Citrus Sinensis ID: 011650

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA
ccEEEEEccccccHHHHHHccccccccEEEEEEccHHHHHHHcccccccccccHHHHHHHHccccccccccHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHccccccEEEccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccccccccccccccccccccEEEEccHHHHHccccEEEEEccccccccccHHHHHHHcccccEEEEccccccHHHHHHcccEEEEEccccccccccccccc
ccEEEEEEcccccccHHHHHHHHccccEEEEEEccHHHHHHHHcccccEccccHHHHHHHHHccccEEEccHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHccccccEEEEccHHHHHHcHHHHHHccccEEEEEcccccccHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccccccccccccccccccEEEEccHHHHHccccEEEEEEcHHHHccccHHHHHHHHcccEEEEEccccccHHHHHHcccEEEEEccccccccccccccc
mvkiccigagyvggpTMAVIALKCPSIEVAVVdisvprinawnsdqlpiyepgLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVntptktqglgagkaadLTYWESAARMIADVsksdkivvekstvpvkTAEAIEKILMHnsrginfqilsnpeflaegtaindlfkpdrvliggretpEGMKAIKALKDVYahwvpedrilCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATgadvsqvshaigfdsrigpkflnasvgfggscfqkDILNLVYICecnglpevANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAfkkdtgdtretpaidvckglmgdkarlsiydpqvpqehiqrdlqmnkfdwdhpihlqptspstinqVIVASdayeatkdshgvciltewdefknldYQKIYNNmqkpafvfdgrnildVEKLRKIGFIVYSIGkpldkwlkdmpava
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFvsvntptktqglgagkaADLTYWESAARMIAdvsksdkivvekstvpvktAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMfntvsgkkIAILGfafkkdtgdtretPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIvysigkpldkwlkdmpava
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA
**KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWL*******
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWL**M****
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLD***KD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query480 2.2.26 [Sep-21-2011]
Q9LIA8480 Probable UDP-glucose 6-de no no 1.0 1.0 0.872 0.0
Q96558480 UDP-glucose 6-dehydrogena no no 1.0 1.0 0.885 0.0
Q9FM01480 Probable UDP-glucose 6-de no no 0.995 0.995 0.868 0.0
O02373476 UDP-glucose 6-dehydrogena yes no 0.960 0.968 0.627 1e-174
O70475493 UDP-glucose 6-dehydrogena yes no 0.95 0.924 0.621 1e-169
Q5F3T9494 UDP-glucose 6-dehydrogena yes no 0.95 0.923 0.619 1e-169
O60701494 UDP-glucose 6-dehydrogena yes no 0.95 0.923 0.623 1e-168
P12378494 UDP-glucose 6-dehydrogena yes no 0.95 0.923 0.619 1e-168
O70199493 UDP-glucose 6-dehydrogena yes no 0.95 0.924 0.615 1e-168
Q5R7B3494 UDP-glucose 6-dehydrogena yes no 0.95 0.923 0.621 1e-167
>sp|Q9LIA8|UGDH1_ARATH Probable UDP-glucose 6-dehydrogenase 1 OS=Arabidopsis thaliana GN=UGD1 PE=1 SV=1 Back     alignment and function desciption
 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/480 (87%), Positives = 456/480 (95%)

Query: 1   MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ 60
           MVKICCIGAGYVGGPTMAVIALKCP +EVAVVDISVPRINAWNSD LPIYEPGL++VVKQ
Sbjct: 1   MVKICCIGAGYVGGPTMAVIALKCPDVEVAVVDISVPRINAWNSDTLPIYEPGLDDVVKQ 60

Query: 61  CRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120
           CRGKNLFFSTDVEKHVREA+IVFVSVNTPTKT+GLGAGKAADLTYWESAARMIADVS SD
Sbjct: 61  CRGKNLFFSTDVEKHVREADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSVSD 120

Query: 121 KIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRE 180
           KIVVEKSTVPVKTAEAIEKIL HNS+GI FQILSNPEFLAEGTAI DLF PDRVLIGGRE
Sbjct: 121 KIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIKDLFNPDRVLIGGRE 180

Query: 181 TPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEAT 240
           TPEG KA++ LK+VYAHWVPE +I+ TNLWSAE+SKLAANAFLAQRISSVNAMSALCEAT
Sbjct: 181 TPEGFKAVQTLKNVYAHWVPEGQIITTNLWSAELSKLAANAFLAQRISSVNAMSALCEAT 240

Query: 241 GADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI 300
           GADV+QVS+A+G DSRIGPKFLN+SVGFGGSCFQKDILNLVYICECNGLPEVA YWKQVI
Sbjct: 241 GADVTQVSYAVGTDSRIGPKFLNSSVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVI 300

Query: 301 KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARL 360
           K+NDYQK+RFVNRVVSSMFN+VS KKIA+LGFAFKKDTGDTRETPAIDVCKGL+ DKARL
Sbjct: 301 KINDYQKSRFVNRVVSSMFNSVSNKKIAVLGFAFKKDTGDTRETPAIDVCKGLLEDKARL 360

Query: 361 SIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILT 420
           SIYDPQV ++ IQRDL MNKFDWDHP+HLQP SP+T+ QV V  DAYEATKD+HG+CI+T
Sbjct: 361 SIYDPQVTEDQIQRDLSMNKFDWDHPLHLQPMSPTTVKQVTVTWDAYEATKDAHGICIMT 420

Query: 421 EWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA 480
           EWDEFKNLD+QKI++NMQKPAFVFDGRNI++++KLR+IGFIVYSIGKPLD WLKDMPAVA
Sbjct: 421 EWDEFKNLDFQKIFDNMQKPAFVFDGRNIMNLQKLREIGFIVYSIGKPLDDWLKDMPAVA 480
Provides UDP-glucuronic acid for hemicellulose precursors.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 2
>sp|Q96558|UGDH_SOYBN UDP-glucose 6-dehydrogenase OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q9FM01|UGDH2_ARATH Probable UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=2 SV=1 Back     alignment and function description
>sp|O02373|UGDH_DROME UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=1 SV=1 Back     alignment and function description
>sp|O70475|UGDH_MOUSE UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugdh PE=1 SV=1 Back     alignment and function description
>sp|Q5F3T9|UGDH_CHICK UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UGDH PE=2 SV=1 Back     alignment and function description
>sp|O60701|UGDH_HUMAN UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGDH PE=1 SV=1 Back     alignment and function description
>sp|P12378|UGDH_BOVIN UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH PE=1 SV=2 Back     alignment and function description
>sp|O70199|UGDH_RAT UDP-glucose 6-dehydrogenase OS=Rattus norvegicus GN=Ugdh PE=1 SV=1 Back     alignment and function description
>sp|Q5R7B3|UGDH_PONAB UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGDH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
225423507480 PREDICTED: UDP-glucose 6-dehydrogenase-l 1.0 1.0 0.904 0.0
283488487480 UDP-D-glucose dehydrogenase [Gossypium h 1.0 1.0 0.897 0.0
40317278480 UDP-glucose dehydrogenase [Cinnamomum os 1.0 1.0 0.891 0.0
297832836480 hypothetical protein ARALYDRAFT_896165 [ 1.0 1.0 0.885 0.0
225452968480 PREDICTED: UDP-glucose 6-dehydrogenase [ 1.0 1.0 0.897 0.0
283488489480 UDP-D-glucose dehydrogenase [Gossypium h 1.0 1.0 0.891 0.0
255547257480 UDP-glucose 6-dehydrogenase, putative [R 1.0 1.0 0.893 0.0
255542070480 UDP-glucose 6-dehydrogenase, putative [R 1.0 1.0 0.885 0.0
255542080480 UDP-glucose 6-dehydrogenase, putative [R 1.0 1.0 0.891 0.0
48093459524 putative UDP-glucose dehydrogenase 2 [Ni 0.993 0.910 0.893 0.0
>gi|225423507|ref|XP_002269692.1| PREDICTED: UDP-glucose 6-dehydrogenase-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/480 (90%), Positives = 457/480 (95%)

Query: 1   MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ 60
           MVKICCIGAGYVGGPTMAVIALKCP IEVAVVDISV RINAWNSDQLPIYEPGL+EVVKQ
Sbjct: 1   MVKICCIGAGYVGGPTMAVIALKCPDIEVAVVDISVGRINAWNSDQLPIYEPGLDEVVKQ 60

Query: 61  CRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120
           CRGKNLFFSTDVEKHV EA+IVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD
Sbjct: 61  CRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120

Query: 121 KIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRE 180
           KIVVEKSTVPVKTAEAIEKIL HNS+GINFQILSNPEFLAEGTAI DLF PDRVLIGGRE
Sbjct: 121 KIVVEKSTVPVKTAEAIEKILTHNSKGINFQILSNPEFLAEGTAIQDLFNPDRVLIGGRE 180

Query: 181 TPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEAT 240
           TPEG KAIKAL+DVYAHWVP +RI+CTNLWSAE+SKLAANAFLAQRISSVNAMSALCEAT
Sbjct: 181 TPEGQKAIKALRDVYAHWVPVERIICTNLWSAELSKLAANAFLAQRISSVNAMSALCEAT 240

Query: 241 GADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI 300
           GADV++VSHA+G D+RIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI
Sbjct: 241 GADVTEVSHAVGKDTRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI 300

Query: 301 KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARL 360
           KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGL+GDKA L
Sbjct: 301 KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLLGDKAHL 360

Query: 361 SIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILT 420
           SIYDPQV  E IQRDL M KFDWDHPIHLQP SP+++ QV V  DAY ATKD+HG+CILT
Sbjct: 361 SIYDPQVSGEQIQRDLAMKKFDWDHPIHLQPLSPTSVKQVSVVWDAYTATKDAHGICILT 420

Query: 421 EWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA 480
           EWDEFK+LDY+KIY+NMQKPAFVFDGRN++D EKLR+IGFIVYSIGKPLD WLKDMPAVA
Sbjct: 421 EWDEFKSLDYKKIYDNMQKPAFVFDGRNVVDAEKLREIGFIVYSIGKPLDAWLKDMPAVA 480

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|283488487|gb|ADB24765.1| UDP-D-glucose dehydrogenase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|40317278|gb|AAR84297.1| UDP-glucose dehydrogenase [Cinnamomum osmophloeum] Back     alignment and taxonomy information
>gi|297832836|ref|XP_002884300.1| hypothetical protein ARALYDRAFT_896165 [Arabidopsis lyrata subsp. lyrata] gi|297330140|gb|EFH60559.1| hypothetical protein ARALYDRAFT_896165 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225452968|ref|XP_002284346.1| PREDICTED: UDP-glucose 6-dehydrogenase [Vitis vinifera] gi|147778657|emb|CAN62897.1| hypothetical protein VITISV_020300 [Vitis vinifera] Back     alignment and taxonomy information
>gi|283488489|gb|ADB24766.1| UDP-D-glucose dehydrogenase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255547257|ref|XP_002514686.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] gi|223546290|gb|EEF47792.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542070|ref|XP_002512099.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] gi|223549279|gb|EEF50768.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542080|ref|XP_002512104.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] gi|223549284|gb|EEF50773.1| UDP-glucose 6-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|48093459|gb|AAT40106.1| putative UDP-glucose dehydrogenase 2 [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
TAIR|locus:2180872480 UGD3 "UDP-glucose dehydrogenas 1.0 1.0 0.879 1.7e-233
TAIR|locus:2093827480 UGD2 "UDP-glucose dehydrogenas 1.0 1.0 0.872 1.5e-232
TAIR|locus:2157275480 UDG4 "UDP-glucose dehydrogenas 0.995 0.995 0.868 3.3e-230
TAIR|locus:2197945481 UGD1 "UDP-glucose dehydrogenas 1.0 0.997 0.844 4.1e-223
FB|FBgn0261445476 sgl "sugarless" [Drosophila me 0.952 0.960 0.632 3.3e-157
UNIPROTKB|I3LIM2494 UGDH "UDP-glucose 6-dehydrogen 0.95 0.923 0.626 1.3e-153
UNIPROTKB|E2R311494 UGDH "UDP-glucose 6-dehydrogen 0.95 0.923 0.626 5.8e-153
MGI|MGI:1306785493 Ugdh "UDP-glucose dehydrogenas 0.95 0.924 0.626 5.8e-153
UNIPROTKB|Q5F3T9494 UGDH "UDP-glucose 6-dehydrogen 0.95 0.923 0.619 7.4e-153
UNIPROTKB|O60701494 UGDH "UDP-glucose 6-dehydrogen 0.95 0.923 0.623 9.5e-153
TAIR|locus:2180872 UGD3 "UDP-glucose dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2252 (797.8 bits), Expect = 1.7e-233, P = 1.7e-233
 Identities = 422/480 (87%), Positives = 456/480 (95%)

Query:     1 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ 60
             MVKICCIGAGYVGGPTMAVIALKCPS+EVAVVDISVPRINAWNSDQLPIYEPGL++VVKQ
Sbjct:     1 MVKICCIGAGYVGGPTMAVIALKCPSVEVAVVDISVPRINAWNSDQLPIYEPGLDDVVKQ 60

Query:    61 CRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120
             CRGKNLFFSTDVEKHVREA+IVFVSVNTPTKT+GLGAGKAADLTYWESAARMIADVS SD
Sbjct:    61 CRGKNLFFSTDVEKHVREADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSVSD 120

Query:   121 KIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRE 180
             KIVVEKSTVPVKTAEAIEKIL HNS+GI FQILSNPEFLAEGTAI DLF PDRVLIGGRE
Sbjct:   121 KIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIEDLFMPDRVLIGGRE 180

Query:   181 TPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEAT 240
             T EG  A+KALKD+YA WVPE+RIL TNLWSAE+SKLAANAFLAQRISSVNAMSALCEAT
Sbjct:   181 TTEGFAAVKALKDIYAQWVPEERILTTNLWSAELSKLAANAFLAQRISSVNAMSALCEAT 240

Query:   241 GADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI 300
             GA+VS+VS+A+G DSRIGPKFLN+SVGFGGSCFQKDILNLVYICECNGLPEVA YWKQVI
Sbjct:   241 GANVSEVSYAVGKDSRIGPKFLNSSVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVI 300

Query:   301 KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARL 360
             K+NDYQKTRFVNR+VSSMFNTVS KKIA+LGFAFKKDTGDTRETPAIDVCKGL+GDKARL
Sbjct:   301 KINDYQKTRFVNRIVSSMFNTVSNKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKARL 360

Query:   361 SIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILT 420
             SIYDPQV +E IQRDL MNKFDWDHP+HLQP SP+T+ QV VA DAY ATKD+HG+CILT
Sbjct:   361 SIYDPQVTEEQIQRDLTMNKFDWDHPLHLQPMSPTTVKQVSVAWDAYTATKDAHGICILT 420

Query:   421 EWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMPAVA 480
             EWDEFK LD+Q+I+ NMQKPAFVFDGRN++D +KLR+IGFIVYSIGKPLD+WLKDMPA+A
Sbjct:   421 EWDEFKKLDFQRIFENMQKPAFVFDGRNVVDADKLREIGFIVYSIGKPLDQWLKDMPALA 480
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003979 "UDP-glucose 6-dehydrogenase activity" evidence=IGI;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0005975 "carbohydrate metabolic process" evidence=IGI
GO:0052546 "cell wall pectin metabolic process" evidence=IGI
GO:0042732 "D-xylose metabolic process" evidence=RCA
TAIR|locus:2093827 UGD2 "UDP-glucose dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157275 UDG4 "UDP-glucose dehydrogenase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197945 UGD1 "UDP-glucose dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0261445 sgl "sugarless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LIM2 UGDH "UDP-glucose 6-dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R311 UGDH "UDP-glucose 6-dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1306785 Ugdh "UDP-glucose dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3T9 UGDH "UDP-glucose 6-dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60701 UGDH "UDP-glucose 6-dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96558UGDH_SOYBN1, ., 1, ., 1, ., 2, 20.88541.01.0nono
O86422UDG_PSEAE1, ., 1, ., 1, ., 2, 20.32700.90200.9558yesno
Q9LIA8UGDH1_ARATH1, ., 1, ., 1, ., 2, 20.87291.01.0nono
O05973UDG_RICPR1, ., 1, ., 1, ., 2, 20.33760.89160.9861yesno
O32271TUAD_BACSU1, ., 1, ., 1, ., 2, 20.35780.90830.9457yesno
O60701UGDH_HUMAN1, ., 1, ., 1, ., 2, 20.62390.950.9230yesno
Q5F3T9UGDH_CHICK1, ., 1, ., 1, ., 2, 20.61960.950.9230yesno
Q92GB1UDG_RICCN1, ., 1, ., 1, ., 2, 20.34530.89160.9907yesno
Q1RKF8UDG_RICBR1, ., 1, ., 1, ., 2, 20.33260.89580.9907yesno
Q68VX0UDG_RICTY1, ., 1, ., 1, ., 2, 20.34240.88750.9815yesno
Q4UK39UDG_RICFE1, ., 1, ., 1, ., 2, 20.34240.89790.9620yesno
P12378UGDH_BOVIN1, ., 1, ., 1, ., 2, 20.61960.950.9230yesno
Q5R7B3UGDH_PONAB1, ., 1, ., 1, ., 2, 20.62170.950.9230yesno
Q19905UGDH_CAEEL1, ., 1, ., 1, ., 2, 20.56440.95200.9501yesno
Q9FM01UGDH2_ARATH1, ., 1, ., 1, ., 2, 20.86820.99580.9958nono
O54068UDG_RHIME1, ., 1, ., 1, ., 2, 20.35820.90410.9931yesno
O02373UGDH_DROME1, ., 1, ., 1, ., 2, 20.62710.96040.9684yesno
O70475UGDH_MOUSE1, ., 1, ., 1, ., 2, 20.62170.950.9249yesno
D4GYH5AGLM_HALVD1, ., 1, ., 1, ., 2, 20.31840.85830.9581yesno
O70199UGDH_RAT1, ., 1, ., 1, ., 2, 20.61530.950.9249yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.998
4th Layer1.1.1.220.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_300135.1
annotation not avaliable (480 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
PLN02353473 PLN02353, PLN02353, probable UDP-glucose 6-dehydro 0.0
COG1004414 COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenas 1e-128
TIGR03026409 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrog 1e-114
pfam03721188 pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose 6e-71
COG0677436 COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate de 3e-50
pfam0098496 pfam00984, UDPG_MGDP_dh, UDP-glucose/GDP-mannose d 9e-41
pfam03720103 pfam03720, UDPG_MGDP_dh_C, UDP-glucose/GDP-mannose 2e-35
smart0098499 smart00984, UDPG_MGDP_dh_C, UDP binding domain 3e-30
PRK11064415 PRK11064, wecC, UDP-N-acetyl-D-mannosamine dehydro 6e-26
PRK15057388 PRK15057, PRK15057, UDP-glucose 6-dehydrogenase; P 3e-22
PRK15182425 PRK15182, PRK15182, Vi polysaccharide biosynthesis 2e-16
>gnl|CDD|177986 PLN02353, PLN02353, probable UDP-glucose 6-dehydrogenase Back     alignment and domain information 
 Score = 1062 bits (2749), Expect = 0.0
 Identities = 426/473 (90%), Positives = 450/473 (95%)

Query: 1   MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ 60
           MVKICCIGAGYVGGPTMAVIALKCP IEV VVDISVPRI+AWNSDQLPIYEPGL+EVVKQ
Sbjct: 1   MVKICCIGAGYVGGPTMAVIALKCPDIEVVVVDISVPRIDAWNSDQLPIYEPGLDEVVKQ 60

Query: 61  CRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120
           CRGKNLFFSTDVEKHV EA+IVFVSVNTPTKT+GLGAGKAADLTYWESAARMIADVSKSD
Sbjct: 61  CRGKNLFFSTDVEKHVAEADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSD 120

Query: 121 KIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLAEGTAINDLFKPDRVLIGGRE 180
           KIVVEKSTVPVKTAEAIEKIL HNS+GINFQILSNPEFLAEGTAI DLFKPDRVLIGGRE
Sbjct: 121 KIVVEKSTVPVKTAEAIEKILTHNSKGINFQILSNPEFLAEGTAIEDLFKPDRVLIGGRE 180

Query: 181 TPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEAT 240
           TPEG KA++ALKDVYAHWVPE+RI+ TNLWSAE+SKLAANAFLAQRISSVNAMSALCEAT
Sbjct: 181 TPEGQKAVQALKDVYAHWVPEERIITTNLWSAELSKLAANAFLAQRISSVNAMSALCEAT 240

Query: 241 GADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVI 300
           GADVSQVSHA+G DSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVA YWKQVI
Sbjct: 241 GADVSQVSHAVGKDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVI 300

Query: 301 KVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARL 360
           K+NDYQK+RFVNRVVSSMFNTVSGKKIA+LGFAFKKDTGDTRETPAIDVCKGL+GDKA+L
Sbjct: 301 KMNDYQKSRFVNRVVSSMFNTVSGKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKAKL 360

Query: 361 SIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILT 420
           SIYDPQV +E IQRDL MNKFDWDHP HLQP SP+ + QV V  DAYEATK +HG+CILT
Sbjct: 361 SIYDPQVTEEQIQRDLSMNKFDWDHPRHLQPMSPTAVKQVSVVWDAYEATKGAHGICILT 420

Query: 421 EWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWL 473
           EWDEFK LDYQKIY+NMQKPAFVFDGRN+LD EKLR+IGFIVYSIGKPLD WL
Sbjct: 421 EWDEFKTLDYQKIYDNMQKPAFVFDGRNVLDHEKLREIGFIVYSIGKPLDPWL 473

Length = 473
>gnl|CDD|223936 COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234094 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase Back     alignment and domain information
>gnl|CDD|217692 pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>gnl|CDD|223749 COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|201536 pfam00984, UDPG_MGDP_dh, UDP-glucose/GDP-mannose dehydrogenase family, central domain Back     alignment and domain information
>gnl|CDD|217691 pfam03720, UDPG_MGDP_dh_C, UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain Back     alignment and domain information
>gnl|CDD|214954 smart00984, UDPG_MGDP_dh_C, UDP binding domain Back     alignment and domain information
>gnl|CDD|182940 PRK11064, wecC, UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185017 PRK15057, PRK15057, UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185104 PRK15182, PRK15182, Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 480
PLN02353473 probable UDP-glucose 6-dehydrogenase 100.0
KOG2666481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 100.0
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 100.0
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 100.0
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 100.0
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 100.0
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 100.0
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 100.0
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 100.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.98
PLN02858 1378 fructose-bisphosphate aldolase 99.97
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.96
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.96
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.96
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.96
PRK15059292 tartronate semialdehyde reductase; Provisional 99.96
KOG0409327 consensus Predicted dehydrogenase [General functio 99.95
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 99.94
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 99.93
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.93
PLN02858 1378 fructose-bisphosphate aldolase 99.93
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 99.93
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.91
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.91
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.89
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.88
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.85
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.84
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.83
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.83
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.8
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.78
PRK09287459 6-phosphogluconate dehydrogenase; Validated 99.77
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.77
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.76
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.75
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.74
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.73
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.73
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.73
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.72
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.72
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.71
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.69
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.67
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.67
PRK08507275 prephenate dehydrogenase; Validated 99.66
PRK07417279 arogenate dehydrogenase; Reviewed 99.66
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.65
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.64
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.63
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.62
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.62
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.62
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.62
PLN02712 667 arogenate dehydrogenase 99.61
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.6
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.59
PRK08655437 prephenate dehydrogenase; Provisional 99.59
PRK11730715 fadB multifunctional fatty acid oxidation complex 99.52
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.51
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.51
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.5
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 99.5
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.48
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.48
PLN02688266 pyrroline-5-carboxylate reductase 99.47
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.47
PRK11154708 fadJ multifunctional fatty acid oxidation complex 99.47
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.45
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.44
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.43
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.4
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.38
PRK06545359 prephenate dehydrogenase; Validated 99.37
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.37
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.37
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.36
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.32
PLN02256304 arogenate dehydrogenase 99.28
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 99.28
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.28
PRK07680273 late competence protein ComER; Validated 99.27
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.24
PLN02712667 arogenate dehydrogenase 99.2
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.2
PRK08818370 prephenate dehydrogenase; Provisional 99.19
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.17
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.15
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.14
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.13
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.13
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.09
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.05
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.02
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.01
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.98
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.97
COG2085211 Predicted dinucleotide-binding enzymes [General fu 98.96
PRK05479330 ketol-acid reductoisomerase; Provisional 98.93
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.92
PRK12480330 D-lactate dehydrogenase; Provisional 98.83
PRK06223307 malate dehydrogenase; Reviewed 98.79
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 98.76
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.75
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 98.71
PRK07574385 formate dehydrogenase; Provisional 98.7
PLN03139386 formate dehydrogenase; Provisional 98.67
PRK13243333 glyoxylate reductase; Reviewed 98.67
PRK08605332 D-lactate dehydrogenase; Validated 98.64
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.59
PRK06436303 glycerate dehydrogenase; Provisional 98.59
PRK13403335 ketol-acid reductoisomerase; Provisional 98.57
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 98.57
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.57
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.55
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.53
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.53
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 98.49
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.45
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.44
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.44
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.43
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.42
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.41
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.38
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 98.38
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.35
PRK06444197 prephenate dehydrogenase; Provisional 98.34
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 98.33
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 98.32
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 98.32
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.27
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.23
PTZ00082321 L-lactate dehydrogenase; Provisional 98.22
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.21
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.19
PLN02928347 oxidoreductase family protein 98.19
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 98.19
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.17
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 98.15
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.15
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.14
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.14
PRK15076431 alpha-galactosidase; Provisional 98.13
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.12
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.12
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.08
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 98.07
PTZ00117319 malate dehydrogenase; Provisional 98.07
PLN02602350 lactate dehydrogenase 98.06
PLN02306386 hydroxypyruvate reductase 97.98
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.97
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.96
PRK06141314 ornithine cyclodeaminase; Validated 97.96
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.95
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.93
PRK06932314 glycerate dehydrogenase; Provisional 97.92
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.91
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.88
PRK06487317 glycerate dehydrogenase; Provisional 97.87
PRK00048257 dihydrodipicolinate reductase; Provisional 97.86
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.82
TIGR00036266 dapB dihydrodipicolinate reductase. 97.82
PF10100429 DUF2338: Uncharacterized protein conserved in bact 97.8
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.79
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.77
PRK13303265 L-aspartate dehydrogenase; Provisional 97.77
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.75
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.75
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.74
PRK05442326 malate dehydrogenase; Provisional 97.74
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.73
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.7
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.69
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.68
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.65
PRK04148134 hypothetical protein; Provisional 97.65
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.64
PRK07340304 ornithine cyclodeaminase; Validated 97.64
PTZ00075476 Adenosylhomocysteinase; Provisional 97.63
PRK08618325 ornithine cyclodeaminase; Validated 97.62
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.61
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.61
COG0673342 MviM Predicted dehydrogenases and related proteins 97.58
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.58
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.57
PRK11579346 putative oxidoreductase; Provisional 97.56
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.55
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.53
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.52
PRK06407301 ornithine cyclodeaminase; Provisional 97.52
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.52
PRK05225487 ketol-acid reductoisomerase; Validated 97.51
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.5
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 97.5
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.49
PTZ00325321 malate dehydrogenase; Provisional 97.49
PLN00112444 malate dehydrogenase (NADP); Provisional 97.48
PLN02494477 adenosylhomocysteinase 97.48
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.48
PRK06823315 ornithine cyclodeaminase; Validated 97.46
PRK05086312 malate dehydrogenase; Provisional 97.46
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 97.46
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.45
PRK06046326 alanine dehydrogenase; Validated 97.42
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.41
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.4
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.4
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.39
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.38
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.37
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 97.36
PRK07574385 formate dehydrogenase; Provisional 97.35
PRK08291330 ectoine utilization protein EutC; Validated 97.34
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.33
PRK07589346 ornithine cyclodeaminase; Validated 97.3
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.3
PRK10206344 putative oxidoreductase; Provisional 97.29
PRK09496453 trkA potassium transporter peripheral membrane com 97.28
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.27
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.27
PLN03139386 formate dehydrogenase; Provisional 97.22
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 97.22
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.22
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 97.21
PLN00106323 malate dehydrogenase 97.2
PLN02928347 oxidoreductase family protein 97.18
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.16
COG2910211 Putative NADH-flavin reductase [General function p 97.15
PLN00203519 glutamyl-tRNA reductase 97.15
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.14
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.13
PRK13243333 glyoxylate reductase; Reviewed 97.1
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.08
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.08
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.07
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.06
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 97.06
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.06
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.06
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 97.05
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.0
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.0
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.99
PRK12480330 D-lactate dehydrogenase; Provisional 96.99
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.95
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.93
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.92
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.89
CHL00194317 ycf39 Ycf39; Provisional 96.89
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.84
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.84
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.84
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.82
PRK06436303 glycerate dehydrogenase; Provisional 96.82
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.81
PLN03075296 nicotianamine synthase; Provisional 96.81
PRK13940414 glutamyl-tRNA reductase; Provisional 96.81
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 96.78
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 96.77
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.75
PRK06199379 ornithine cyclodeaminase; Validated 96.74
PRK03659601 glutathione-regulated potassium-efflux system prot 96.72
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 96.72
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.71
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 96.71
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 96.7
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.7
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.69
PLN02306386 hydroxypyruvate reductase 96.69
PRK13403 335 ketol-acid reductoisomerase; Provisional 96.69
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.69
PRK08605332 D-lactate dehydrogenase; Validated 96.68
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.67
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.66
PRK06487317 glycerate dehydrogenase; Provisional 96.66
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.65
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.64
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.64
PRK08300302 acetaldehyde dehydrogenase; Validated 96.63
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.62
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 96.6
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.59
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.58
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.56
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 96.52
KOG1495332 consensus Lactate dehydrogenase [Energy production 96.51
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.49
PRK10669558 putative cation:proton antiport protein; Provision 96.49
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.49
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 96.46
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 96.45
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.42
PRK06932314 glycerate dehydrogenase; Provisional 96.42
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 96.41
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.4
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 96.39
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.35
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.35
PRK03562621 glutathione-regulated potassium-efflux system prot 96.35
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.34
PRK11908347 NAD-dependent epimerase/dehydratase family protein 96.31
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.29
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.29
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 96.27
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.25
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 96.24
PRK15059 292 tartronate semialdehyde reductase; Provisional 96.22
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.22
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 96.21
COG4408431 Uncharacterized protein conserved in bacteria [Fun 96.2
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.2
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.18
PRK09496453 trkA potassium transporter peripheral membrane com 96.17
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.17
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.17
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.15
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.11
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 96.02
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.96
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 95.93
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.93
PRK06719157 precorrin-2 dehydrogenase; Validated 95.92
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.89
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.89
PLN02256 304 arogenate dehydrogenase 95.88
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.86
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.85
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.85
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 95.8
PRK06270341 homoserine dehydrogenase; Provisional 95.8
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.8
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 95.78
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.77
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.77
COG2344211 AT-rich DNA-binding protein [General function pred 95.75
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.73
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.68
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.68
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.63
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 95.63
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.63
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.63
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.63
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.62
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.57
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.56
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 95.54
PRK06349426 homoserine dehydrogenase; Provisional 95.52
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 95.51
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.5
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.5
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.47
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.46
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 95.45
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.43
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.4
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.37
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.37
PLN02688 266 pyrroline-5-carboxylate reductase 95.37
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 95.34
PRK01581374 speE spermidine synthase; Validated 95.34
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.33
PTZ00075 476 Adenosylhomocysteinase; Provisional 95.32
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.3
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 95.28
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.25
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.23
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.22
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.21
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.19
PRK05479 330 ketol-acid reductoisomerase; Provisional 95.19
PRK08040336 putative semialdehyde dehydrogenase; Provisional 95.19
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.17
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 95.16
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.16
PRK07417 279 arogenate dehydrogenase; Reviewed 95.15
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 95.15
PLN02383344 aspartate semialdehyde dehydrogenase 95.13
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.11
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.11
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.11
PRK09414445 glutamate dehydrogenase; Provisional 95.09
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.08
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.07
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 95.05
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.01
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.01
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.99
PRK05868372 hypothetical protein; Validated 94.99
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.97
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.94
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 94.94
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.93
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.92
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 94.92
PRK14982340 acyl-ACP reductase; Provisional 94.92
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.89
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.88
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.88
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.88
PRK06392326 homoserine dehydrogenase; Provisional 94.87
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 94.87
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.84
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.84
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.83
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.79
TIGR01082448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 94.79
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.75
PRK06753373 hypothetical protein; Provisional 94.75
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 94.75
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.72
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.7
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.7
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.69
PRK00536262 speE spermidine synthase; Provisional 94.65
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 94.64
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 94.63
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.62
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 94.59
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.57
PTZ00188506 adrenodoxin reductase; Provisional 94.57
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 94.57
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.56
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.55
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.55
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.54
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 94.45
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 94.44
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 94.44
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.42
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 94.42
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 94.42
PLN02427386 UDP-apiose/xylose synthase 94.38
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.36
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 94.34
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.32
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.31
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 94.3
PLN02214342 cinnamoyl-CoA reductase 94.27
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.27
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.22
PTZ00245287 ubiquitin activating enzyme; Provisional 94.21
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 94.2
PRK12771564 putative glutamate synthase (NADPH) small subunit; 94.2
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.19
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.17
PRK08328231 hypothetical protein; Provisional 94.17
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 94.11
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.1
PRK12779 944 putative bifunctional glutamate synthase subunit b 94.07
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.06
PRK12320 699 hypothetical protein; Provisional 94.06
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 94.06
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 94.04
PLN00203 519 glutamyl-tRNA reductase 94.01
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.01
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 93.97
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.96
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 93.95
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.94
PRK07588391 hypothetical protein; Provisional 93.93
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.9
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 93.9
PRK07538413 hypothetical protein; Provisional 93.9
PRK11728393 hydroxyglutarate oxidase; Provisional 93.9
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.89
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 93.89
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.84
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 93.84
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 93.83
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.81
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.79
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.75
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.75
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 93.73
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 93.71
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 93.64
PRK07236386 hypothetical protein; Provisional 93.62
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 93.62
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.59
PRK08163396 salicylate hydroxylase; Provisional 93.59
PRK06153393 hypothetical protein; Provisional 93.59
PRK10538248 malonic semialdehyde reductase; Provisional 93.59
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.58
PLN02477410 glutamate dehydrogenase 93.56
PRK06847375 hypothetical protein; Provisional 93.53
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.53
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 93.52
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 93.48
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 93.48
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 93.46
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.45
PRK12814652 putative NADPH-dependent glutamate synthase small 93.41
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.38
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.37
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 93.36
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 93.36
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 93.35
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information 
Probab=100.00  E-value=1.4e-100  Score=797.40  Aligned_cols=473  Identities=90%  Similarity=1.398  Sum_probs=434.7

Q ss_pred             CceEEEECCChhHHHHHHHHHHcCCCCeEEEEeCCHHHHHHHHcCCCCCCCCChHHHHHHhcCCCEEEecCHHHHhhcCC
Q 011650            1 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCRGKNLFFSTDVEKHVREAN   80 (480)
Q Consensus         1 ~mkI~VIGlG~~G~~lA~~La~~~~G~~V~~~D~~~~~v~~l~~g~~~~~e~~l~~~~~~~~~~~l~~t~d~~~a~~~aD   80 (480)
                      ||||+|||+||||+++|..|++++.|++|+++|+++++++++++|..+++|+++++++.+...+++++|+++++++++||
T Consensus         1 ~m~I~ViG~GyvGl~~A~~lA~~g~g~~V~gvD~~~~~v~~l~~g~~~~~e~gl~ell~~~~~~~l~~t~~~~~~i~~ad   80 (473)
T PLN02353          1 MVKICCIGAGYVGGPTMAVIALKCPDIEVVVVDISVPRIDAWNSDQLPIYEPGLDEVVKQCRGKNLFFSTDVEKHVAEAD   80 (473)
T ss_pred             CCEEEEECCCHHHHHHHHHHHhcCCCCeEEEEECCHHHHHHHHcCCCccCCCCHHHHHHHhhcCCEEEEcCHHHHHhcCC
Confidence            79999999999999999999987446889999999999999999999999999999987644456999999988899999


Q ss_pred             EEEEEccCCCCcCCCCCCCCCchHHHHHHHHHHHhhCCCCcEEEEecCCCcccHHHHHHHHHhhcCCCceEEeeCCcccc
Q 011650           81 IVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILMHNSRGINFQILSNPEFLA  160 (480)
Q Consensus        81 vVii~Vptp~~~~~~~~~~~~d~~~v~~~~~~i~~~l~~~~iVi~~STv~~gt~~~l~~~l~~~~~g~~~~v~~~Pe~~~  160 (480)
                      ++|||||||.+.++.+++..+|++++++++++|+++++++++||.+||+||||++++.+.+.+.+.|.+|+++|+|||+.
T Consensus        81 vi~I~V~TP~~~~g~~~~~~~Dls~v~~a~~~i~~~l~~~~lVv~~STvp~Gtt~~~~~~l~~~~~g~~f~v~~~PErl~  160 (473)
T PLN02353         81 IVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGINFQILSNPEFLA  160 (473)
T ss_pred             EEEEEeCCCCCCCCCcCCCCCcHHHHHHHHHHHHhhCCCCcEEEEeCCCCCChHHHHHHHHHhhCCCCCeEEEECCCccC
Confidence            99999999987644333458999999999999999999999999999999999999988877654467899999999999


Q ss_pred             cCccccccCCCCeEEEEccCCcchHHHHHHHHHHHhccCCCCeEEeCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
Q 011650          161 EGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEAT  240 (480)
Q Consensus       161 ~G~a~~~~~~~~~vviG~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~ae~~Kl~~N~~~~~~ia~~nE~~~l~~~~  240 (480)
                      ||++++++.+|++||+|+.++.+.+++.++++++|+.+.+..++..+++++||++|+++|+|++++|+|+||++++|+++
T Consensus       161 ~G~a~~d~~~p~riViG~~~~~~~~~a~~~~~~lY~~~~~~~~i~~~s~~~AE~~K~~eN~~ra~~Iaf~NEla~lce~~  240 (473)
T PLN02353        161 EGTAIEDLFKPDRVLIGGRETPEGQKAVQALKDVYAHWVPEERIITTNLWSAELSKLAANAFLAQRISSVNAMSALCEAT  240 (473)
T ss_pred             CCCcccccCCCCEEEEccCCchhhHHHHHHHHHHHHHhhcCCCEEecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999874433366889999999998744578889999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHhcCCCCCCCccccCCCCccccchhhhHHHHHHHHHHCCCchhhhHHHHHHHHhhHhHHHHHHHHHHHhcC
Q 011650          241 GADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVVSSMFN  320 (480)
Q Consensus       241 gid~~~v~~~~~~~~~i~~~~~~pg~g~gG~c~~kD~~~l~~~a~~~g~~~~~~~~~~~~~~N~~~~~~~~~~~~~~~~~  320 (480)
                      |+|+++|+++++++||+|++|++||+||||||||||+++|++.+++.|+++.++++++++++|++||+++++++++.+.+
T Consensus       241 giD~~eV~~~~~~d~rig~~~l~PG~G~GG~ClpkD~~~L~~~a~~~g~~~~~~l~~~~~~iN~~~~~~vv~~~~~~l~~  320 (473)
T PLN02353        241 GADVSQVSHAVGKDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVIKMNDYQKSRFVNRVVSSMFN  320 (473)
T ss_pred             CCCHHHHHHHhCCCCcCCCCCCCCCCCCCCcchhhhHHHHHHHHHHcCCchHHHHHHHHHHHHHhhHHHHHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999988667899999999999999999999998877


Q ss_pred             CCCCCEEEEEeeccCCCCCcccCChHHHHHHHHHhCCCeEEEECCCCChhHHHhhhhcccCCCCCCCCCCCCCCCCcCce
Q 011650          321 TVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQV  400 (480)
Q Consensus       321 ~~~~~~v~ilGla~K~~~~d~r~Sp~~~l~~~L~~~g~~V~~~DP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  400 (480)
                      .+++++|+|||+|||+||+|+|+||+++|++.|+++|++|.+|||++..++..+.++...++|++|.++++-++.....+
T Consensus       321 ~~~~~~VavlGlafK~~tdD~R~Spa~~li~~L~~~G~~V~~~DP~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  400 (473)
T PLN02353        321 TVSGKKIAVLGFAFKKDTGDTRETPAIDVCKGLLGDKAKLSIYDPQVTEEQIQRDLSMNKFDWDHPRHLQPMSPTAVKQV  400 (473)
T ss_pred             ccCCCEEEEEeeeecCCCCccccChHHHHHHHHHhCCCEEEEECCCCChHHHHHHhhcccccccccccccccccccccce
Confidence            78999999999999999999999999999999999999999999999887665567667899999988787777766678


Q ss_pred             EEecChhhhcccCcEEEEeecCcccccccHHHHHhhcCCCCEEEEcCCCCChHHHhhcCcEEEEecCCCcccc
Q 011650          401 IVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWL  473 (480)
Q Consensus       401 ~~~~~~~~a~~~~d~~vi~~~~~~~~~~~~~~~~~~~~~~~~i~D~~~~~~~~~~~~~g~~y~~iG~~~~~~~  473 (480)
                      ++++++++++++||+||++|+|++|++++|+.+.+.|++|++|||+||+++++.+++.||+|+|+|++.++||
T Consensus       401 ~~~~~~~~a~~~aD~vvi~t~~~ef~~l~~~~~~~~m~~~~~viD~rn~l~~~~~~~~G~~y~~~G~~~~~~~  473 (473)
T PLN02353        401 SVVWDAYEATKGAHGICILTEWDEFKTLDYQKIYDNMQKPAFVFDGRNVLDHEKLREIGFIVYSIGKPLDPWL  473 (473)
T ss_pred             eeeCCHHHHhcCCCEEEECCCChHhcccCHHHHHHhccCCCEEEECCCCCCHHHHHhCCcEEEEeCCCCCCCC
Confidence            9999999999999999999999999999999999999888789999999999999999999999999999997

>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2q3e_A467 Structure Of Human Udp-Glucose Dehydrogenase Comple 1e-170
3tdk_A487 Crystal Structure Of Human Udp-Glucose Dehydrogenas 1e-170
3khu_A467 Crystal Structure Of Human Udp-Glucose Dehydrogenas 1e-169
3prj_A494 Role Of Packing Defects In The Evolution Of Alloste 1e-169
3itk_A467 Crystal Structure Of Human Udp-Glucose Dehydrogenas 1e-169
4edf_A494 Dimeric Hugdh, K94e Length = 494 1e-169
3tf5_A493 Structure Of Udp-Glucose Dehydrogenase V132 Deletio 1e-168
2o3j_A481 Structure Of Caenorhabditis Elegans Udp-Glucose Deh 1e-160
2y0e_A478 Bcec And The Final Step Of Ugds Reaction Length = 4 5e-73
2y0d_A478 Bcec Mutation Y10k Length = 478 7e-72
2y0c_A478 Bcec Mutation Y10s Length = 478 7e-72
4a7p_A446 Se-Met Derivatized Ugdg, Udp-Glucose Dehydrogenase 1e-68
3gg2_A450 Crystal Structure Of Udp-Glucose 6-Dehydrogenase Fr 5e-65
3vtf_A444 Structure Of A Udp-Glucose Dehydrogenase From The H 7e-52
1mv8_A436 1.55 A Crystal Structure Of A Ternary Complex Of Gd 9e-32
1mfz_A436 Partially Refined 2.8 A Crystal Structure Of Gdp-Ma 8e-31
3g79_A478 Crystal Structure Of Ndp-N-Acetyl-D-Galactosaminuro 6e-25
3ojl_A431 Native Structure Of The Udp-N-Acetyl-Mannosamine De 1e-22
3phl_A424 The Apo-Form Udp-Glucose 6-Dehydrogenase Length = 4 2e-22
3pid_A432 The Apo-Form Udp-Glucose 6-Dehydrogenase With A C-T 2e-22
1dli_A402 The First Structure Of Udp-Glucose Dehydrogenase (U 8e-19
1dlj_A402 The First Structure Of Udp-Glucose Dehydrogenase (U 7e-18
>pdb|2Q3E|A Chain A, Structure Of Human Udp-Glucose Dehydrogenase Complexed With Nadh And Udp-Glucose Length = 467 Back     alignment and structure 
Iteration: 1

 Score =  593 bits (1530), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 292/468 (62%), Positives = 357/468 (76%), Gaps = 12/468 (2%)
Query: 3   KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQCR 62
           KICCIGAGYVGGPT +VIA  CP I V VVD++  RINAWNS  LPIYEPGL+EVV+ CR
Sbjct: 7   KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCR 66
Query: 63  GKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKI 122
           GKNLFFST+++  ++EA++VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KI
Sbjct: 67  GKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKI 126
Query: 123 VVEKSTVPVKTAEAIEKILMHNSR-GINFQILSNPEFLAEGTAINDLFKPDRVLIGGRET 181
           V EKSTVPV+ AE+I +I   N++  +N Q+LSNPEFLAEGTAI DL  PDRVLIGG ET
Sbjct: 127 VTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDET 186
Query: 182 PEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALCEATG 241
           PEG +A++AL  VY HWVP ++IL TN WS+E+SKLAANAFLAQRISS+N++SALCEATG
Sbjct: 187 PEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATG 246
Query: 242 ADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIK 301
           ADV +V+ AIG D RIG KFL ASVGFGGSCFQKD+LNLVY+CE   LPEVA YW+QVI 
Sbjct: 247 ADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVID 306
Query: 302 VNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLS 361
           +NDYQ+ RF +R++ S+FNTV+ KKIAILGFAFKKDTGDTRE+ +I + K LM + A L 
Sbjct: 307 MNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLH 366
Query: 362 IYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTE 421
           IYDP+VP+E I  DL        HP   +    S +  V ++ D YEA   +H V I TE
Sbjct: 367 IYDPKVPREQIVVDLS-------HPGVSEDDQVSRL--VTISKDPYEACDGAHAVVICTE 417
Query: 422 WDEFKNLDYQKIYNNMQKPAFVFDGRNILD--VEKLRKIGFIVYSIGK 467
           WD FK LDY++I+  M KPAF+FDGR +LD    +L+ IGF + +IGK
Sbjct: 418 WDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGK 465
>pdb|3TDK|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase Length = 487 Back     alignment and structure
>pdb|3KHU|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase Glu161gln, In Complex With Thiohemiacetal Intermediate Length = 467 Back     alignment and structure
>pdb|3PRJ|A Chain A, Role Of Packing Defects In The Evolution Of Allostery And Induced Fit In Human Udp-Glucose Dehydrogenase. Length = 494 Back     alignment and structure
>pdb|3ITK|A Chain A, Crystal Structure Of Human Udp-Glucose Dehydrogenase Thr131ala, Apo Form. Length = 467 Back     alignment and structure
>pdb|4EDF|A Chain A, Dimeric Hugdh, K94e Length = 494 Back     alignment and structure
>pdb|3TF5|A Chain A, Structure Of Udp-Glucose Dehydrogenase V132 Deletion Length = 493 Back     alignment and structure
>pdb|2O3J|A Chain A, Structure Of Caenorhabditis Elegans Udp-Glucose Dehydrogenase Length = 481 Back     alignment and structure
>pdb|2Y0E|A Chain A, Bcec And The Final Step Of Ugds Reaction Length = 478 Back     alignment and structure
>pdb|2Y0D|A Chain A, Bcec Mutation Y10k Length = 478 Back     alignment and structure
>pdb|2Y0C|A Chain A, Bcec Mutation Y10s Length = 478 Back     alignment and structure
>pdb|4A7P|A Chain A, Se-Met Derivatized Ugdg, Udp-Glucose Dehydrogenase From Sphingomonas Elodea Length = 446 Back     alignment and structure
>pdb|3GG2|A Chain A, Crystal Structure Of Udp-Glucose 6-Dehydrogenase From Porphyromonas Gingivalis Bound To Product Udp-Glucuronate Length = 450 Back     alignment and structure
>pdb|3VTF|A Chain A, Structure Of A Udp-Glucose Dehydrogenase From The Hyperthermophilic Archaeon Pyrobaculum Islandicum Length = 444 Back     alignment and structure
>pdb|1MV8|A Chain A, 1.55 A Crystal Structure Of A Ternary Complex Of Gdp-Mannose Dehydrogenase From Psuedomonas Aeruginosa Length = 436 Back     alignment and structure
>pdb|1MFZ|A Chain A, Partially Refined 2.8 A Crystal Structure Of Gdp-Mannose Dehydrogenase From P. Aeruginosa Length = 436 Back     alignment and structure
>pdb|3G79|A Chain A, Crystal Structure Of Ndp-N-Acetyl-D-Galactosaminuronic Acid Dehydrogenase From Methanosarcina Mazei Go1 Length = 478 Back     alignment and structure
>pdb|3OJL|A Chain A, Native Structure Of The Udp-N-Acetyl-Mannosamine Dehydrogenase Cap5o From Staphylococcus Aureus Length = 431 Back     alignment and structure
>pdb|3PHL|A Chain A, The Apo-Form Udp-Glucose 6-Dehydrogenase Length = 424 Back     alignment and structure
>pdb|3PID|A Chain A, The Apo-Form Udp-Glucose 6-Dehydrogenase With A C-Terminal Six- Histidine Tag Length = 432 Back     alignment and structure
>pdb|1DLI|A Chain A, The First Structure Of Udp-Glucose Dehydrogenase (Udpgdh) Reveals The Catalytic Residues Necessary For The Two-Fold Oxidation Length = 402 Back     alignment and structure
>pdb|1DLJ|A Chain A, The First Structure Of Udp-Glucose Dehydrogenase (Udpgdh) Reveals The Catalytic Residues Necessary For The Two-Fold Oxidation Length = 402 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 0.0
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 0.0
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 1e-161
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 1e-155
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 1e-136
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 1e-107
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 1e-104
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 1e-102
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 5e-58
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3l6d_A306 Putative oxidoreductase; structural genomics, prot 8e-04
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 8e-04
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Length = 481 Back     alignment and structure
 Score =  790 bits (2042), Expect = 0.0
 Identities = 264/483 (54%), Positives = 350/483 (72%), Gaps = 14/483 (2%)

Query: 1   MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ 60
           + K+ C+GAGYVGGPT A+IA KCP I V VVD++  +I  WNSD+LPIYEPGL+E+V  
Sbjct: 9   VSKVVCVGAGYVGGPTCAMIAHKCPHITVTVVDMNTAKIAEWNSDKLPIYEPGLDEIVFA 68

Query: 61  CRGKNLFFSTDVEKHVREANIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSD 120
            RG+NLFFS+D+ K + EA+++F+SVNTPTK  G G G A DL Y ES +R IA  +   
Sbjct: 69  ARGRNLFFSSDIPKAIAEADLIFISVNTPTKMYGRGKGMAPDLKYVESVSRTIAQYAGGP 128

Query: 121 KIVVEKSTVPVKTAEAIEKILMHNSR---GINFQILSNPEFLAEGTAINDLFKPDRVLIG 177
           KIVVEKSTVPVK AE+I  IL    +    + FQ+LSNPEFLAEGTA+ DL  PDRVLIG
Sbjct: 129 KIVVEKSTVPVKAAESIGCILREAQKNNENLKFQVLSNPEFLAEGTAMKDLANPDRVLIG 188

Query: 178 GRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSALC 237
           G  +PEG++A+  L  +Y +WVP +RI+ TN WS+E+SKL ANAFLAQRISS+N++SA+C
Sbjct: 189 GESSPEGLQAVAELVRIYENWVPRNRIITTNTWSSELSKLVANAFLAQRISSINSISAVC 248

Query: 238 EATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWK 297
           EATGA++S+V+HA+G+D+RIG KFL ASVGFGGSCFQKD+L+LVY+CE   LP+VA+YW+
Sbjct: 249 EATGAEISEVAHAVGYDTRIGSKFLQASVGFGGSCFQKDVLSLVYLCESLNLPQVADYWQ 308

Query: 298 QVIKVNDYQKTRFVNRVVSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDK 357
            VI +N++Q+ RF +++++ +FNTV+ KKIAI GFAFKK+TGDTRE+ AI V K LM + 
Sbjct: 309 GVININNWQRRRFADKIIAELFNTVTDKKIAIFGFAFKKNTGDTRESSAIHVIKHLMEEH 368

Query: 358 ARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVC 417
           A+LS+YDP+V +  +  DL       D               + V SD Y A + +H + 
Sbjct: 369 AKLSVYDPKVQKSQMLNDLASVTSAQDVE-----------RLITVESDPYAAARGAHAIV 417

Query: 418 ILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKPLDKWLKDMP 477
           +LTEWDEF  L+Y +I+N+MQ PA +FDGR ILD + LR+IGF  ++IG   D+      
Sbjct: 418 VLTEWDEFVELNYSQIHNDMQHPAAIFDGRLILDQKALREIGFRTFAIGTSPDQAYNLFG 477

Query: 478 AVA 480
              
Sbjct: 478 TAG 480
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Length = 467 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Length = 478 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Length = 450 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Length = 436 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Length = 402 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Length = 432 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Length = 478 Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Length = 431 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Length = 404 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 100.0
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 100.0
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 100.0
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 100.0
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 100.0
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 100.0
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 100.0
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 100.0
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 100.0
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 100.0
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.98
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.98
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.98
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.98
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.97
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.97
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.97
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.97
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.97
4ezb_A317 Uncharacterized conserved protein; structural geno 99.95
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.95
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.94
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.93
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.93
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.93
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.92
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.92
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 99.91
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.91
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.9
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.9
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 99.88
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.86
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.86
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.86
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.86
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.85
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 99.85
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.85
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 99.85
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.84
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.83
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.82
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.76
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.76
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.74
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.73
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.73
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.73
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.72
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.72
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.71
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.71
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.7
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.69
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.69
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.67
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.67
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.66
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.66
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.65
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.65
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.64
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.64
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.63
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.61
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.61
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.6
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.59
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.57
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.56
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.55
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.55
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.53
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.52
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.49
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.49
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.47
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.46
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.43
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.38
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.36
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.27
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.27
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.24
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.19
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.18
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.17
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.12
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 99.11
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.11
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.7
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 99.07
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.02
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.01
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 99.0
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.99
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.99
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.96
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.95
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.94
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.93
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.93
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.92
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.91
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.88
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.86
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.86
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.84
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.84
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.84
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.84
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.83
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.82
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.82
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.82
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.82
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.81
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.81
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.81
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.79
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.79
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.78
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.78
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.77
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.75
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.74
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.73
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.72
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.71
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.71
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.69
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.68
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.67
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.65
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.63
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.61
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.61
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.6
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.57
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.53
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.53
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.52
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.51
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.5
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.49
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.49
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.49
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.48
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.46
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.44
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 98.43
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.42
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 98.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.42
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.41
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.4
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.39
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.39
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.39
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.38
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.38
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.37
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.37
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.37
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.36
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 98.35
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.33
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.32
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.31
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.31
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.3
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.29
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.28
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.24
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.24
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.24
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.23
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.23
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.23
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 98.22
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.2
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.2
4had_A350 Probable oxidoreductase protein; structural genomi 98.2
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 98.19
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.19
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.18
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.17
2duw_A145 Putative COA-binding protein; ligand binding prote 98.14
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.14
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.13
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.12
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 98.12
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.11
1ydw_A362 AX110P-like protein; structural genomics, protein 98.11
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.11
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.11
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.1
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.1
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.1
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.09
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.07
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.07
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 98.06
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.03
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.03
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.02
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.02
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.99
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.98
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.97
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.97
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.96
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.95
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.94
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.92
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.92
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.92
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.91
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.88
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.86
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.86
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.84
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.84
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.8
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.79
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.79
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.77
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.77
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.76
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.74
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.74
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.72
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.7
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.68
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.68
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.67
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.65
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.64
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.64
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.64
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.61
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.6
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.6
3oqb_A383 Oxidoreductase; structural genomics, protein struc 97.58
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.57
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 97.57
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.56
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.56
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.54
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.54
3btv_A438 Galactose/lactose metabolism regulatory protein GA 97.54
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.53
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 97.5
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.49
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.48
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.46
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.46
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.46
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.43
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.42
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.39
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.39
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.38
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.38
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.38
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.37
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.36
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.35
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.34
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.34
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.33
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.31
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.28
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.27
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.26
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.26
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.24
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.24
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.23
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.23
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.22
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.21
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.17
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.17
3qha_A 296 Putative oxidoreductase; seattle structural genomi 97.17
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.16
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.16
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.15
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 97.14
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.14
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 97.14
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.14
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 97.13
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.13
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.12
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.12
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.11
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.11
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.1
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.09
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.09
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.09
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.08
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.08
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.06
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 97.05
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.05
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.05
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.04
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.04
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.02
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.01
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.01
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.01
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.0
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.98
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.97
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.95
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.94
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.93
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.9
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.89
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.88
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.87
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.87
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 96.85
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.84
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.83
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.82
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.81
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.79
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.76
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.73
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.72
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.72
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 96.71
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.7
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.7
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.69
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.69
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.66
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.63
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.63
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.63
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.62
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.61
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.61
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.61
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.6
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 96.59
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.59
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.59
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.57
2duw_A145 Putative COA-binding protein; ligand binding prote 96.57
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.55
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.55
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.54
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 96.53
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 96.52
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.49
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.46
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.46
4ezb_A 317 Uncharacterized conserved protein; structural geno 96.44
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.44
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.44
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.42
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.42
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.37
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.35
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.34
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.32
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 96.31
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.31
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.29
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.22
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.21
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 96.18
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 96.16
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.15
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.14
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.12
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.1
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.09
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.07
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.07
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.03
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.03
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 96.03
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.02
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.02
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.0
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.0
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 95.99
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.96
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.96
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.95
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 95.92
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 95.9
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 95.89
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.89
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.86
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 95.86
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 95.86
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.85
1xq6_A253 Unknown protein; structural genomics, protein stru 95.85
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 95.84
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 95.83
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 95.82
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 95.8
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 95.76
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.76
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.75
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 95.75
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.75
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.74
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.73
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.73
1lnq_A336 MTHK channels, potassium channel related protein; 95.72
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 95.65
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.59
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 95.52
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.48
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.47
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 95.45
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 95.44
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 95.33
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.32
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.32
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 95.31
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 95.31
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.29
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.29
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.28
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.27
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.27
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.27
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 95.26
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 95.23
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.22
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 95.2
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 95.17
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.14
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 95.13
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 95.12
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 95.1
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 95.08
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.06
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.05
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.05
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.04
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 95.03
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.03
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.03
2ywl_A180 Thioredoxin reductase related protein; uncharacter 95.02
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.02
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 95.02
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 95.02
1iuk_A140 Hypothetical protein TT1466; structural genomics, 95.01
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 95.0
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.99
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.94
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 94.9
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.9
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 94.9
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.85
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.84
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.84
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 94.83
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.81
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.81
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 94.74
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 94.74
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 94.71
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 94.67
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 94.67
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 94.65
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 93.65
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 94.63
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 94.59
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 94.55
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.55
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.54
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.53
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.52
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.42
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 94.39
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.36
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 94.25
3l07_A285 Bifunctional protein fold; structural genomics, ID 94.23
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.22
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 94.18
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 94.17
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 94.16
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 94.16
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
Probab=100.00  E-value=4.9e-95  Score=747.89  Aligned_cols=419  Identities=34%  Similarity=0.545  Sum_probs=384.8

Q ss_pred             CceEEEECCChhHHHHHHHHHHcCCCCeEEEEeCCHHHHHHHHcCCCCCCCCChHHHHHH-hcCCCEEEecCHHHHhhcC
Q 011650            1 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ-CRGKNLFFSTDVEKHVREA   79 (480)
Q Consensus         1 ~mkI~VIGlG~~G~~lA~~La~~~~G~~V~~~D~~~~~v~~l~~g~~~~~e~~l~~~~~~-~~~~~l~~t~d~~~a~~~a   79 (480)
                      |.+|+|||+||||+++|.+|+++  ||+|+|+|+|+++++.|++|..|++||++++++++ ...+++++|+|+++++++|
T Consensus        21 m~~IaViGlGYVGLp~A~~~A~~--G~~V~g~Did~~kV~~ln~G~~pi~Epgl~ell~~~~~~g~l~~tt~~~~ai~~a   98 (444)
T 3vtf_A           21 MASLSVLGLGYVGVVHAVGFALL--GHRVVGYDVNPSIVERLRAGRPHIYEPGLEEALGRALSSGRLSFAESAEEAVAAT   98 (444)
T ss_dssp             CCEEEEECCSHHHHHHHHHHHHH--TCEEEEECSCHHHHHHHHTTCCSSCCTTHHHHHHHHHHTTCEEECSSHHHHHHTS
T ss_pred             CCEEEEEccCHHHHHHHHHHHhC--CCcEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHcCCeeEEcCHHHHHhcC
Confidence            56899999999999999999998  99999999999999999999999999999999876 5678999999999999999


Q ss_pred             CEEEEEccCCCCcCCCCCCCCCchHHHHHHHHHHHhhCC---CCcEEEEecCCCcccHHHH-HHHHHhhcCCCceEEeeC
Q 011650           80 NIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSK---SDKIVVEKSTVPVKTAEAI-EKILMHNSRGINFQILSN  155 (480)
Q Consensus        80 DvVii~Vptp~~~~~~~~~~~~d~~~v~~~~~~i~~~l~---~~~iVi~~STv~~gt~~~l-~~~l~~~~~g~~~~v~~~  155 (480)
                      |++|||||||.+.++     .+|+++++++.+.|+++++   ++++||++||+||||++++ .+.+++.+++.+|+++|+
T Consensus        99 d~~~I~VpTP~~~d~-----~~Dl~~v~~a~~~I~~~l~~~~~g~lVV~eSTVppGtte~~~~~~l~~~~~~~~f~v~~~  173 (444)
T 3vtf_A           99 DATFIAVGTPPAPDG-----SADLRYVEAAARAVGRGIRAKGRWHLVVVKSTVPPGTTEGLVARAVAEEAGGVKFSVASN  173 (444)
T ss_dssp             SEEEECCCCCBCTTS-----SBCCHHHHHHHHHHHHHHHHHCSCCEEEECSCCCTTTTTTHHHHHHHTTTTTCCCEEEEC
T ss_pred             CceEEEecCCCCCCC-----CCCcHHHHHHHHHHHHHHhhcCCCeEEEEeCCCCCchHHHHHHHHHHHhCCCCCceeecC
Confidence            999999999988754     8999999999999999986   5789999999999999985 566776655789999999


Q ss_pred             CcccccCccccccCCCCeEEEEccCCcchHHHHHHHHHHHhccCCCCeEEeCCchhHHHHHHHHHHHHHHHHHHHHHHHH
Q 011650          156 PEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWVPEDRILCTNLWSAEVSKLAANAFLAQRISSVNAMSA  235 (480)
Q Consensus       156 Pe~~~~G~a~~~~~~~~~vviG~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~ae~~Kl~~N~~~~~~ia~~nE~~~  235 (480)
                      |||+.||++++++.+|+|||+|+.    ++++.+.+.++|+.+.  .++.++++++||++|+++|+|++++|+|+||++.
T Consensus       174 PErl~eG~a~~d~~~~~riViG~~----~~~a~~~~~~ly~~~~--~~~~~~~~~~AE~~Kl~eN~~ravnIa~~NEla~  247 (444)
T 3vtf_A          174 PEFLREGSALEDFFKPDRIVIGAG----DERAASFLLDVYKAVD--APKLVMKPREAELVKYASNVFLALKISFANEVGL  247 (444)
T ss_dssp             CCCCCTTSHHHHHHSCSCEEEEES----SHHHHHHHHHHTTTSC--SCEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccCCccccccccCCcEEEcCC----CHHHHHHHHHHHhccC--CCEEEechhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999986    4788999999999874  4677889999999999999999999999999999


Q ss_pred             HHHHcCCCHHHHHHHhcCCCCCCCccccCCCCccccchhhhHHHHHHHHHHCCCchhhhHHHHHHHHhhHhHHHHHHHHH
Q 011650          236 LCEATGADVSQVSHAIGFDSRIGPKFLNASVGFGGSCFQKDILNLVYICECNGLPEVANYWKQVIKVNDYQKTRFVNRVV  315 (480)
Q Consensus       236 l~~~~gid~~~v~~~~~~~~~i~~~~~~pg~g~gG~c~~kD~~~l~~~a~~~g~~~~~~~~~~~~~~N~~~~~~~~~~~~  315 (480)
                      +|+++|+|+++|++++++++|+|++|++||+||||||||||+++|.+.|++.|++  .+++++++++|++||.++++++.
T Consensus       248 ice~~GiDv~eV~~a~~~d~rig~~~l~PG~G~GG~CipkD~~~L~~~a~~~g~~--~~li~a~~~iN~~~~~~vv~~l~  325 (444)
T 3vtf_A          248 LAKRLGVDTYRVFEAVGLDKRIGRHYFGAGLGFGGSCFPKDTLAFIRFGESLGLE--MAISKAVLRVNEYMPRYAVQLLE  325 (444)
T ss_dssp             HHHHTTCCHHHHHHHHHTSTTSCSTTCCCSSCCCTTTHHHHHHHHHHHHHHTTCC--CHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHcCCCHHHHHHHhccCCCCCCCCCCCCCCCCCcccCcCHHHHHHHHHhcCCC--HHHHHhhHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999998  78999999999999999999998


Q ss_pred             HHhcCCCCCCEEEEEeeccCCCCCcccCChHHHHHHHHHhCCCeEEEECCCCChhHHHhhhhcccCCCCCCCCCCCCCCC
Q 011650          316 SSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQRDLQMNKFDWDHPIHLQPTSPS  395 (480)
Q Consensus       316 ~~~~~~~~~~~v~ilGla~K~~~~d~r~Sp~~~l~~~L~~~g~~V~~~DP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  395 (480)
                      +.+ +.++++||+|||+|||+||+|+||||++.|++.|.++|++|.+|||++.++.. ..++                  
T Consensus       326 ~~~-~~l~g~~V~vlGlafK~~tdD~ReSpa~~ii~~L~~~Ga~V~~~DP~~~~~~~-~~~~------------------  385 (444)
T 3vtf_A          326 ERL-GGLRGRHVGVLGLAFKPNTDDVRESRGVEVARLLLERGARVYVHDPMAMEKAR-AVLG------------------  385 (444)
T ss_dssp             HHH-TCCTTCEEEEECCSSSSSCCCCTTCHHHHHHHHHHHTTCEEEEECSSTHHHHH-HHHG------------------
T ss_pred             HHc-cccCCCEEEEEeeecCCCCCccccCcHHHHHHHHHHCCCEEEEECCCCChHHH-HhcC------------------
Confidence            876 57899999999999999999999999999999999999999999999965433 3332                  


Q ss_pred             CcCceEEecChhhhcccCcEEEEeecCcccccccHHHHHhhcCCCCEEEEcCCCCChHHHhhcCcEEEEecCC
Q 011650          396 TINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIYNNMQKPAFVFDGRNILDVEKLRKIGFIVYSIGKP  468 (480)
Q Consensus       396 ~~~~~~~~~~~~~a~~~~d~~vi~~~~~~~~~~~~~~~~~~~~~~~~i~D~~~~~~~~~~~~~g~~y~~iG~~  468 (480)
                        ..+++++++++++++||+|||+|+|++|+++|+       +.+ +|||+||+++++.    .+.|.||||.
T Consensus       386 --~~~~~~~~~~~a~~~aDavvi~t~h~ef~~ld~-------~~~-vv~D~Rni~~~~~----~~~y~gigWs  444 (444)
T 3vtf_A          386 --DSVTYVEDPQALLDQVEGVIIATAWPQYEGLDY-------RGK-VVVDGRYVKKARE----AKIYEGVAWA  444 (444)
T ss_dssp             --GGSEECSCHHHHHHHCSEEEECSCCGGGGGSCC-------TTC-EEEESSCCGGGGG----SSEEEESSCC
T ss_pred             --CCceecCCHHHHHhCCCEEEEccCCHHHhCCCc-------CCC-EEEECCCCCChhh----hcceeeeecC
Confidence              357888999999999999999999999999985       345 9999999999753    4589999974
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 480
d1mv8a3136 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, 5e-22
d1mv8a2202 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pse 5e-21
d1dlja198 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (U 7e-19
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 1e-18
d1dlja2196 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGD 5e-18
d1mv8a198 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, 2e-14
d1dlja3108 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UD 1e-07
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain
family: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain
domain: GDP-mannose 6-dehydrogenase, GDP-binding domain
species: Pseudomonas aeruginosa [TaxId: 287]

 Score = 89.4 bits (221), Expect = 5e-22
 Identities = 25/149 (16%), Positives = 51/149 (34%), Gaps = 16/149 (10%)

Query: 315 VSSMFNTVSGKKIAILGFAFKKDTGDTRETPAIDVCKGLMGDKARLSIYDPQVPQEHIQR 374
              +  +   +K+ +LG +FK  T D RE+P +++ + L+G    L I+D  V    +  
Sbjct: 4   AFDLITSHDTRKVGLLGLSFKAGTDDLRESPLVELAEMLIGKGYELRIFDRNVEYARVHG 63

Query: 375 DLQMNKFDWDHPIHLQPTSPSTINQVIVASDAYEATKDSHGVCILTEWDEFKNLDYQKIY 434
             +         +             ++ SD  E    S  + +    + F +L      
Sbjct: 64  ANKEYIESKIPHVS-----------SLLVSDLDEVVASSDVLVLGNGDELFVDLV----- 107

Query: 435 NNMQKPAFVFDGRNILDVEKLRKIGFIVY 463
           N       + D    +      +   I +
Sbjct: 108 NKTPSGKKLVDLVGFMPHTTTAQAEGICW 136
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Length = 98 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 196 Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 98 Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 100.0
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 99.95
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 99.92
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 99.91
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 99.9
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.86
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.82
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 99.79
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.78
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.76
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.73
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.67
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.64
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.63
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.59
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.59
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.57
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.52
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.5
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.5
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.4
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.4
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.36
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.1
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.08
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.87
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.78
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.7
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.68
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.67
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.66
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.66
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.64
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.6
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.59
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.58
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.48
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.45
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.43
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.38
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.37
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.36
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.35
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.32
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.31
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.3
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.24
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.21
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.2
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.18
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.17
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.17
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.16
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.14
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.13
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.1
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.07
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.06
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.04
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.01
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.98
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.96
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.93
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.92
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.91
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.89
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.86
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.84
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.8
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.76
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.76
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.74
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.74
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.69
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.64
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.63
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.55
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.54
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.51
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.5
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.47
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.47
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.46
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.39
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.38
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.34
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.33
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.3
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.3
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.3
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.28
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.27
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.23
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.19
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.16
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.13
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.11
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 97.1
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.08
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.03
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.02
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.96
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.87
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.85
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.84
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.8
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.76
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.75
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.69
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.58
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.54
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.48
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.46
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.42
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.41
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.4
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.39
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.38
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.3
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.3
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.2
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.19
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.18
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.1
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.1
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.09
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.03
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.97
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.91
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.9
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.87
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.84
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.83
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.73
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.7
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.68
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.67
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.65
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.65
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.63
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.62
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.57
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.55
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.55
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.52
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.5
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.49
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.46
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.45
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.39
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 95.38
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.38
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.38
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.37
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.37
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.35
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.34
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.32
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.26
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.22
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.03
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.03
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.03
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.03
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.02
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.01
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.0
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.0
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.99
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.98
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.96
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.89
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 94.87
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.85
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.82
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.76
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.75
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.75
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.68
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.66
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.62
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.57
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.49
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.48
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.47
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.46
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.44
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.43
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.42
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.41
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.39
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 94.38
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 94.37
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.35
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.32
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.29
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.26
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.17
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.16
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.15
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 94.14
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.12
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.09
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.07
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.06
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.05
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.79
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.73
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.66
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.6
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 93.57
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 93.55
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.48
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 93.46
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 93.36
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 93.26
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.1
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.05
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.0
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 92.9
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 92.85
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.76
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 92.75
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.7
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.62
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 92.62
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 92.62
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.62
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.61
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 92.6
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 92.6
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 92.56
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.56
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.56
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.43
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.42
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 92.24
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.01
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 91.95
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.94
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.78
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 91.75
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 91.71
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 91.7
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.61
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.57
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 91.55
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 91.54
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 91.47
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.3
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.19
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.1
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 91.09
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 90.99
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 90.94
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 90.92
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.92
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 90.9
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 90.81
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 90.74
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.66
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 90.66
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 90.62
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 90.62
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 90.6
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 90.59
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 90.55
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.54
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.5
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.46
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 90.34
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 90.32
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.3
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 90.29
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 90.27
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.22
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.14
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 90.14
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 90.11
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 89.95
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 89.73
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 89.72
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 89.7
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 89.67
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 89.64
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.6
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 89.56
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 89.53
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.52
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.44
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 89.3
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.29
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 89.08
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.05
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 89.03
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 88.99
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 88.9
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 88.86
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 88.85
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 88.6
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 88.53
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 88.52
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 88.15
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 88.08
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 88.06
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 87.9
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 87.9
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 87.85
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.81
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 87.76
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 87.72
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.62
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 87.59
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 87.51
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 87.42
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 87.41
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.23
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 87.11
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.11
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 87.07
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 86.96
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 86.76
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 86.67
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 86.66
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 86.59
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 86.57
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 86.39
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 86.36
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.26
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 86.24
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.17
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 86.03
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 85.94
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 85.72
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 85.47
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 85.43
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.41
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 85.32
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 85.23
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.03
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.91
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 84.87
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 84.74
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 84.73
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.67
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.66
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 84.52
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.46
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 84.42
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 84.39
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 84.23
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 83.96
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 83.96
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 83.89
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 83.82
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 83.49
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 83.34
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 83.28
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 83.24
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 83.15
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 82.98
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 82.86
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 82.56
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 82.45
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 82.42
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 82.4
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 82.37
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 82.31
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 82.28
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.84
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 81.7
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 81.62
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 81.32
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 81.18
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 81.17
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 81.07
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 80.7
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 80.69
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 80.29
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 80.23
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 80.05
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: GDP-mannose 6-dehydrogenase
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=7.2e-34  Score=263.87  Aligned_cols=187  Identities=33%  Similarity=0.490  Sum_probs=167.1

Q ss_pred             ceEEEECCChhHHHHHHHHHHcCCCCeEEEEeCCHHHHHHHHcCCCCCCCCChHHHHHH-hcCCCEEEecCHHHHhhcCC
Q 011650            2 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVPRINAWNSDQLPIYEPGLEEVVKQ-CRGKNLFFSTDVEKHVREAN   80 (480)
Q Consensus         2 mkI~VIGlG~~G~~lA~~La~~~~G~~V~~~D~~~~~v~~l~~g~~~~~e~~l~~~~~~-~~~~~l~~t~d~~~a~~~aD   80 (480)
                      |||+|||+|++|+++|..||++  ||+|++||.|+++++.|++|..|+.|+++.+++.. ...+++.+++|.++++.+||
T Consensus         1 MkI~ViGlG~vGl~~a~~la~~--g~~V~g~D~n~~~i~~ln~g~~p~~e~~~~~~l~~~~~~~~~~~~~~~~~~i~~~d   78 (202)
T d1mv8a2           1 MRISIFGLGYVGAVCAGCLSAR--GHEVIGVDVSSTKIDLINQGKSPIVEPGLEALLQQGRQTGRLSGTTDFKKAVLDSD   78 (202)
T ss_dssp             CEEEEECCSTTHHHHHHHHHHT--TCEEEEECSCHHHHHHHHTTCCSSCCTTHHHHHHHHHHTTCEEEESCHHHHHHTCS
T ss_pred             CEEEEECCCHhHHHHHHHHHhC--CCcEEEEeCCHHHHHHhcccCCcccchhhhhhhhhhhcccccccCCCHHHHHhhCC
Confidence            8999999999999999999999  99999999999999999999999999999988765 55678999999999999999


Q ss_pred             EEEEEccCCCCcCCCCCCCCCchHHHHHHHHHHHhhC---CCCcEEEEecCCCcccHHHH-HHHHHhhcC---CCceEEe
Q 011650           81 IVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVS---KSDKIVVEKSTVPVKTAEAI-EKILMHNSR---GINFQIL  153 (480)
Q Consensus        81 vVii~Vptp~~~~~~~~~~~~d~~~v~~~~~~i~~~l---~~~~iVi~~STv~~gt~~~l-~~~l~~~~~---g~~~~v~  153 (480)
                      ++|+|||||...++     .+|.+++.++.+.+...+   .++++|+++||++|||++++ .+++++...   +.+|.++
T Consensus        79 ~i~i~VpTP~~~~~-----~~d~~~~~~~~~~i~~~~~~~~~~~liii~STv~pGtt~~~~~~~l~~~~~~~~~~~~~~~  153 (202)
T d1mv8a2          79 VSFICVGTPSKKNG-----DLDLGYIETVCREIGFAIREKSERHTVVVRSTVLPGTVNNVVIPLIEDCSGKKAGVDFGVG  153 (202)
T ss_dssp             EEEECCCCCBCTTS-----SBCCHHHHHHHHHHHHHHTTCCSCCEEEECSCCCTTHHHHTHHHHHHHHHSCCBTTTBEEE
T ss_pred             EEEEecCccccccc-----cccchhhhhhhhhhhheeecccCCcceeeccccCCcchhhhhhhhhhccccccccccccch
Confidence            99999999987644     789999999888877654   47889999999999999985 455655432   6789999


Q ss_pred             eCCcccccCccccccCCCCeEEEEccCCcchHHHHHHHHHHHhccC
Q 011650          154 SNPEFLAEGTAINDLFKPDRVLIGGRETPEGMKAIKALKDVYAHWV  199 (480)
Q Consensus       154 ~~Pe~~~~G~a~~~~~~~~~vviG~~~~~~~~~~~~~~~~l~~~~~  199 (480)
                      |+|||+.+|+++.++.+++++|+|+.    ++++.++++++|+.+.
T Consensus       154 ~~PE~~~~G~a~~d~~~~~~iViG~~----~~~~~~~~~~ly~~i~  195 (202)
T d1mv8a2         154 TNPEFLRESTAIKDYDFPPMTVIGEL----DKQTGDLLEEIYRELD  195 (202)
T ss_dssp             ECCCCCCTTSHHHHHHSCSCEEEEES----SHHHHHHHHHHHTTSS
T ss_pred             hhhhhhcccchhhhhcCCCeEEEEeC----CHHHHHHHHHHHHhcC
Confidence            99999999999999999999999987    5889999999999975
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure