Citrus Sinensis ID: 011624
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 481 | ||||||
| 359481606 | 567 | PREDICTED: signal recognition particle 5 | 0.958 | 0.813 | 0.858 | 0.0 | |
| 255578951 | 572 | signal recognition particle protein, put | 0.960 | 0.807 | 0.837 | 0.0 | |
| 449451269 | 572 | PREDICTED: signal recognition particle 5 | 0.962 | 0.809 | 0.840 | 0.0 | |
| 224138482 | 576 | predicted protein [Populus trichocarpa] | 0.964 | 0.805 | 0.825 | 0.0 | |
| 224088549 | 559 | predicted protein [Populus trichocarpa] | 0.966 | 0.831 | 0.823 | 0.0 | |
| 440583671 | 731 | similar to signal recognition particle 5 | 0.956 | 0.629 | 0.825 | 0.0 | |
| 356572574 | 565 | PREDICTED: signal recognition particle 5 | 0.943 | 0.803 | 0.814 | 0.0 | |
| 356505382 | 565 | PREDICTED: signal recognition particle 5 | 0.950 | 0.808 | 0.815 | 0.0 | |
| 297810481 | 562 | hypothetical protein ARALYDRAFT_487173 [ | 0.945 | 0.809 | 0.806 | 0.0 | |
| 15237580 | 564 | signal recognition particle subunit [Ara | 0.950 | 0.810 | 0.809 | 0.0 |
| >gi|359481606|ref|XP_002276439.2| PREDICTED: signal recognition particle 54 kDa protein, chloroplastic-like [Vitis vinifera] gi|297740127|emb|CBI30309.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 785 bits (2027), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 399/465 (85%), Positives = 423/465 (90%), Gaps = 4/465 (0%)
Query: 1 MEAVQFSTVASRHYSATSKTFYNSRISAGKSAKFVSSWAASSDPARLSSTSRNLFTRETW 60
MEAV FSTVASR +S+TS + + + +S SW AS P LSS RN FTRE W
Sbjct: 1 MEAVPFSTVASRPFSSTSPSLSTPKSLSRRSTNTRCSWTASKLPLPLSS--RNPFTREVW 58
Query: 61 GLINSKSVTIRRNGRRRLIVRAEMFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRA 120
L+ SKSV++RR + ++RAEMFGQLTSGLEAAW KLKGEE LTKENIVEPMRDIRRA
Sbjct: 59 SLVKSKSVSVRR--QMPGVIRAEMFGQLTSGLEAAWTKLKGEEVLTKENIVEPMRDIRRA 116
Query: 121 LLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAK 180
LLEADVSLPVVRRFVQAVSEQAVGVGLIRGV+PDQQLVKIV DELVKLMGGEVSELVFAK
Sbjct: 117 LLEADVSLPVVRRFVQAVSEQAVGVGLIRGVKPDQQLVKIVHDELVKLMGGEVSELVFAK 176
Query: 181 SRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVP 240
S PTVILLAGLQGVGKTTV AKLA YLKKQGKSCMLVAGDVYRPAAIDQLVILGEQV VP
Sbjct: 177 SGPTVILLAGLQGVGKTTVCAKLAFYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVDVP 236
Query: 241 VYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVL 300
VYTAGTEVKPSQIAKQGLEEA+KKN+DVVIVDTAGRLQIDKAMMDELKDVKR +NPTEVL
Sbjct: 237 VYTAGTEVKPSQIAKQGLEEARKKNIDVVIVDTAGRLQIDKAMMDELKDVKRAINPTEVL 296
Query: 301 LVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER 360
LVVDAMTGQEAAALVTTFN+EIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER
Sbjct: 297 LVVDAMTGQEAAALVTTFNVEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER 356
Query: 361 MEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQEDAEEMQKKIMSANFDFNDFLKQTR 420
MEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVM+QEDAEE+QKKIMSA FDFNDFLKQTR
Sbjct: 357 MEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMRQEDAEELQKKIMSAKFDFNDFLKQTR 416
Query: 421 TVARMGSMSRVIGMIPGMGKITPAQVREAEKSLKIMEAMIEAMTP 465
VARMGSM+RV+GMIPGMGK+TPAQ+REAEKSLK+ME MIEAMTP
Sbjct: 417 AVARMGSMTRVLGMIPGMGKVTPAQIREAEKSLKMMEGMIEAMTP 461
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255578951|ref|XP_002530328.1| signal recognition particle protein, putative [Ricinus communis] gi|223530132|gb|EEF32044.1| signal recognition particle protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449451269|ref|XP_004143384.1| PREDICTED: signal recognition particle 54 kDa protein, chloroplastic-like [Cucumis sativus] gi|449482550|ref|XP_004156318.1| PREDICTED: signal recognition particle 54 kDa protein, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224138482|ref|XP_002322825.1| predicted protein [Populus trichocarpa] gi|222867455|gb|EEF04586.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224088549|ref|XP_002308469.1| predicted protein [Populus trichocarpa] gi|222854445|gb|EEE91992.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|440583671|emb|CCH47177.1| similar to signal recognition particle 54 kDa protein [Lupinus angustifolius] | Back alignment and taxonomy information |
|---|
| >gi|356572574|ref|XP_003554443.1| PREDICTED: signal recognition particle 54 kDa protein, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505382|ref|XP_003521470.1| PREDICTED: signal recognition particle 54 kDa protein, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297810481|ref|XP_002873124.1| hypothetical protein ARALYDRAFT_487173 [Arabidopsis lyrata subsp. lyrata] gi|297318961|gb|EFH49383.1| hypothetical protein ARALYDRAFT_487173 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15237580|ref|NP_196014.1| signal recognition particle subunit [Arabidopsis thaliana] gi|586038|sp|P37107.1|SR54C_ARATH RecName: Full=Signal recognition particle 54 kDa protein, chloroplastic; Short=54 chloroplast protein; Short=54CP; Short=SRP54; Short=cpSRP54; AltName: Full=FFC; Flags: Precursor gi|396701|emb|CAA79981.1| 54CP [Arabidopsis thaliana] gi|7406404|emb|CAB85514.1| signal recognition particle 54CP protein precursor [Arabidopsis thaliana] gi|15293131|gb|AAK93676.1| putative signal recognition particle 54CP protein precursor [Arabidopsis thaliana] gi|24030445|gb|AAN41376.1| putative signal recognition particle 54CP protein precursor [Arabidopsis thaliana] gi|332003291|gb|AED90674.1| signal recognition particle subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 481 | ||||||
| TAIR|locus:2150620 | 564 | CPSRP54 "chloroplast signal re | 0.952 | 0.812 | 0.8 | 1e-185 | |
| TIGR_CMR|CHY_1434 | 446 | CHY_1434 "signal recognition p | 0.792 | 0.854 | 0.534 | 5.4e-102 | |
| TIGR_CMR|BA_3983 | 449 | BA_3983 "signal recognition pa | 0.790 | 0.846 | 0.481 | 5.3e-95 | |
| UNIPROTKB|Q97QD2 | 523 | ffh "Signal recognition partic | 0.790 | 0.726 | 0.479 | 1.8e-94 | |
| UNIPROTKB|P0AGD7 | 453 | ffh [Escherichia coli K-12 (ta | 0.790 | 0.838 | 0.498 | 9e-93 | |
| TIGR_CMR|CBU_0450 | 461 | CBU_0450 "signal recognition p | 0.792 | 0.826 | 0.492 | 5e-92 | |
| UNIPROTKB|P66844 | 525 | ffh "Signal recognition partic | 0.794 | 0.727 | 0.485 | 2.5e-90 | |
| TIGR_CMR|GSU_0642 | 452 | GSU_0642 "signal recognition p | 0.794 | 0.845 | 0.472 | 1.1e-89 | |
| TIGR_CMR|SO_1356 | 457 | SO_1356 "signal recognition pa | 0.790 | 0.831 | 0.476 | 8.6e-88 | |
| TIGR_CMR|VC_0560 | 461 | VC_0560 "signal recognition pa | 0.790 | 0.824 | 0.480 | 6e-87 |
| TAIR|locus:2150620 CPSRP54 "chloroplast signal recognition particle 54 kDa subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1801 (639.0 bits), Expect = 1.0e-185, P = 1.0e-185
Identities = 372/465 (80%), Positives = 403/465 (86%)
Query: 1 MEAVQFSTVASRHYSATSKTFYNSRISAGKSAKFVSSWAASSDPARLSSTSRNLFTRETW 60
MEA+QFS+V T N RI A S+ F S A LSS SRNL TRE W
Sbjct: 1 MEALQFSSV--NRVPCTLSCTGNRRIKAAFSSAFTGGTINS---ASLSS-SRNLSTREIW 54
Query: 61 GLINSKSVTIXXXXXXXXXXXAEMFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRA 120
+ SK+V + AEMFGQLT GLEAAW+KLKGEE LTK+NI EPMRDIRRA
Sbjct: 55 SWVKSKTV-VGHGRYRRSQVRAEMFGQLTGGLEAAWSKLKGEEVLTKDNIAEPMRDIRRA 113
Query: 121 LLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAK 180
LLEADVSLPVVRRFVQ+VS+QAVG+G+IRGV+PDQQLVKIV DELVKLMGGEVSEL FAK
Sbjct: 114 LLEADVSLPVVRRFVQSVSDQAVGMGVIRGVKPDQQLVKIVHDELVKLMGGEVSELQFAK 173
Query: 181 SRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVP 240
S PTVILLAGLQGVGKTTV AKLA YLKKQGKSCML+AGDVYRPAAIDQLVILGEQVGVP
Sbjct: 174 SGPTVILLAGLQGVGKTTVCAKLACYLKKQGKSCMLIAGDVYRPAAIDQLVILGEQVGVP 233
Query: 241 VYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVL 300
VYTAGT+VKP+ IAKQGL+EAKK NVDVVI+DTAGRLQIDK MMDELKDVK+ LNPTEVL
Sbjct: 234 VYTAGTDVKPADIAKQGLKEAKKNNVDVVIMDTAGRLQIDKGMMDELKDVKKFLNPTEVL 293
Query: 301 LVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER 360
LVVDAMTGQEAAALVTTFN+EIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER
Sbjct: 294 LVVDAMTGQEAAALVTTFNVEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGER 353
Query: 361 MEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQEDAEEMQKKIMSANFDFNDFLKQTR 420
MEDLEPFYPDRMAGRILGMGDVLSFVEKA EVM+QEDAE++QKKIMSA FDFNDFLKQTR
Sbjct: 354 MEDLEPFYPDRMAGRILGMGDVLSFVEKATEVMRQEDAEDLQKKIMSAKFDFNDFLKQTR 413
Query: 421 TVARMGSMSRVIGMIPGMGKITPAQVREAEKSLKIMEAMIEAMTP 465
VA+MGSM+RV+GMIPGMGK++PAQ+REAEK+L +MEAMIE MTP
Sbjct: 414 AVAKMGSMTRVLGMIPGMGKVSPAQIREAEKNLLVMEAMIEVMTP 458
|
|
| TIGR_CMR|CHY_1434 CHY_1434 "signal recognition particle protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3983 BA_3983 "signal recognition particle protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q97QD2 ffh "Signal recognition particle protein" [Streptococcus pneumoniae TIGR4 (taxid:170187)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AGD7 ffh [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0450 CBU_0450 "signal recognition particle protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P66844 ffh "Signal recognition particle protein" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0642 GSU_0642 "signal recognition particle protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1356 SO_1356 "signal recognition particle protein Ffh" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0560 VC_0560 "signal recognition particle protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 481 | |||
| PRK10867 | 433 | PRK10867, PRK10867, signal recognition particle pr | 0.0 | |
| COG0541 | 451 | COG0541, Ffh, Signal recognition particle GTPase [ | 0.0 | |
| TIGR00959 | 428 | TIGR00959, ffh, signal recognition particle protei | 0.0 | |
| PRK00771 | 437 | PRK00771, PRK00771, signal recognition particle pr | 1e-140 | |
| pfam00448 | 196 | pfam00448, SRP54, SRP54-type protein, GTPase domai | 1e-103 | |
| smart00962 | 197 | smart00962, SRP54, SRP54-type protein, GTPase doma | 2e-99 | |
| cd03115 | 173 | cd03115, SRP, The signal recognition particle (SRP | 2e-96 | |
| COG0552 | 340 | COG0552, FtsY, Signal recognition particle GTPase | 2e-79 | |
| PRK10416 | 318 | PRK10416, PRK10416, signal recognition particle-do | 3e-79 | |
| TIGR00064 | 272 | TIGR00064, ftsY, signal recognition particle-docki | 5e-77 | |
| PRK14974 | 336 | PRK14974, PRK14974, cell division protein FtsY; Pr | 3e-73 | |
| TIGR01425 | 429 | TIGR01425, SRP54_euk, signal recognition particle | 2e-69 | |
| PRK05703 | 424 | PRK05703, flhF, flagellar biosynthesis regulator F | 1e-25 | |
| COG1419 | 407 | COG1419, FlhF, Flagellar GTP-binding protein [Cell | 8e-24 | |
| TIGR03499 | 283 | TIGR03499, FlhF, flagellar biosynthetic protein Fl | 7e-18 | |
| smart00963 | 77 | smart00963, SRP54_N, SRP54-type protein, helical b | 4e-16 | |
| pfam02978 | 101 | pfam02978, SRP_SPB, Signal peptide binding domain | 2e-15 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 2e-13 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 6e-12 | |
| PRK11889 | 436 | PRK11889, flhF, flagellar biosynthesis regulator F | 7e-12 | |
| PRK06731 | 270 | PRK06731, flhF, flagellar biosynthesis regulator F | 2e-11 | |
| PRK14722 | 374 | PRK14722, flhF, flagellar biosynthesis regulator F | 5e-11 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 2e-10 | |
| pfam02881 | 77 | pfam02881, SRP54_N, SRP54-type protein, helical bu | 3e-10 | |
| PRK12726 | 407 | PRK12726, PRK12726, flagellar biosynthesis regulat | 4e-10 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 1e-09 | |
| PRK12724 | 432 | PRK12724, PRK12724, flagellar biosynthesis regulat | 1e-09 | |
| PRK14721 | 420 | PRK14721, flhF, flagellar biosynthesis regulator F | 4e-09 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 1e-08 | |
| PRK12723 | 388 | PRK12723, PRK12723, flagellar biosynthesis regulat | 1e-06 | |
| pfam01583 | 157 | pfam01583, APS_kinase, Adenylylsulphate kinase | 3e-05 | |
| COG0529 | 197 | COG0529, CysC, Adenylylsulfate kinase and related | 4e-05 | |
| cd02027 | 149 | cd02027, APSK, Adenosine 5'-phosphosulfate kinase | 4e-04 | |
| cd02035 | 217 | cd02035, ArsA, ArsA ATPase functionas as an efflux | 5e-04 | |
| cd02034 | 116 | cd02034, CooC, The accessory protein CooC, which c | 8e-04 | |
| COG0489 | 265 | COG0489, Mrp, ATPases involved in chromosome parti | 0.001 | |
| cd02036 | 179 | cd02036, MinD, Bacterial cell division requires th | 0.002 | |
| pfam02374 | 304 | pfam02374, ArsA_ATPase, Anion-transporting ATPase | 0.002 | |
| COG4240 | 300 | COG4240, COG4240, Predicted kinase [General functi | 0.002 | |
| COG2074 | 299 | COG2074, COG2074, 2-phosphoglycerate kinase [Carbo | 0.004 | |
| pfam06414 | 191 | pfam06414, Zeta_toxin, Zeta toxin | 0.004 |
| >gnl|CDD|236780 PRK10867, PRK10867, signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
Score = 603 bits (1559), Expect = 0.0
Identities = 215/383 (56%), Positives = 284/383 (74%), Gaps = 4/383 (1%)
Query: 84 MFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRALLEADVSLPVVRRFVQAVSEQAV 143
MF L+ L +A+ KL+G+ LT+ +I E +R++R ALLEADV+LPVV+ F+ V E+AV
Sbjct: 1 MFESLSDRLSSAFKKLRGKGRLTEADIKEALREVRLALLEADVNLPVVKDFIARVKEKAV 60
Query: 144 GVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKL 203
G +++ + P QQ++KIV DELV+++GGE SEL A PTVI++ GLQG GKTT + KL
Sbjct: 61 GQEVLKSLTPGQQVIKIVNDELVEILGGENSELNLAAKPPTVIMMVGLQGAGKTTTAGKL 120
Query: 204 ANYLKKQ-GKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAKQGLEEAK 262
A YLKK+ K +LVA DVYRPAAI+QL LGEQ+GVPV+ +G P IAK LEEAK
Sbjct: 121 AKYLKKKKKKKVLLVAADVYRPAAIEQLKTLGEQIGVPVFPSGDGQDPVDIAKAALEEAK 180
Query: 263 KKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEI 322
+ DVVIVDTAGRL ID+ +MDELK +K +NP E+LLVVDAMTGQ+A FN +
Sbjct: 181 ENGYDVVIVDTAGRLHIDEELMDELKAIKAAVNPDEILLVVDAMTGQDAVNTAKAFNEAL 240
Query: 323 GITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDV 382
G+TG ILTKLDGD+RGGAALS++ V+GKPIK +G GE+++DLEPF+PDRMA RILGMGDV
Sbjct: 241 GLTGVILTKLDGDARGGAALSIRAVTGKPIKFIGTGEKLDDLEPFHPDRMASRILGMGDV 300
Query: 383 LSFVEKAQEVMQQEDAEEMQKKIMSANFDFNDFLKQTRTVARMGSMSRVIGMIPGMGKIT 442
LS +EKAQEV+ +E AE++ KK+ FD DFL+Q + + +MG + ++GM+PGMG +
Sbjct: 301 LSLIEKAQEVVDEEKAEKLAKKLKKGKFDLEDFLEQLQQMKKMGGLGSLLGMLPGMGNMK 360
Query: 443 PAQVREAEKSLKIMEAMIEAMTP 465
+K LK +EA+I +MTP
Sbjct: 361 AQL---DDKELKRIEAIINSMTP 380
|
Length = 433 |
| >gnl|CDD|223615 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|233210 TIGR00959, ffh, signal recognition particle protein | Back alignment and domain information |
|---|
| >gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215925 pfam00448, SRP54, SRP54-type protein, GTPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|214940 smart00962, SRP54, SRP54-type protein, GTPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239389 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|223626 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236686 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232804 TIGR00064, ftsY, signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >gnl|CDD|237875 PRK14974, PRK14974, cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130492 TIGR01425, SRP54_euk, signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234232 TIGR03499, FlhF, flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >gnl|CDD|214941 smart00963, SRP54_N, SRP54-type protein, helical bundle domain | Back alignment and domain information |
|---|
| >gnl|CDD|202493 pfam02978, SRP_SPB, Signal peptide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|183360 PRK11889, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|75717 PRK06731, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173185 PRK14722, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217266 pfam02881, SRP54_N, SRP54-type protein, helical bundle domain | Back alignment and domain information |
|---|
| >gnl|CDD|183704 PRK12726, PRK12726, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173184 PRK14721, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216586 pfam01583, APS_kinase, Adenylylsulphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223603 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238985 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >gnl|CDD|223563 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >gnl|CDD|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|226691 COG4240, COG4240, Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224985 COG2074, COG2074, 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219014 pfam06414, Zeta_toxin, Zeta toxin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 481 | |||
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 100.0 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 100.0 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 100.0 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 100.0 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 100.0 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 100.0 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 100.0 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 100.0 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 100.0 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 100.0 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 100.0 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 100.0 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 100.0 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 100.0 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 100.0 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 100.0 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 100.0 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 100.0 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 100.0 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 100.0 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 100.0 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 100.0 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.97 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.97 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 99.96 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 99.94 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.93 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 99.9 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 99.89 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 99.81 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 99.68 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.67 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.67 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 99.63 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 99.62 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 99.61 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 99.59 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 99.59 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.59 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 99.58 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 99.58 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.58 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 99.57 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 99.57 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.56 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 99.55 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.55 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 99.55 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 99.55 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 99.54 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.53 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.52 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 99.52 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 99.52 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 99.52 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.52 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 99.52 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.52 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 99.51 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.51 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 99.51 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.51 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 99.5 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 99.5 | |
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 99.49 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.49 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.49 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.49 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 99.46 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 99.46 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 99.45 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.44 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.43 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.42 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 99.42 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.41 | |
| PRK10037 | 250 | cell division protein; Provisional | 99.41 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 99.4 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.39 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.39 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 99.38 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.37 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.35 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 99.35 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 99.35 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.34 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.32 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 99.29 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.28 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.28 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.26 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 99.26 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.26 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 99.23 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.21 | |
| PRK13768 | 253 | GTPase; Provisional | 99.2 | |
| PF02978 | 104 | SRP_SPB: Signal peptide binding domain; InterPro: | 99.18 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 99.14 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 99.08 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 99.06 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.03 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 99.02 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 98.99 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 98.96 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 98.92 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 98.91 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 98.9 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 98.86 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 98.84 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 98.84 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 98.81 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 98.81 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 98.8 | |
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 98.79 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 98.74 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 98.73 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 98.73 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.68 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 98.64 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 98.62 | |
| PF02881 | 75 | SRP54_N: SRP54-type protein, helical bundle domain | 98.6 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 98.59 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 98.57 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 98.51 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 98.49 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 98.48 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 98.47 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 98.43 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 98.42 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 98.42 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 98.41 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 98.41 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 98.4 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 98.4 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 98.34 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 98.34 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 98.34 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 98.34 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 98.33 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 98.33 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 98.33 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 98.33 | |
| PRK11537 | 318 | putative GTP-binding protein YjiA; Provisional | 98.31 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 98.29 | |
| KOG2825 | 323 | consensus Putative arsenite-translocating ATPase [ | 98.29 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.29 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 98.29 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.28 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 98.24 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 98.24 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 98.23 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 98.23 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 98.21 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 98.2 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 98.2 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.19 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 98.18 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 98.17 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 98.15 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 98.13 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 98.13 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 98.09 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 98.08 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 98.06 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 98.05 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 98.05 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 98.04 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 98.04 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 98.04 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 98.02 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 98.02 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 98.0 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 98.0 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.99 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 97.99 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 97.98 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 97.98 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.98 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.95 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 97.94 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.93 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 97.93 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.92 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 97.91 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.9 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 97.9 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 97.9 | |
| TIGR02475 | 341 | CobW cobalamin biosynthesis protein CobW. A broade | 97.89 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.88 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 97.87 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 97.87 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 97.85 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 97.85 | |
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 97.85 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.85 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 97.85 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 97.84 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 97.84 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 97.84 | |
| PRK06526 | 254 | transposase; Provisional | 97.83 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 97.82 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 97.81 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 97.8 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.79 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.78 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.77 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 97.77 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 97.76 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 97.76 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 97.76 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.74 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 97.74 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.73 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.72 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 97.71 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.71 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 97.7 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 97.7 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 97.69 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 97.69 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.68 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 97.67 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.67 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.67 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 97.66 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 97.66 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 97.66 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 97.65 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 97.64 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 97.64 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 97.62 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 97.62 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 97.62 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 97.61 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 97.61 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 97.6 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 97.59 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 97.59 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 97.59 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 97.59 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 97.59 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 97.56 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 97.56 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 97.56 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 97.56 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.56 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 97.56 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 97.55 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.55 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.55 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 97.55 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 97.54 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 97.54 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 97.53 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 97.53 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 97.53 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 97.53 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 97.51 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 97.51 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 97.51 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 97.51 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 97.5 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 97.49 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.49 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 97.49 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 97.48 | |
| KOG2743 | 391 | consensus Cobalamin synthesis protein [Coenzyme tr | 97.48 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.48 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 97.47 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 97.47 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 97.46 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 97.46 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 97.46 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.46 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 97.45 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 97.45 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 97.44 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 97.44 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 97.44 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 97.44 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.43 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 97.43 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.42 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 97.42 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.41 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 97.41 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 97.41 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 97.41 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 97.4 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 97.39 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.38 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 97.37 | |
| CHL00071 | 409 | tufA elongation factor Tu | 97.36 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 97.35 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 97.35 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 97.35 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.35 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 97.35 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 97.33 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 97.33 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 97.33 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.33 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 97.32 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 97.32 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.32 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 97.31 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 97.31 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 97.31 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 97.3 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 97.29 | |
| PRK08181 | 269 | transposase; Validated | 97.29 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.29 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 97.29 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 97.28 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 97.28 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 97.28 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 97.27 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 97.27 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.26 | |
| PF13479 | 213 | AAA_24: AAA domain | 97.26 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.26 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 97.26 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 97.26 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.25 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 97.25 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 97.24 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.24 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.24 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.23 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 97.23 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 97.23 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 97.22 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 97.21 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 97.21 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 97.21 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.2 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 97.2 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 97.2 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 97.19 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 97.19 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 97.19 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 97.18 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 97.18 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 97.18 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 97.18 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.17 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 97.17 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.17 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 97.17 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 97.17 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 97.17 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.16 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 97.16 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 97.16 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 97.15 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.15 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.15 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 97.15 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 97.14 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 97.14 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 97.14 | |
| PLN03118 | 211 | Rab family protein; Provisional | 97.14 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.13 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 97.13 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 97.13 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 97.13 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.12 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.12 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 97.11 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 97.11 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 97.11 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 97.11 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.1 | |
| PRK13695 | 174 | putative NTPase; Provisional | 97.1 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 97.1 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 97.1 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 97.09 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 97.09 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 97.09 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 97.08 | |
| KOG2749 | 415 | consensus mRNA cleavage and polyadenylation factor | 97.08 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 97.07 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 97.06 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 97.06 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.06 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 97.05 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 97.05 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 97.04 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.04 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 97.03 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 97.03 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 97.03 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 97.02 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 97.02 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 97.02 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 97.02 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 97.0 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 97.0 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 97.0 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 96.99 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 96.99 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 96.99 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 96.98 | |
| KOG0464 | 753 | consensus Elongation factor G [Translation, riboso | 96.98 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.98 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 96.97 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 96.97 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.96 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.96 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 96.94 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.94 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.94 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 96.94 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 96.93 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 96.93 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 96.93 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 96.92 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.92 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 96.91 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 96.91 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 96.91 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.91 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 96.9 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 96.89 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.88 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.87 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 96.87 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 96.87 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 96.87 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.85 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 96.85 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 96.84 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 96.84 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 96.84 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 96.84 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 96.84 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 96.84 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.84 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 96.83 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 96.83 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 96.83 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.83 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 96.81 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.81 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 96.81 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 96.8 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 96.8 | |
| PLN02348 | 395 | phosphoribulokinase | 96.79 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 96.79 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.79 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.79 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.77 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.77 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 96.76 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 96.75 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 96.74 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 96.74 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.73 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 96.73 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 96.73 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.73 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 96.72 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 96.71 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 96.71 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 96.71 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.71 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.7 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 96.69 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 96.69 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.68 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 96.68 | |
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 96.68 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 96.68 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 96.67 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 96.66 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.66 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 96.66 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.66 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 96.66 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 96.66 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 96.65 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 96.65 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 96.63 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 96.63 | |
| PF07755 | 301 | DUF1611: Protein of unknown function (DUF1611); In | 96.62 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 96.61 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 96.6 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 96.59 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 96.59 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 96.58 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 96.58 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.58 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 96.58 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.57 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 96.57 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 96.56 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.56 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 96.56 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 96.56 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.55 |
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-85 Score=667.26 Aligned_cols=398 Identities=55% Similarity=0.869 Sum_probs=382.0
Q ss_pred HHHHHHHHHHHHHHHhhCCCCCChhhhHHHHHHHHHHHHHCCCChHHHHHHHHHHHHHHhhccccCCCChhHHHHHHHHH
Q 011624 84 MFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRALLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVRD 163 (481)
Q Consensus 84 ~~~~l~~~l~~~~~~~~~~~~~~~~~i~~~l~~i~~~Ll~~dv~~~~v~~l~~~l~~~~~~~~~~~~~~~~~~~~~~l~~ 163 (481)
||++|+++|++++++++++..++|++|++.++||+.+|+++||+..+|++|++++++++.+++++.+++|.|+++++|++
T Consensus 1 m~e~L~~~l~~~l~kl~g~~~i~E~~i~e~~reir~ALLeADVnl~vVk~fi~~ikera~g~ev~~~l~p~q~~iKiV~e 80 (451)
T COG0541 1 MFESLSDRLSNALKKLRGKGRITEKDVKEALREIRRALLEADVNLKVVKDFIKRIKERALGEEVPKGLTPGQQFIKIVYE 80 (451)
T ss_pred ChHHHHHHHHHHHHHhhCCCcCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHhccccCCCCCCHHHHHHHHHHH
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCccccccccCCCCEEEEEEcCCCCCHHHHHHHHHHHHHHcCCeEEEEeccCCchhHHHHHHHhhhhcCCCeec
Q 011624 164 ELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYT 243 (481)
Q Consensus 164 ~L~~~l~~~~~~~~~~~~~~~VI~i~G~~GvGKTTta~~LA~~L~~~G~kVlLId~D~~rp~aidql~~~~~~~gv~v~~ 243 (481)
||+++||++..++.+..++|.||+++|.+|+||||++++||.||+++|++|++|+||+|||++++||+++++..++|+|.
T Consensus 81 ELv~llG~~~~~~~l~~~~P~vImmvGLQGsGKTTt~~KLA~~lkk~~~kvllVaaD~~RpAA~eQL~~La~q~~v~~f~ 160 (451)
T COG0541 81 ELVKLLGGENSELNLAKKPPTVILMVGLQGSGKTTTAGKLAKYLKKKGKKVLLVAADTYRPAAIEQLKQLAEQVGVPFFG 160 (451)
T ss_pred HHHHHhCCCCcccccCCCCCeEEEEEeccCCChHhHHHHHHHHHHHcCCceEEEecccCChHHHHHHHHHHHHcCCceec
Confidence 99999998666777777789999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCHHHHHHHHHHHHHcCCCcEEEEcCCCCccccHHHHHHHHhhhhccCCceEEEEEeCcchHHHHHHHHHhhhcCC
Q 011624 244 AGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEIG 323 (481)
Q Consensus 244 ~~~~~~~~~~l~~~l~~~~~~~~D~VIIDt~G~~~~d~~~~~el~~i~~~~~p~~vvLVvda~~~~~~~~~~~~f~~~~~ 323 (481)
.+...+|.+++++++++++...||+|||||+|+++.|..++.|+..+..+++|++++||+|+++||+++++++.|++.++
T Consensus 161 ~~~~~~Pv~Iak~al~~ak~~~~DvvIvDTAGRl~ide~Lm~El~~Ik~~~~P~E~llVvDam~GQdA~~~A~aF~e~l~ 240 (451)
T COG0541 161 SGTEKDPVEIAKAALEKAKEEGYDVVIVDTAGRLHIDEELMDELKEIKEVINPDETLLVVDAMIGQDAVNTAKAFNEALG 240 (451)
T ss_pred CCCCCCHHHHHHHHHHHHHHcCCCEEEEeCCCcccccHHHHHHHHHHHhhcCCCeEEEEEecccchHHHHHHHHHhhhcC
Confidence 98788999999999999998889999999999999999999999999999999999999999999999999999999999
Q ss_pred eeEEEEcCCCCCCchhHHHHHHHHhCCCeEEeecCCCCCCCCCcChhhHhhhhcCCchhHHHHHHHHHhhchhHHHHHHH
Q 011624 324 ITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQEDAEEMQK 403 (481)
Q Consensus 324 i~GvIlnKvD~~~~~g~~~~~~~~~glPV~~ig~g~~v~dl~~f~~~~~~~r~lGlgd~~~lve~a~e~~~~~~~~~~~~ 403 (481)
++|||+||+|+++++|.++++.+.+|.||+|+|+|++++||++|+|+|+++|+||+||+.+|+|++++..++++.++..+
T Consensus 241 itGvIlTKlDGdaRGGaALS~~~~tg~PIkFiGtGEki~dLE~F~P~R~asRILGMGDv~sLvEk~~~~~d~e~a~~~~~ 320 (451)
T COG0541 241 ITGVILTKLDGDARGGAALSARAITGKPIKFIGTGEKIDDLEPFHPDRFASRILGMGDVLSLIEKAEEVVDEEEAEKLAE 320 (451)
T ss_pred CceEEEEcccCCCcchHHHhhHHHHCCCeEEEecCCCcccCCCcChHHHHHHhcCcccHHHHHHHHHHhhhHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhcccccHHHHHHHHhhhhccCCccccccCCCCCC-CccccccchhhhcchhHHHHHHccChhhhccCCcccccccCC
Q 011624 404 KIMSANFDFNDFLKQTRTVARMGSMSRVIGMIPGMG-KITPAQVREAEKSLKIMEAMIEAMTPGIFFFSIIIIGLTFKR 481 (481)
Q Consensus 404 k~~~~~~dl~~l~~~~~~~~~~g~~~~~~~~~p~~~-~~~~~~~~d~a~~f~~~~~li~sm~~e~~~~~~l~~~~~~~~ 481 (481)
++.+++|||+||++|++++.+|||++++++|+||++ ..........+..|+++++||+|||.+|+.+|.+|++||+||
T Consensus 321 kl~~g~FtL~Df~~Ql~~m~kmGpl~~ll~miPG~~~~~~~~~~~~~e~~~kr~~aIi~SMT~~Er~nP~ii~~SR~rR 399 (451)
T COG0541 321 KLKKGKFTLEDFLEQLEQMKKMGPLSKLLSMIPGMGMKDSDKDIELDEKKLKRIEAIIDSMTPEERENPDIINASRKRR 399 (451)
T ss_pred HHHhCCCCHHHHHHHHHHHHccCCHHHHHHhCCCCCCCCchhhhhccHHHHHHHHHHHHcCCHHHhhCccccChHHHHH
Confidence 999999999999999999999999999999999986 222222334577899999999999999999999999999987
|
|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PF02978 SRP_SPB: Signal peptide binding domain; InterPro: IPR004125 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >PF02881 SRP54_N: SRP54-type protein, helical bundle domain; InterPro: IPR013822 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK11537 putative GTP-binding protein YjiA; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >TIGR02475 CobW cobalamin biosynthesis protein CobW | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 481 | ||||
| 2xxa_A | 433 | The Crystal Structure Of The Signal Recognition Par | 1e-100 | ||
| 2j28_9 | 430 | Model Of E. Coli Srp Bound To 70s Rncs Length = 430 | 1e-100 | ||
| 2ffh_A | 425 | The Signal Sequence Binding Protein Ffh From Thermu | 2e-86 | ||
| 2iy3_A | 432 | Structure Of The E. Coli Signal Recognition Particl | 7e-82 | ||
| 2v3c_C | 432 | Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna C | 1e-75 | ||
| 3ndb_B | 454 | Crystal Structure Of A Signal Sequence Bound To The | 1e-75 | ||
| 1rj9_B | 300 | Structure Of The Heterodimer Of The Conserved Gtpas | 8e-75 | ||
| 1o87_A | 297 | A New Mggdp Complex Of The Ffh Ng Domain Length = 2 | 3e-74 | ||
| 2c03_A | 297 | Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 29 | 3e-74 | ||
| 1jpj_A | 296 | Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 | 9e-74 | ||
| 1ls1_A | 295 | T. Aquaticus Ffh Ng Domain At 1.1a Resolution Lengt | 5e-73 | ||
| 3ng1_A | 294 | N And Gtpase Domains Of The Signal Sequence Recogni | 2e-72 | ||
| 1ffh_A | 294 | N And Gtpase Domains Of The Signal Sequence Recogni | 2e-72 | ||
| 2ng1_A | 293 | N And Gtpase Domains Of The Signal Sequence Recogni | 1e-71 | ||
| 3dm5_A | 443 | Structures Of Srp54 And Srp19, The Two Proteins Ass | 4e-65 | ||
| 3kl4_A | 433 | Recognition Of A Signal Peptide By The Signal Recog | 2e-58 | ||
| 1qzw_A | 440 | Crystal Structure Of The Complete Core Of Archaeal | 2e-58 | ||
| 2j37_W | 504 | Model Of Mammalian Srp Bound To 80s Rncs Length = 5 | 3e-55 | ||
| 1fts_A | 295 | Signal Recognition Particle Receptor From E. Coli L | 3e-44 | ||
| 2xxa_B | 302 | The Crystal Structure Of The Signal Recognition Par | 3e-44 | ||
| 2qy9_A | 309 | Structure Of The Ng+1 Construct Of The E. Coli Srp | 3e-44 | ||
| 1j8m_F | 297 | Signal Recognition Particle Conserved Gtpase Domain | 7e-44 | ||
| 2yhs_A | 503 | Structure Of The E. Coli Srp Receptor Ftsy Length = | 1e-43 | ||
| 1j8y_F | 297 | Signal Recognition Particle Conserved Gtpase Domain | 3e-43 | ||
| 3dmd_B | 328 | Structures And Conformations In Solution Of The Sig | 4e-42 | ||
| 3dm9_B | 328 | Structures And Conformations In Solution Of The Sig | 2e-40 | ||
| 2og2_A | 359 | Crystal Structure Of Chloroplast Ftsy From Arabidop | 4e-39 | ||
| 3b9q_A | 302 | The Crystal Structure Of Cpftsy From Arabidopsis Th | 5e-39 | ||
| 4ak9_A | 318 | Structure Of Chloroplast Ftsy From Physcomitrella P | 3e-38 | ||
| 1vma_A | 306 | Crystal Structure Of Cell Division Protein Ftsy (Tm | 2e-35 | ||
| 2q9a_A | 304 | Structure Of Apo Ftsy Length = 304 | 6e-31 | ||
| 1okk_D | 303 | Homo-Heterodimeric Complex Of The Srp Gtpases Lengt | 7e-31 | ||
| 2j7p_D | 283 | Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpa | 9e-31 | ||
| 2cnw_D | 284 | Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Len | 9e-31 | ||
| 1zu4_A | 320 | Crystal Structure Of Ftsy From Mycoplasma Mycoides- | 1e-30 | ||
| 1rj9_A | 304 | Structure Of The Heterodimer Of The Conserved Gtpas | 7e-30 | ||
| 2px0_A | 296 | Crystal Structure Of Flhf Complexed With GmppnpMG(2 | 8e-10 | ||
| 1hq1_A | 105 | Structural And Energetic Analysis Of Rna Recognitio | 2e-06 |
| >pdb|2XXA|A Chain A, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 433 | Back alignment and structure |
|
| >pdb|2J28|9 Chain 9, Model Of E. Coli Srp Bound To 70s Rncs Length = 430 | Back alignment and structure |
| >pdb|2FFH|A Chain A, The Signal Sequence Binding Protein Ffh From Thermus Aquaticus Length = 425 | Back alignment and structure |
| >pdb|2IY3|A Chain A, Structure Of The E. Coli Signal Recognition Particle Bound To A Translating Ribosome Length = 432 | Back alignment and structure |
| >pdb|2V3C|C Chain C, Crystal Structure Of The Srp54-Srp19-7s.S Srp Rna Complex Of M. Jannaschii Length = 432 | Back alignment and structure |
| >pdb|3NDB|B Chain B, Crystal Structure Of A Signal Sequence Bound To The Signal Recognition Particle Length = 454 | Back alignment and structure |
| >pdb|1RJ9|B Chain B, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 300 | Back alignment and structure |
| >pdb|1O87|A Chain A, A New Mggdp Complex Of The Ffh Ng Domain Length = 297 | Back alignment and structure |
| >pdb|2C03|A Chain A, Gdp Complex Of Srp Gtpase Ffh Ng Domain Length = 297 | Back alignment and structure |
| >pdb|1JPJ|A Chain A, Gmppnp Complex Of Srp Gtpase Ng Domain Length = 296 | Back alignment and structure |
| >pdb|1LS1|A Chain A, T. Aquaticus Ffh Ng Domain At 1.1a Resolution Length = 295 | Back alignment and structure |
| >pdb|3NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 | Back alignment and structure |
| >pdb|1FFH|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 294 | Back alignment and structure |
| >pdb|2NG1|A Chain A, N And Gtpase Domains Of The Signal Sequence Recognition Protein Ffh From Thermus Aquaticus Length = 293 | Back alignment and structure |
| >pdb|3DM5|A Chain A, Structures Of Srp54 And Srp19, The Two Proteins Assembling The Ribonucleic Core Of The Signal Recognition Particle From The Archaeon Pyrococcus Furiosus. Length = 443 | Back alignment and structure |
| >pdb|3KL4|A Chain A, Recognition Of A Signal Peptide By The Signal Recognition Particle Length = 433 | Back alignment and structure |
| >pdb|1QZW|A Chain A, Crystal Structure Of The Complete Core Of Archaeal Srp And Implications For Inter-Domain Communication Length = 440 | Back alignment and structure |
| >pdb|2J37|W Chain W, Model Of Mammalian Srp Bound To 80s Rncs Length = 504 | Back alignment and structure |
| >pdb|1FTS|A Chain A, Signal Recognition Particle Receptor From E. Coli Length = 295 | Back alignment and structure |
| >pdb|2XXA|B Chain B, The Crystal Structure Of The Signal Recognition Particle (Srp) In Complex With Its Receptor(Sr) Length = 302 | Back alignment and structure |
| >pdb|2QY9|A Chain A, Structure Of The Ng+1 Construct Of The E. Coli Srp Receptor Ftsy Length = 309 | Back alignment and structure |
| >pdb|1J8M|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens Length = 297 | Back alignment and structure |
| >pdb|2YHS|A Chain A, Structure Of The E. Coli Srp Receptor Ftsy Length = 503 | Back alignment and structure |
| >pdb|1J8Y|F Chain F, Signal Recognition Particle Conserved Gtpase Domain From A. Ambivalens T112a Mutant Length = 297 | Back alignment and structure |
| >pdb|3DMD|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 | Back alignment and structure |
| >pdb|3DM9|B Chain B, Structures And Conformations In Solution Of The Signal Recognition Particle Receptor From The Archaeon Pyrococcus Furiosus Length = 328 | Back alignment and structure |
| >pdb|2OG2|A Chain A, Crystal Structure Of Chloroplast Ftsy From Arabidopsis Thaliana Length = 359 | Back alignment and structure |
| >pdb|3B9Q|A Chain A, The Crystal Structure Of Cpftsy From Arabidopsis Thaliana Length = 302 | Back alignment and structure |
| >pdb|4AK9|A Chain A, Structure Of Chloroplast Ftsy From Physcomitrella Patens Length = 318 | Back alignment and structure |
| >pdb|1VMA|A Chain A, Crystal Structure Of Cell Division Protein Ftsy (Tm0570) From Thermotoga Maritima At 1.60 A Resolution Length = 306 | Back alignment and structure |
| >pdb|2Q9A|A Chain A, Structure Of Apo Ftsy Length = 304 | Back alignment and structure |
| >pdb|1OKK|D Chain D, Homo-Heterodimeric Complex Of The Srp Gtpases Length = 303 | Back alignment and structure |
| >pdb|2J7P|D Chain D, Gmppnp-Stabilized Ng Domain Complex Of The Srp Gtpases Ffh And Ftsy Length = 283 | Back alignment and structure |
| >pdb|2CNW|D Chain D, Gdpalf4 Complex Of The Srp Gtpases Ffh And Ftsy Length = 284 | Back alignment and structure |
| >pdb|1ZU4|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group P21212 Length = 320 | Back alignment and structure |
| >pdb|1RJ9|A Chain A, Structure Of The Heterodimer Of The Conserved Gtpase Domains Signal Recognition Particle (Ffh) And Its Receptor (Ftsy) Length = 304 | Back alignment and structure |
| >pdb|2PX0|A Chain A, Crystal Structure Of Flhf Complexed With GmppnpMG(2+) Length = 296 | Back alignment and structure |
| >pdb|1HQ1|A Chain A, Structural And Energetic Analysis Of Rna Recognition By A Universally Conserved Protein From The Signal Recognition Particle Length = 105 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 481 | |||
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 0.0 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 0.0 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 0.0 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 0.0 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 0.0 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 0.0 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 1e-171 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 1e-168 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 3e-92 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 1e-85 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 4e-71 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 5e-71 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 4e-70 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 5e-70 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 3e-68 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 3e-67 | |
| 1mfq_C | 129 | SRP54, signal recognition particle 54KDA protein; | 1e-19 | |
| 2jqe_A | 119 | SRP54, signal recognition 54 kDa protein; AF54, st | 7e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-15 | |
| 1hq1_A | 105 | Signal recognition particle protein; protein-RNA c | 1e-14 | |
| 1qb2_A | 109 | SRP54, human signal recognition particle 54 KD pro | 1e-14 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 1e-06 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 1e-05 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 7e-05 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 2e-04 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 2e-04 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 2e-04 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 2e-04 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 3e-04 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 4e-04 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 6e-04 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 6e-04 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 9e-04 |
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Length = 433 | Back alignment and structure |
|---|
Score = 575 bits (1484), Expect = 0.0
Identities = 190/385 (49%), Positives = 256/385 (66%), Gaps = 3/385 (0%)
Query: 84 MFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRALLEADVSLPVVRRFVQAVSEQAV 143
MF LT L + G LT++N+ + +R++R ALLEADV+LPVVR F+ V E+AV
Sbjct: 1 MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAV 60
Query: 144 GVGLIRGVRPDQQLVKIVRDELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKL 203
G + + + P Q+ VKIVR+ELV MG E L A P V+L+AGLQG GKTT KL
Sbjct: 61 GHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKL 120
Query: 204 ANYLK-KQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAKQGLEEAK 262
+L+ K K ++V+ DVYRPAAI QL L EQVGV + + KP I L+EAK
Sbjct: 121 GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK 180
Query: 263 KKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEI 322
K DV++VDTAGRL +D+AMMDE+K V +NP E L VVDAMTGQ+AA FN +
Sbjct: 181 LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL 240
Query: 323 GITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDV 382
+TG +LTK+DGD+RGGAALS++ ++GKPIK +G GE+ E LEPF+PDR+A RILGMGDV
Sbjct: 241 PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDV 300
Query: 383 LSFVEKAQEVMQQEDAEEMQKKIMSAN-FDFNDFLKQTRTVARMGSMSRVIGMIPGMGKI 441
LS +E + + + AE++ K+ + FD NDFL+Q R + MG M+ ++G +PGMG+I
Sbjct: 301 LSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI 360
Query: 442 TP-AQVREAEKSLKIMEAMIEAMTP 465
+ + +K L MEA+I +MT
Sbjct: 361 PDNVKSQMDDKVLVRMEAIINSMTM 385
|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Length = 433 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Length = 443 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Length = 425 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Length = 432 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Length = 295 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Length = 297 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Length = 296 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Length = 304 | Back alignment and structure |
|---|
| >1mfq_C SRP54, signal recognition particle 54KDA protein; RNA-protein complex, A-minor motif, 3-helix junction, signaling protein/RNA complex; HET: CCC; 3.10A {Homo sapiens} SCOP: a.36.1.1 Length = 129 | Back alignment and structure |
|---|
| >2jqe_A SRP54, signal recognition 54 kDa protein; AF54, structure, solution, signaling protein; NMR {Archaeoglobus fulgidus} Length = 119 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1hq1_A Signal recognition particle protein; protein-RNA complex, double helix, tetraloop, internal loop, SRP, ribonucleoprotein; HET: CCC; 1.52A {Escherichia coli} SCOP: a.36.1.1 PDB: 3lqx_A* 2pxb_A 2pxd_A 2pxe_A 2pxf_A 2pxk_A 2pxl_A 2pxp_A 2pxq_A 2pxt_A 2pxu_A 2pxv_A Length = 105 | Back alignment and structure |
|---|
| >1qb2_A SRP54, human signal recognition particle 54 KD protein; alpha-helix, helix-turn-helix, signaling protein; 2.10A {Homo sapiens} SCOP: a.36.1.1 PDB: 1ry1_W* 2go5_W Length = 109 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Length = 194 | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Length = 251 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Length = 192 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Length = 174 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 481 | |||
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 100.0 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 100.0 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 100.0 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 100.0 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 100.0 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 100.0 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 100.0 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 100.0 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 100.0 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 100.0 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 100.0 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 100.0 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 100.0 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 100.0 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 100.0 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 100.0 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 99.66 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 99.64 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.63 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 99.63 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.63 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 99.62 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 99.61 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.6 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 99.6 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.59 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.58 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 99.58 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 99.58 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 99.57 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 99.56 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 99.56 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.53 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 99.52 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 99.51 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.5 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 99.49 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 99.44 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 99.43 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 99.42 | |
| 2jqe_A | 119 | SRP54, signal recognition 54 kDa protein; AF54, st | 99.42 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 99.41 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 99.4 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 99.39 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.39 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 99.38 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 99.37 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.37 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.36 | |
| 1hq1_A | 105 | Signal recognition particle protein; protein-RNA c | 99.34 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.29 | |
| 1mfq_C | 129 | SRP54, signal recognition particle 54KDA protein; | 99.29 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 99.28 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.27 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 99.25 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 99.24 | |
| 1qb2_A | 109 | SRP54, human signal recognition particle 54 KD pro | 99.2 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 99.19 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.07 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 98.94 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 98.87 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 98.84 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.77 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 98.7 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 98.39 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 98.37 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 98.28 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 98.27 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.24 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 98.23 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 98.19 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 98.18 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 98.16 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 98.16 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 98.14 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 98.13 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 98.1 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.1 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 98.1 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 98.1 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 98.08 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 98.07 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 98.06 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 98.06 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 98.05 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 98.04 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 98.04 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 98.03 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 98.01 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 98.0 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 98.0 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 97.97 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.96 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 97.93 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 97.92 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 97.92 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 97.91 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 97.87 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.85 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 97.85 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 97.83 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 97.83 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.83 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 97.82 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.82 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 97.78 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 97.77 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.76 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.73 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.72 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 97.7 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.69 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.69 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 97.68 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 97.68 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.67 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.65 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.65 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.63 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.63 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.63 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 97.63 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 97.63 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.61 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 97.61 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.6 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 97.59 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 97.59 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.58 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 97.57 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 97.57 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 97.57 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 97.54 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 97.53 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.52 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 97.51 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 97.5 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.49 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 97.49 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 97.49 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 97.49 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 97.48 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 97.48 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 97.48 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 97.47 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 97.46 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 97.45 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 97.44 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 97.44 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 97.44 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 97.44 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 97.44 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 97.43 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.43 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.42 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 97.41 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 97.41 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.41 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 97.41 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 97.4 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.4 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 97.39 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 97.38 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 97.38 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 97.37 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 97.37 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 97.37 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 97.37 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 97.36 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 97.36 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 97.35 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 97.35 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 97.35 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.35 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 97.35 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 97.35 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.34 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 97.33 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 97.33 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 97.33 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.33 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 97.32 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.32 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 97.32 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.31 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 97.31 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 97.31 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 97.31 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.3 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 97.3 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 97.29 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.29 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 97.29 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 97.28 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 97.27 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.26 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.26 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.25 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 97.24 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 97.24 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 97.23 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.23 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 97.23 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.22 | |
| 1dul_A | 69 | Signal recognition particle protein (fifty-four ho | 97.22 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 97.21 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 97.21 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 97.21 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.21 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 97.2 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 97.2 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 97.2 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.2 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.2 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 97.2 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 97.19 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 97.18 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.17 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 97.16 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 97.15 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 97.15 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 97.15 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 97.14 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 97.14 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 97.14 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 97.13 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 97.13 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 97.13 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.13 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.13 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 97.12 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 97.12 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 97.1 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 97.08 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 97.07 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 97.07 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 97.06 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 97.06 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 97.05 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 97.04 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 97.03 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.02 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 97.02 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 97.02 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 97.01 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.01 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 97.0 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 97.0 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.0 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.99 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.99 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.98 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 96.98 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 96.98 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 96.96 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.96 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 96.95 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.95 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.94 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.93 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.92 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.91 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.91 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 96.91 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.9 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.9 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 96.89 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 96.89 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.89 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 96.88 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 96.87 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 96.87 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.85 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 96.85 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 96.84 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.84 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.83 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.83 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 96.83 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.83 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.82 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 96.8 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 96.79 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.79 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 96.78 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.77 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.77 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.76 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.75 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 96.73 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.72 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 96.72 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.72 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 96.71 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 96.71 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.7 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 96.7 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.69 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 96.68 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 96.68 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 96.67 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 96.67 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 96.67 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.66 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.64 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 96.64 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 96.63 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 96.63 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.63 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 96.62 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 96.61 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.61 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.61 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.59 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 96.59 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 96.59 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 96.58 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 96.57 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.56 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 96.54 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 96.54 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 96.52 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.51 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.51 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.5 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 96.5 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 96.5 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.49 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 96.48 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.47 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.47 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.46 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 96.45 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.44 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 96.42 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.4 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.4 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.4 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 96.39 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 96.39 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.38 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.38 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 96.38 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 96.36 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.36 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.36 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 96.35 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 96.35 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 96.34 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.33 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 96.3 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 96.28 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 96.27 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 96.26 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 96.25 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.24 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.24 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.23 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.23 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.23 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.22 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.22 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 96.21 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 96.18 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 96.17 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.17 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.17 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 96.16 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.15 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.14 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 96.11 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 96.11 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.11 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.11 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.08 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.07 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 96.06 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.04 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 96.03 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 96.0 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.99 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 95.98 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.98 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 95.97 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 95.97 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.97 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.97 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 95.96 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.96 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 95.94 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 95.94 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.94 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.91 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 95.91 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.9 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.88 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.88 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.88 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 95.87 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 95.86 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.84 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 95.84 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 95.84 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 95.83 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.82 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.8 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.77 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 95.76 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 95.74 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.73 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.73 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 95.72 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.71 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 95.71 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.7 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.69 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 95.68 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.68 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 95.67 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.67 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 95.66 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 95.66 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 95.64 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 95.62 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 95.62 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.6 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.59 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.55 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 95.54 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.54 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 95.54 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.52 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 95.49 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 95.48 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 95.47 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.47 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 95.46 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 95.46 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 95.46 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.45 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.44 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 95.43 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 95.39 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 95.36 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 95.34 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.32 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 95.31 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.3 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 95.3 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.26 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 95.25 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.25 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 95.24 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.21 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 95.2 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 95.2 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 95.19 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 95.19 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.19 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.18 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.14 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 95.11 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 95.11 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 95.07 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.06 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 95.02 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 94.98 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 94.95 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 94.94 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 94.9 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.89 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 94.88 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.87 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.86 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 94.82 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 94.81 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 94.81 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 94.81 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.79 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 94.78 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 94.77 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.77 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.77 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 94.76 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 94.74 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.72 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 94.72 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 94.66 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 94.56 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 94.53 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 94.44 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 94.4 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 94.35 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 94.28 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 94.28 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 94.21 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 94.19 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 94.15 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.15 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 94.11 |
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-69 Score=566.46 Aligned_cols=397 Identities=34% Similarity=0.597 Sum_probs=355.7
Q ss_pred HHHHHHHHHHHHHHHHhhCCCCCChhhhHHHHHHHHHHHHHCCCChHHHHHHHHHHHHHHhhccccCCCChhHHHHHHHH
Q 011624 83 EMFGQLTSGLEAAWNKLKGEETLTKENIVEPMRDIRRALLEADVSLPVVRRFVQAVSEQAVGVGLIRGVRPDQQLVKIVR 162 (481)
Q Consensus 83 ~~~~~l~~~l~~~~~~~~~~~~~~~~~i~~~l~~i~~~Ll~~dv~~~~v~~l~~~l~~~~~~~~~~~~~~~~~~~~~~l~ 162 (481)
|||++|+++|+++++++.+...++++++++++++|+.+|+++||+.+++.+|++++++...+.++..++++.+++.++++
T Consensus 1 m~~~~l~~~l~~~~~~l~~~~~l~e~~~~~~l~ei~~~Ll~adv~~~~~~~~~~~v~~~~~~~~v~~~~~~~~~v~~~l~ 80 (443)
T 3dm5_A 1 MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVY 80 (443)
T ss_dssp CCSTHHHHHHHHHHHHHHHCSCCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHCCCCTTCCHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHhhccccccCCcHHHHHHHHH
Confidence 58999999999999999999999999999999999999999999999999999999999999888888999999999999
Q ss_pred HHHHHHhcCccccccccCCCCEEEEEEcCCCCCHHHHHHHHHHHHHHcCCeEEEEeccCCchhHHHHHHHhhhhcCCCee
Q 011624 163 DELVKLMGGEVSELVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVY 242 (481)
Q Consensus 163 ~~L~~~l~~~~~~~~~~~~~~~VI~i~G~~GvGKTTta~~LA~~L~~~G~kVlLId~D~~rp~aidql~~~~~~~gv~v~ 242 (481)
++|.+++++....+... .+|.+|+++|++||||||++++||.+|+++|++|+++++|+|||++++|+..|++..|++++
T Consensus 81 ~eL~~~L~~~~~~~~~~-~~p~vIlivG~~G~GKTTt~~kLA~~l~~~G~kVllv~~D~~R~aa~eqL~~~~~~~gvpv~ 159 (443)
T 3dm5_A 81 EELTKFLGTEAKPIEIK-EKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVF 159 (443)
T ss_dssp HHHHHHTTSSCCCCCCC-SSSEEEEEECCTTSSHHHHHHHHHHHHHTTTCCEEEEECCCSSTHHHHHHHHHHGGGTCEEE
T ss_pred HHHHHHhcCcccccccC-CCCeEEEEECcCCCCHHHHHHHHHHHHHHCCCeEEEEeCCCcchhHHHHHHHHHHhcCCcEE
Confidence 99999998743333332 36899999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCHHHHHHHHHHHHHcCCCcEEEEcCCCCccccHHHHHHHHhhhhccCCceEEEEEeCcchHHHHHHHHHhhhcC
Q 011624 243 TAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLNPTEVLLVVDAMTGQEAAALVTTFNIEI 322 (481)
Q Consensus 243 ~~~~~~~~~~~l~~~l~~~~~~~~D~VIIDt~G~~~~d~~~~~el~~i~~~~~p~~vvLVvda~~~~~~~~~~~~f~~~~ 322 (481)
..+...+|.+++++++..++.++||+|||||||+.+.+..++.++..+.....|+.++||+|+++++++.++++.|++.+
T Consensus 160 ~~~~~~dp~~i~~~al~~a~~~~~DvVIIDTaGrl~~d~~lm~el~~i~~~~~pd~vlLVvDA~~gq~a~~~a~~f~~~~ 239 (443)
T 3dm5_A 160 GNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAT 239 (443)
T ss_dssp CCTTCCCHHHHHHHHHHHHHHTTCSEEEEECCCCSSCCHHHHHHHHHHHHHHCCSEEEEEEEGGGGGGHHHHHHHHHHSC
T ss_pred ecCCCCCHHHHHHHHHHHHHhCCCCEEEEECCCcccchHHHHHHHHHHHHhhcCceEEEEEeCCCchhHHHHHHHHHhhC
Confidence 88888899999999999987678999999999999999999999999999999999999999999999999999999999
Q ss_pred CeeEEEEcCCCCCCchhHHHHHHHHhCCCeEEeecCCCCCCCCCcChhhHhhhhcCCchhHHHHHHHHHhhchhH--HHH
Q 011624 323 GITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILGMGDVLSFVEKAQEVMQQED--AEE 400 (481)
Q Consensus 323 ~i~GvIlnKvD~~~~~g~~~~~~~~~glPV~~ig~g~~v~dl~~f~~~~~~~r~lGlgd~~~lve~a~e~~~~~~--~~~ 400 (481)
++.|||+||+|+++++|.++++...+|+||.|+|+|++++||++|+|+++++++||+||+.+|+|++++..++++ . +
T Consensus 240 ~i~gVIlTKlD~~~~gG~~ls~~~~~g~PI~fig~Ge~vddL~~f~~~~~~~~llg~gd~~~l~e~~~~~~~~~~~~~-~ 318 (443)
T 3dm5_A 240 PIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKE-E 318 (443)
T ss_dssp TTEEEEEECCSSCSSHHHHHHHHHTTCCCEEEEECSSSTTCEEECCHHHHHHHHTTTTCHHHHHHHHHHHHTTHHHHH-H
T ss_pred CCeEEEEECCCCcccccHHHHHHHHHCCCEEEEEcCCChHHhhhCCHHHHHHHHcCCCcHHHHHHHHHHhhhhhHHHH-H
Confidence 999999999999999999999999999999999999999999999999999999999999999999999998775 5 4
Q ss_pred HHHhhhcccccHHHHHHHHhhhhccCCccccccCCCCCCC-ccccccchhhhcchhHHHHHHccChhhhccCCccccccc
Q 011624 401 MQKKIMSANFDFNDFLKQTRTVARMGSMSRVIGMIPGMGK-ITPAQVREAEKSLKIMEAMIEAMTPGIFFFSIIIIGLTF 479 (481)
Q Consensus 401 ~~~k~~~~~~dl~~l~~~~~~~~~~g~~~~~~~~~p~~~~-~~~~~~~d~a~~f~~~~~li~sm~~e~~~~~~l~~~~~~ 479 (481)
+.+++.+++|||+||++|++++.+||+++++++|+||+++ +........+..|+++++||+|||++|+.+|.|+++||+
T Consensus 319 ~~~k~~~~~f~l~d~~~q~~~~~kmg~~~~~~~m~pg~~~~~~~~~~~~~~~~~~~~~~ii~smt~~e~~~p~~~~~sr~ 398 (443)
T 3dm5_A 319 DIERFLRGKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGYSLPDDVISIGEERLKKFKVIMDSMTEEELLNPEIINYSRI 398 (443)
T ss_dssp HHHHHHTTCCCHHHHHHHHHHHHTTCC-------------------CCCCHHHHHHHHHHHTTSCHHHHHCGGGCCHHHH
T ss_pred HHHHHhhCCcCHHHHHHHHHHHHhccCHHHHHHHCCCchhhcchhhhhhhHHHHHHHHHHHHcCCHHHhcCchhcChHHH
Confidence 8889999999999999999999999999999999999873 433333445778899999999999999999999999998
Q ss_pred CC
Q 011624 480 KR 481 (481)
Q Consensus 480 ~~ 481 (481)
+|
T Consensus 399 ~r 400 (443)
T 3dm5_A 399 KR 400 (443)
T ss_dssp HH
T ss_pred HH
Confidence 86
|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >2jqe_A SRP54, signal recognition 54 kDa protein; AF54, structure, solution, signaling protein; NMR {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1hq1_A Signal recognition particle protein; protein-RNA complex, double helix, tetraloop, internal loop, SRP, ribonucleoprotein; HET: CCC; 1.52A {Escherichia coli} SCOP: a.36.1.1 PDB: 3lqx_A* 2pxb_A 2pxd_A 2pxe_A 2pxf_A 2pxk_A 2pxl_A 2pxp_A 2pxq_A 2pxt_A 2pxu_A 2pxv_A | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1mfq_C SRP54, signal recognition particle 54KDA protein; RNA-protein complex, A-minor motif, 3-helix junction, signaling protein/RNA complex; HET: CCC; 3.10A {Homo sapiens} SCOP: a.36.1.1 | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1qb2_A SRP54, human signal recognition particle 54 KD protein; alpha-helix, helix-turn-helix, signaling protein; 2.10A {Homo sapiens} SCOP: a.36.1.1 PDB: 1ry1_W* 2go5_W | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1dul_A Signal recognition particle protein (fifty-four homolog); protein-RNA complex, double helix, tetraloop, internal loop, SRP, ribonucleoprotein; HET: CCC; 1.80A {Escherichia coli} SCOP: a.36.1.1 PDB: 2xkv_C | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 481 | ||||
| d2qy9a2 | 211 | c.37.1.10 (A:285-495) GTPase domain of the signal | 4e-64 | |
| d1okkd2 | 207 | c.37.1.10 (D:97-303) GTPase domain of the signal r | 1e-63 | |
| d1ls1a2 | 207 | c.37.1.10 (A:89-295) GTPase domain of the signal s | 2e-61 | |
| d1j8yf2 | 211 | c.37.1.10 (F:87-297) GTPase domain of the signal s | 2e-60 | |
| d1vmaa2 | 213 | c.37.1.10 (A:82-294) GTPase domain of the signal r | 6e-60 | |
| d1khta_ | 190 | c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco | 9e-31 | |
| d1nksa_ | 194 | c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu | 8e-30 | |
| d1ls1a1 | 88 | a.24.13.1 (A:1-88) Signal sequence recognition pro | 3e-27 | |
| d1wgwa_ | 99 | a.24.13.1 (A:) Signal recognition particle 54 kDa | 7e-25 | |
| d1bifa1 | 213 | c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct | 3e-24 | |
| d1j8yf1 | 84 | a.24.13.1 (F:3-86) Signal sequence recognition pro | 3e-22 | |
| d1qzxa2 | 138 | a.36.1.1 (A:295-432) Signal sequence binding prote | 5e-17 | |
| d2i3ba1 | 189 | c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 | 4e-11 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 6e-10 | |
| d1hq1a_ | 104 | a.36.1.1 (A:) Signal sequence binding protein Ffh | 2e-09 | |
| d1qb2a_ | 107 | a.36.1.1 (A:) SRP54M {Human (Homo sapiens) [TaxId: | 4e-09 | |
| d2ffha2 | 100 | a.36.1.1 (A:319-418) Signal sequence binding prote | 3e-07 | |
| d1hyqa_ | 232 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 1e-05 | |
| d1ihua1 | 296 | c.37.1.10 (A:1-296) Arsenite-translocating ATPase | 2e-05 | |
| d1g3qa_ | 237 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 2e-05 | |
| d1rz3a_ | 198 | c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci | 5e-05 | |
| d1ihua2 | 279 | c.37.1.10 (A:308-586) Arsenite-translocating ATPas | 9e-05 | |
| d1m8pa3 | 183 | c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d | 1e-04 | |
| d1cp2a_ | 269 | c.37.1.10 (A:) Nitrogenase iron protein {Clostridi | 1e-04 | |
| d1x6va3 | 195 | c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin | 1e-04 | |
| d1odfa_ | 286 | c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' | 2e-04 | |
| d1a7ja_ | 288 | c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph | 3e-04 | |
| d1qf9a_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi | 3e-04 | |
| d2vp4a1 | 197 | c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr | 5e-04 | |
| d1np6a_ | 170 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 5e-04 | |
| d1uj2a_ | 213 | c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho | 7e-04 | |
| d2afhe1 | 289 | c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot | 8e-04 | |
| d1gsia_ | 208 | c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tu | 8e-04 | |
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 0.001 | |
| d1ukza_ | 196 | c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac | 0.001 | |
| d1sq5a_ | 308 | c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi | 0.001 | |
| d1nn5a_ | 209 | c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapi | 0.002 | |
| d1byia_ | 224 | c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi | 0.002 | |
| d1xjca_ | 165 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 0.003 | |
| d1m7ga_ | 208 | c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (A | 0.003 | |
| d1e9ra_ | 433 | c.37.1.11 (A:) Bacterial conjugative coupling prot | 0.003 | |
| d4tmka_ | 210 | c.37.1.1 (A:) Thymidylate kinase {Escherichia coli | 0.004 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 0.004 |
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Length = 211 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: GTPase domain of the signal recognition particle receptor FtsY species: Escherichia coli [TaxId: 562]
Score = 204 bits (521), Expect = 4e-64
Identities = 89/209 (42%), Positives = 124/209 (59%), Gaps = 6/209 (2%)
Query: 176 LVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGE 235
L P VIL+ G+ GVGKTT KLA ++QGKS ML AGD +R AA++QL + G+
Sbjct: 2 LNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQ 61
Query: 236 QVGVPVYTAGTEVKPSQIAKQGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLN 295
+ +PV T + + ++ AK +N+DV+I DTAGRLQ +M+ELK + RV+
Sbjct: 62 RNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMK 121
Query: 296 ------PTEVLLVVDAMTGQEAAALVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSG 349
P EV+L +DA TGQ A + F+ +G+TG LTKLDG ++GG SV + G
Sbjct: 122 KLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFG 181
Query: 350 KPIKLVGRGERMEDLEPFYPDRMAGRILG 378
PI+ +G GER+EDL PF D +
Sbjct: 182 IPIRYIGVGERIEDLRPFKADDFIEALFA 210
|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 | Back information, alignment and structure |
|---|
| >d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 84 | Back information, alignment and structure |
|---|
| >d1qzxa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 138 | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qb2a_ a.36.1.1 (A:) SRP54M {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ffha2 a.36.1.1 (A:319-418) Signal sequence binding protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 100 | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 208 | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 209 | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 208 | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Length = 433 | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 481 | |||
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 100.0 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 100.0 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 100.0 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 100.0 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 100.0 | |
| d1ls1a1 | 88 | Signal sequence recognition protein Ffh {Thermus a | 99.69 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 99.65 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 99.64 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 99.63 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 99.59 | |
| d1qzxa2 | 138 | Signal sequence binding protein Ffh {Archaeon Sulf | 99.58 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 99.54 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.52 | |
| d1j8yf1 | 84 | Signal sequence recognition protein Ffh {Archaeon | 99.49 | |
| d1wgwa_ | 99 | Signal recognition particle 54 kDa protein, SRP54 | 99.42 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.37 | |
| d1hq1a_ | 104 | Signal sequence binding protein Ffh {Escherichia c | 99.25 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 99.23 | |
| d2ffha2 | 100 | Signal sequence binding protein Ffh {Thermus aquat | 99.2 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 99.14 | |
| d1qb2a_ | 107 | SRP54M {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.91 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.89 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 98.74 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 98.59 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 98.56 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.53 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 98.43 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.36 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 98.34 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 98.25 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.2 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.14 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 98.14 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 98.13 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 98.11 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 98.06 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 98.05 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 98.02 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 97.99 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 97.9 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.82 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 97.81 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.79 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 97.78 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.77 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.76 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.74 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 97.72 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 97.69 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.66 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.62 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.61 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 97.6 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 97.57 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.56 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 97.51 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.5 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.49 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.48 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.46 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.46 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 97.46 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.45 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.41 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 97.33 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 97.31 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.29 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.25 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 97.24 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 97.23 | |
| d1vmaa1 | 81 | Signal recognition particle receptor, FtsY {Thermo | 97.2 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 97.2 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.2 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 97.19 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 97.17 | |
| d1dula_ | 69 | Signal sequence binding protein Ffh {Escherichia c | 97.15 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.09 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 97.09 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 97.07 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.06 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.05 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.02 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.01 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 96.96 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.93 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.92 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.91 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.89 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.88 | |
| d2qy9a1 | 84 | Signal recognition particle receptor, FtsY {Escher | 96.88 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.82 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.8 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 96.79 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.77 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.75 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.75 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 96.74 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.71 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.68 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.67 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.64 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 96.61 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.61 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.58 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.57 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.53 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.5 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.5 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.47 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.46 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.44 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.43 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.43 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 96.4 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.4 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.4 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.39 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 96.36 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 96.34 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.34 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.33 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 96.32 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.32 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 96.3 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.3 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.29 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.27 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.25 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.24 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.24 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.23 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 96.2 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.16 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.14 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.09 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 96.09 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 96.08 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.06 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.04 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.01 | |
| d1okkd1 | 58 | Signal recognition particle receptor, FtsY {Thermu | 95.99 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.96 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 95.95 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 95.93 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 95.91 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 95.9 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 95.88 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.87 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 95.85 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.85 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 95.81 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.77 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 95.74 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.74 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.73 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.7 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.68 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.67 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 95.67 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.66 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.63 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 95.62 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 95.59 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 95.56 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 95.54 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 95.51 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 95.5 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.49 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 95.45 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 95.42 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.42 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.4 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 95.38 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.36 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.36 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 95.32 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.3 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 95.29 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.29 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 95.23 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.15 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.14 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 95.09 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.06 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.04 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.02 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.97 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.95 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 94.93 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.93 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 94.92 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.84 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.83 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 94.73 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.71 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.65 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.58 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.57 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.56 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.56 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 94.5 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.47 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.47 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 94.45 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 94.3 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.23 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 94.2 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 93.99 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 93.98 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 93.96 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 93.81 | |
| d2g0ta1 | 338 | Hypothetical protein TM0796 {Thermotoga maritima [ | 93.5 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.47 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.8 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 92.35 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.21 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 92.16 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 91.98 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 91.95 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.89 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 91.88 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.82 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 91.81 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.7 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 91.7 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 91.51 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 91.36 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.36 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 91.33 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.28 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.27 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 91.22 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.12 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.03 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 90.98 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.92 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 90.77 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 90.63 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 90.53 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 90.48 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 90.46 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 90.43 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 90.14 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.1 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 89.93 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 89.47 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.37 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 89.14 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 88.96 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 88.84 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 88.74 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 88.62 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 88.53 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 88.41 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 88.38 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 88.05 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 87.74 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 87.68 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 87.59 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 87.51 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 87.5 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 87.49 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.42 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 87.37 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.3 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.26 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 87.24 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 87.15 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 86.77 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 86.65 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 86.55 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 86.52 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 86.44 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 86.32 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 86.31 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 86.3 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 86.12 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 85.87 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 85.44 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 85.25 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.15 | |
| d1j6ua3 | 207 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 84.99 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 84.86 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 84.82 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 84.7 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 84.65 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 84.33 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 84.28 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 84.15 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 84.05 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 83.89 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 83.04 | |
| d1p3da3 | 215 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 82.28 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.15 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 82.0 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 81.97 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 81.85 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 81.33 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 81.01 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 80.98 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 80.85 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 80.78 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 80.73 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 80.67 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 80.33 |
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: GTPase domain of the signal recognition particle receptor FtsY species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=6.4e-41 Score=316.20 Aligned_cols=203 Identities=44% Similarity=0.726 Sum_probs=190.8
Q ss_pred ccccCCCCEEEEEEcCCCCCHHHHHHHHHHHHHHcCCeEEEEeccCCchhHHHHHHHhhhhcCCCeecCCCCCCHHHHHH
Q 011624 176 LVFAKSRPTVILLAGLQGVGKTTVSAKLANYLKKQGKSCMLVAGDVYRPAAIDQLVILGEQVGVPVYTAGTEVKPSQIAK 255 (481)
Q Consensus 176 ~~~~~~~~~VI~i~G~~GvGKTTta~~LA~~L~~~G~kVlLId~D~~rp~aidql~~~~~~~gv~v~~~~~~~~~~~~l~ 255 (481)
++.+.++|.||+++|++||||||+++|||++++++|++|.+|++|+||+++++||+.|++..|++++......++...++
T Consensus 2 l~~~~~~p~vi~lvGptGvGKTTTiAKLA~~~~~~g~kV~lit~Dt~R~gA~eQL~~~a~~l~v~~~~~~~~~d~~~~l~ 81 (211)
T d2qy9a2 2 LNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIF 81 (211)
T ss_dssp CCCCSCTTEEEEEECCTTSCHHHHHHHHHHHHHTTTCCEEEECCCTTCHHHHHHHHHHHHHTTCCEECCSTTCCHHHHHH
T ss_pred CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCcEEEEecccccccchhhhhhhhhhcCCcccccccCCCHHHHHH
Confidence 44556779999999999999999999999999999999999999999999999999999999999999888889999999
Q ss_pred HHHHHHHcCCCcEEEEcCCCCccccHHHHHHHHhhhhccC------CceEEEEEeCcchHHHHHHHHHhhhcCCeeEEEE
Q 011624 256 QGLEEAKKKNVDVVIVDTAGRLQIDKAMMDELKDVKRVLN------PTEVLLVVDAMTGQEAAALVTTFNIEIGITGAIL 329 (481)
Q Consensus 256 ~~l~~~~~~~~D~VIIDt~G~~~~d~~~~~el~~i~~~~~------p~~vvLVvda~~~~~~~~~~~~f~~~~~i~GvIl 329 (481)
+.++.++.+++|+|||||||+++.+..++.|+.++...+. |.+++||+|++++++....+..|...+++.|+|+
T Consensus 82 ~~~~~a~~~~~d~ilIDTaGr~~~d~~~~~el~~l~~~~~~~~~~~p~~~~LVl~a~~~~~~~~~~~~~~~~~~~~~lIl 161 (211)
T d2qy9a2 82 DAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITL 161 (211)
T ss_dssp HHHHHHHHTTCSEEEECCCCCGGGHHHHHHHHHHHHHHHTTTCTTCCSEEEEEEEGGGTHHHHHHHHHHHHHSCCCEEEE
T ss_pred HHHHHHHHcCCCEEEeccCCCccccHHHHHHHHHHHHHHhhhcccCcceeeeehhcccCcchHHHHhhhhhccCCceEEE
Confidence 9888877789999999999999999999999999987764 7899999999999988888888877899999999
Q ss_pred cCCCCCCchhHHHHHHHHhCCCeEEeecCCCCCCCCCcChhhHhhhhcC
Q 011624 330 TKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDLEPFYPDRMAGRILG 378 (481)
Q Consensus 330 nKvD~~~~~g~~~~~~~~~glPV~~ig~g~~v~dl~~f~~~~~~~r~lG 378 (481)
||+|++.++|.++++...+++||.|+++||+++||++|+|+++++++||
T Consensus 162 TKlDe~~~~G~~l~~~~~~~~Pi~~i~~Gq~v~Dl~~~~~~~~~~~llg 210 (211)
T d2qy9a2 162 TKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFA 210 (211)
T ss_dssp ECCTTCTTTTHHHHHHHHHCCCEEEEECSSSGGGEEECCHHHHHHHHHC
T ss_pred eecCCCCCccHHHHHHHHHCCCEEEEeCCCCcccCccCCHHHHHHHHhC
Confidence 9999999999999999999999999999999999999999999999987
|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ls1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qzxa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf1 a.24.13.1 (F:3-86) Signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1wgwa_ a.24.13.1 (A:) Signal recognition particle 54 kDa protein, SRP54 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ffha2 a.36.1.1 (A:319-418) Signal sequence binding protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qb2a_ a.36.1.1 (A:) SRP54M {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dula_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a1 a.24.13.1 (A:201-284) Signal recognition particle receptor, FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|