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 1e-06 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 2e-06 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 4e-06 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 8e-06 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 1e-05 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 4e-05 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 1e-04 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 2e-05 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 2e-04 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 4e-05 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 6e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 9e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-04 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 5e-04 |
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
Score = 233 bits (595), Expect = 4e-73
Identities = 73/345 (21%), Positives = 155/345 (44%), Gaps = 36/345 (10%)
Query: 138 EADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDF 197
+ + + I +F+ + T Y++LP S ++ DV L VK + +L + PLWD
Sbjct: 5 QETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSE 64
Query: 198 KGRFVGVLSALDFILILRELGTNGSNLTE-EELETHTISAWKVGKLQLNLKRQMDGNGRP 256
+F G+L+ DF+ +++ + S E++ + + + ++
Sbjct: 65 ANKFAGLLTMADFVNVIKYYYQSSSFPEAIAEIDKFRLLGLREVERKIGAI--------- 115
Query: 257 CPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRH 316
P + P SL + L + +++ +P+I G GS + I+ + + ILK I +
Sbjct: 116 -PPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGETGS-EMIVSVLTQYRILKFISMN 173
Query: 317 FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP 376
K +L+ P++ + +GTW + + +L + ++S++P
Sbjct: 174 CKE----TAMLRVPLNQMTIGTWSNLA---------TASMETKVYDVIKMLAEKNISAVP 220
Query: 377 IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMC 436
IV+ +LL++Y D+ L +D Y+ + L ++ +AL C
Sbjct: 221 IVNSEGTLLNVYESVDVMHLIQDGDYSNLDL---SVGEALLKRPANFD-------GVHTC 270
Query: 437 LRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLL 481
+D L + + + + V RL +V+ + ++EGI+SL+D+ +++
Sbjct: 271 RATDRLDGIFDAIKHSRVHRLFVVDE-NLKLEGILSLADILNYII 314
|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 100.0 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 100.0 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 100.0 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.98 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.97 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.96 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 99.91 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 99.9 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.9 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.88 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.87 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.85 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.84 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.82 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.82 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.8 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.76 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.76 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.76 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.75 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.75 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.74 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.73 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.73 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.73 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.73 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.72 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.72 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.72 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.71 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.71 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.71 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.71 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.71 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.7 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.7 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.7 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.7 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.7 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.7 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.7 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.69 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.69 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.68 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.68 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.68 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.68 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.67 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.67 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.67 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.66 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.66 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.65 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.65 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.64 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.63 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.63 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.63 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.62 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.62 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.6 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.59 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.59 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.58 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.57 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.57 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.56 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.56 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.56 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.55 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.55 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.55 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.55 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.54 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.54 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.53 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.53 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.53 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.53 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.52 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.52 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.52 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.52 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.52 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.51 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.51 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.51 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.5 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.5 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.5 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.5 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.5 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.5 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.5 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.49 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.48 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.47 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.47 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.46 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.46 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.45 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.44 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.44 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.44 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.43 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.42 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.42 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.4 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.39 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.33 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.29 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.27 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.26 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.26 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.25 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.24 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.2 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.16 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.15 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.11 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.11 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.08 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.06 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.05 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.03 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.03 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.01 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.84 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.78 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.75 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.75 | |
| 2z0b_A | 131 | GDE5, KIAA1434, putative glycerophosphodiester pho | 98.53 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.51 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.48 | |
| 1ac0_A | 108 | Glucoamylase; hydrolase, starch binding domain; HE | 97.94 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 97.87 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 97.32 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 97.06 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 96.99 | |
| 2laa_A | 104 | Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa | 96.45 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 96.41 | |
| 2vn4_A | 599 | Glucoamylase; hydrolase, carbohydrate binding, gly | 96.05 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 95.78 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 95.72 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 95.48 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 95.41 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 95.37 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 95.17 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 95.09 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 95.04 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 94.89 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 94.78 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 94.48 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 93.14 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 92.89 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 92.73 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 92.19 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 92.04 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 91.98 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 91.77 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 90.29 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 90.21 | |
| 4fch_A | 221 | Outer membrane protein SUSE; starch binding, extra | 89.82 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 89.58 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 88.64 | |
| 2c3v_A | 102 | Alpha-amylase G-6; carbohydrate-binding module, st | 86.96 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 84.32 |
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-40 Score=327.12 Aligned_cols=307 Identities=25% Similarity=0.449 Sum_probs=245.2
Q ss_pred HHHHHHHHHHHHhhccccccccCCCCccEEEEccCcCHHHHHHHHHHcCCCeeeceeCCCCceeEEeeHHHHHHHHHHhc
Q 011558 139 ADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELG 218 (483)
Q Consensus 139 ~~~~~~~~~~~~fl~~~~~~d~~p~s~kvi~l~~~~~v~~A~~~l~e~~i~s~PV~d~~~~~~vGilt~~D~i~il~~~~ 218 (483)
.+.....+++.+||+.++|||+||.+.++++++.+.|+.+|++.|.+++++++||||++.++++|++|..|++.++.+++
T Consensus 14 ~~~~~~~~~i~~~l~~~~~~d~m~~~~~~v~v~~~~sv~~a~~~m~~~~~~~~pV~d~~~~~lvGilt~~Dl~~~l~~~~ 93 (323)
T 3t4n_C 14 IEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYF 93 (323)
T ss_dssp HHHHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHHHHHHHTTCSCEEEEETTTTEEEEEECHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhCchHhhCCCCCcEEEEcCCCcHHHHHHHHHHcCCceEEEEeCCCCeEEEEEEHHHHHHHHHHHH
Confidence 44466789999999999999999999999999999999999999999999999999988888999999999999887665
Q ss_pred cCCCCCCHHHHhhccHHHHHHHHhhhhccccCCCCCCCCCCCeEEeCCCCCHHHHHHHHHhCCCceeEEEecCCCCCCcc
Q 011558 219 TNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQ 298 (483)
Q Consensus 219 ~~~~~l~~~~l~~~~i~~~~~~~~~~~~~~~~d~~g~~~~~~~v~v~~~~sl~~a~~~m~~~~~~~ipVvd~d~~~g~~~ 298 (483)
..+.. .+.++.+....+++.....+ .+.++++++.+++++.+|++.|.+++++++||++++...+ ..
T Consensus 94 ~~~~~--~~~l~~~~~~~v~~i~~~~~----------~~~~~~v~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~~-~~ 160 (323)
T 3t4n_C 94 SNPDK--FELVDKLQLDGLKDIERALG----------VDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETH-RE 160 (323)
T ss_dssp HCGGG--GGGGGGCBHHHHHHHHHHTT----------C----CCCBCTTSBHHHHHHHHHHHTCSEEEEEEECTTTC-CE
T ss_pred cCcch--hHHHHHHHHHHHHHHHHHhC----------CCCCCceEeCCCCcHHHHHHHHHhCCeeEEEEEecCCCCC-cc
Confidence 43322 23555666666766554332 4678899999999999999999999999999997632222 11
Q ss_pred eEEEEechhhHHHHHHhhccCCCCCCcccccccccccccccccccccccCCCeeEecCCCCHHHHHHHHHhCCCCEEEEE
Q 011558 299 EILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIV 378 (483)
Q Consensus 299 ~l~Giit~~dIl~~l~~~~~~~~~~~~~~~~~v~~l~i~~~~~~v~~~m~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVv 378 (483)
+++|++|.+||++++..+... ......+++++.++ |.+++.++.+++++.+|+++|.+++++++||+
T Consensus 161 ~l~Givt~~di~~~l~~~~~~----~~~~~~~v~~~~~~---------m~~~~~~v~~~~~~~~~~~~m~~~~~~~~pVv 227 (323)
T 3t4n_C 161 IVVSVLTQYRILKFVALNCRE----THFLKIPIGDLNII---------TQDNMKSCQMTTPVIDVIQMLTQGRVSSVPII 227 (323)
T ss_dssp EEEEEEEHHHHHHHHHHHCGG----GGGCCSBGGGTTCS---------BCTTCCCBCTTSBHHHHHHHHHHHTCSEEEEE
T ss_pred ceEEEecHHHHHHHHHhcCCc----hhhhhCcHHHcCCC---------CCCCcEEECCCCcHHHHHHHHHHcCCCEEEEE
Confidence 399999999999998765432 12223344433211 67789999999999999999999999999999
Q ss_pred cCCCcEEEEEeHHHHHHHHhcccccccccCCccHHHHHhcCCCCCCCcccCCCcceEEeCCCCHHHHHHHHHcCCCCEEE
Q 011558 379 DDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLV 458 (483)
Q Consensus 379 d~~g~lvGiit~~di~~l~~~~~~~~~~l~~~~v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tl~~~~~~m~~~~~~~l~ 458 (483)
|++|+++|++|.+|+++++..+.+... +.++.+++..... ...++++|.+++++.+|+++|.+++++++|
T Consensus 228 d~~~~~~Giit~~dl~~~~~~~~~~~~---~~~v~~~m~~~~~-------~~~~~~~v~~~~~l~~~~~~m~~~~~~~l~ 297 (323)
T 3t4n_C 228 DENGYLINVYEAYDVLGLIKGGIYNDL---SLSVGEALMRRSD-------DFEGVYTCTKNDKLSTIMDNIRKARVHRFF 297 (323)
T ss_dssp CTTCBEEEEEETTHHHHHHHTTHHHHT---TSBHHHHGGGSCT-------TCCCCEEECTTCBHHHHHHHHHHSCCCEEE
T ss_pred CCCCeEEEEEeHHHHHHHHhhchhhhc---cCCHHHHHhhccc-------cCCCCEEECCCCCHHHHHHHHHHhCCCEEE
Confidence 999999999999999997765543322 3678885543110 002688999999999999999999999999
Q ss_pred EEeCCCCeEEEEEehHHHHHHHhc
Q 011558 459 IVEAGSKRVEGIISLSDVFRFLLG 482 (483)
Q Consensus 459 VVd~~~~~l~GiIs~~DIl~~l~~ 482 (483)
||| ++|+++|+||.+||++++++
T Consensus 298 Vvd-~~~~l~Giit~~Dil~~l~~ 320 (323)
T 3t4n_C 298 VVD-DVGRLVGVLTLSDILKYILL 320 (323)
T ss_dssp EEC-TTSBEEEEEEHHHHHHHHHH
T ss_pred EEC-CCCcEEEEEEHHHHHHHHHh
Confidence 999 57999999999999999975
|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >4fch_A Outer membrane protein SUSE; starch binding, extracellular, carbohydrate-B protein; HET: GLC; 1.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >2c3v_A Alpha-amylase G-6; carbohydrate-binding module, starch binding, carbohydrate binding, glycoside hydrolase, amylose, amylopectin; HET: TYI; 1.39A {Bacillus halodurans} PDB: 2c3v_B* 2c3w_A* 2c3x_A* | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 483 | ||||
| d2qlvb1 | 87 | b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi | 2e-25 | |
| d1z0na1 | 87 | b.1.18.21 (A:77-163) 5'-AMP-activated protein kina | 3e-25 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 4e-15 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 1e-05 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 3e-13 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 1e-09 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 2e-09 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 2e-09 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 3e-09 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 0.002 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 8e-09 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 0.002 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 2e-08 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 4e-08 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 1e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 1e-07 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 0.001 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 3e-07 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-06 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 6e-06 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 3e-05 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 4e-05 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 2e-04 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 6e-04 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 0.004 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 7e-04 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 0.002 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 0.002 |
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: SIP2 species: Saccharomyces cerevisiae [TaxId: 4932]
Score = 97.9 bits (243), Expect = 2e-25
Identities = 27/82 (32%), Positives = 42/82 (51%)
Query: 18 SILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVD 77
S++VPV W GG +V ++GSFT+W + + + P F + RL PG H+++F VD
Sbjct: 1 SLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVD 60
Query: 78 GEWRHDENQPHVSGNYGVVNCV 99
E R + P + G
Sbjct: 61 NELRVSDFLPTATDQMGNFVNY 82
|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| d2qlvb1 | 87 | SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | 99.95 | |
| d1z0na1 | 87 | 5'-AMP-activated protein kinase subunit beta-1 {Ra | 99.94 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.92 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.88 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.83 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.82 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.81 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.8 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.8 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.8 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.79 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.78 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.78 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.78 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.77 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.76 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.76 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.76 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.76 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.76 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.75 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.75 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.74 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.74 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.73 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.71 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.7 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.68 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.67 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.67 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.67 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.67 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.66 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.66 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.66 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.66 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.65 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.65 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.65 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.64 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.64 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.64 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.63 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.63 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.62 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.62 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.61 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.59 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.59 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.59 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.59 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.58 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.58 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.5 | |
| d1m7xa1 | 110 | 1,4-alpha-glucan branching enzyme, N-terminal doma | 98.48 | |
| d2bhua1 | 97 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 98.44 | |
| d1kula_ | 108 | Glucoamylase, granular starch-binding domain {Aspe | 97.92 | |
| d3bmva2 | 105 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.89 | |
| d1cyga2 | 106 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.86 | |
| d1qhoa2 | 110 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.71 | |
| d1eh9a1 | 90 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 97.64 | |
| d1vema1 | 99 | beta-amylase {Bacillus cereus [TaxId: 1396]} | 97.48 | |
| d1bf2a1 | 162 | Isoamylase, N-terminal domain N {Pseudomonas amylo | 95.51 | |
| d2fhfa1 | 115 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 92.91 | |
| d3c8da1 | 145 | Enterochelin esterase {Shigella flexneri 2a str. 2 | 88.67 | |
| d1ji1a1 | 122 | Maltogenic amylase, N-terminal domain N {Thermoact | 82.86 |
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: SIP2 species: Saccharomyces cerevisiae [TaxId: 4932]
Probab=99.95 E-value=1.6e-28 Score=192.51 Aligned_cols=86 Identities=31% Similarity=0.639 Sum_probs=80.1
Q ss_pred cceEEEEEecCCCceEEEEeccCCCCCCCCCCcCCCCCCeEEEEEEcCCceEEEEEEEcCeeeeCCCCCeeeCCCCCeee
Q 011558 19 ILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNC 98 (483)
Q Consensus 19 ~~~~~~f~~~~~~~~V~l~Gsf~~W~~~~~m~~~~~~~~~~~~~~~l~~g~~~ykf~vdg~w~~d~~~~~~~~~~g~~nn 98 (483)
-+|||+|+|+++|++|+|+||||||++..+|.+....+|.|+++++|+||.|+|||+|||+|++||.+|++.|++|+.||
T Consensus 2 ~~vpv~f~w~~~g~~V~v~GsFn~W~~~~~~~~~~~~~g~~~~~l~l~~G~y~YKFiVDG~w~~d~~~p~~~d~~G~~nn 81 (87)
T d2qlvb1 2 LMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVN 81 (87)
T ss_dssp CCEEEEEEECSCCSCEEEEEGGGTTSSCEECEECSSSTTCEEEEEEECSEEEEEEEEETTEEECCTTSCEEBCSSCCCEE
T ss_pred eEEEEEEEECCCCeEEEEEEEecCcCcccccccccCCCccEEEEEeCCCCCEEEEEEECCcEEcCCCCCeeECCCCCEeE
Confidence 46999999999999999999999999987777766568999999999999999999999999999999999999999999
Q ss_pred EEEeccC
Q 011558 99 VYIAVPQ 105 (483)
Q Consensus 99 ~~~v~~~ 105 (483)
+|.| ++
T Consensus 82 vi~V-~~ 87 (87)
T d2qlvb1 82 YIEV-RQ 87 (87)
T ss_dssp EEEE-CC
T ss_pred EEEE-EC
Confidence 9999 53
|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1ji1a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|