Citrus Sinensis ID: 011674

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
cccccEEEccccccccccccccccccccccEEEccccccccccHHHccccccccEEEccccccccccHHHccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccEEEccccccccccccccccccccEEcccccccccHHHHHHHHccccccEEEcccccccccccccccccccEEEccccccccccHHHHHHccccccEEEccccccccccHHHHHcccccccEEEccccccccccHHHHcccccccEEEccccccccccccccccHHHcccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHcccccccccccccccccccccc
ccccEEEEccccccccHHHHHHHHcHHHccEEEcccccccHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHHcccEEEcccccccccccHHHHHHccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHHHHcEEccccccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHHcccEEEccccccccHEHccccccccHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHcHccccEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccccccccccccHHHHHcccccccccccHHHHHccccHHHHHHHHHcccHccccccccHHHccccc
mtclkeldlsrcvkVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLqnlsvldlgglpvtDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKmfprlsflnlawtgvtklpnissleclnlsnctidsilegnenkaplakISLAGTTFINEREAFLYIETSLLSFldvsnsslsrFCFLTQMKALEhldlsssmigddSVEMVACVGANlrnlnlsntrfssagvgilaghlpnleilslsgtqiDDYAISYMsmmpslkfidisnTDIKGFIQQVGAETDLVLSLTALQNLNHLERLnleqtqvsdatlfplstFKELIHLSLrnasltdvslhqlsslskltnlsirdavltnsglgsfkpprslklldlhggwllTEDAILQFCKMHPRIEVWHELSvicpsdqigsngpspsrtSLRASLVkqkqdpmpmshsfLDQRLKYSREELLELQYSSlslarpddsstqdamglr
mtclkeldlsrcvKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTnsglgsfkppRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLvkqkqdpmpmsHSFLDQRLKYSREELLELQysslslarpddsstqdamglr
MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSlklldlhggwllTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSReellelqysslslARPDDSSTQDAMGLR
****KELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP***********************************************************************
MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP***********************************DQRLKYSREELLE***********************
MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQ*************************PMSHSFLDQRLKYSREELLELQYSSLSL***************
*TCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVIC*******************************SHSFLDQRLKYSREELLELQYS*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query480 2.2.26 [Sep-21-2011]
Q8YA32 1778 Internalin-I OS=Listeria yes no 0.622 0.168 0.274 2e-08
Q723X5 1775 Internalin-I OS=Listeria yes no 0.631 0.170 0.271 1e-06
Q8NEE6735 F-box/LRR-repeat protein no no 0.529 0.345 0.293 3e-06
Q8CDU4790 F-box/LRR-repeat protein yes no 0.387 0.235 0.248 2e-05
P0DJM0 800 Internalin-A OS=Listeria no no 0.566 0.34 0.283 7e-05
P34284466 Uncharacterized F-box/LRR yes no 0.666 0.686 0.245 9e-05
Q723K6 800 Internalin-A OS=Listeria no no 0.547 0.328 0.276 0.0001
G2K3G6 800 Internalin-A OS=Listeria no no 0.547 0.328 0.276 0.0001
Q9DGB6 781 Toll-like receptor 2 type yes no 0.189 0.116 0.387 0.0002
O01615225 Acidic leucine-rich nucle no no 0.189 0.404 0.349 0.0003
>sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=4 SV=1 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 94/342 (27%), Positives = 154/342 (45%), Gaps = 43/342 (12%)

Query: 29  LEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVS 88
           L+ L L   G+T+  I  L +L  L  LDL    +T +    +  L +L YLD+  + ++
Sbjct: 414 LKTLTLDGCGITS--IGTLDNLPKLEKLDLKENQITSI--SEITDLPRLSYLDVSVNNLT 469

Query: 89  NRGAAVLKMFPRLSFLNLA---WTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAK 145
             G   LK  P L +LN++    + V+ L N  SL  +N+SN  I ++  G   + P  K
Sbjct: 470 TIGD--LKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINISNNVIRTV--GKMTELPSLK 525

Query: 146 ISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSV 205
              A    I++    +  +   L  +D SN+ ++       +  L+ LD+ S+ I   SV
Sbjct: 526 EFYAQNNSISDIS--MIHDMPNLRKVDASNNLITNIGTFDNLPKLQSLDVHSNRITSTSV 583

Query: 206 --------------EMVACVGA--NLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQ 249
                          ++  +G   NL +L   N  F+        G LPNLE L +S   
Sbjct: 584 IHDLPSLETFNAQTNLITNIGTMDNLPDLTYVNLSFNRIPSLAPIGDLPNLETLIVSDNN 643

Query: 250 IDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQ 309
               ++  M  +P L+ +D+ N     ++   G E +    L++L +L +L  LNL    
Sbjct: 644 SYLRSLGTMDGVPKLRILDLQN----NYLNYTGTEGN----LSSLSDLTNLTELNLRNNV 695

Query: 310 VSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNL 351
             D  +  LST   LI+L+L +  + D+     S+LS LTNL
Sbjct: 696 YID-DISGLSTLSRLIYLNLDSNKIEDI-----SALSNLTNL 731
Unknown. A role in virulence could not be demonstrated.
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) (taxid: 169963)
>sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 Back     alignment and function description
>sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description
>sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 Back     alignment and function description
>sp|Q9DGB6|TLR22_CHICK Toll-like receptor 2 type-2 OS=Gallus gallus GN=TLR2-2 PE=2 SV=1 Back     alignment and function description
>sp|O01615|AN322_CAEEL Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 OS=Caenorhabditis elegans GN=T19H12.2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
356513289 589 PREDICTED: uncharacterized protein LOC10 0.975 0.794 0.634 1e-166
297742329 588 unnamed protein product [Vitis vinifera] 0.954 0.778 0.630 1e-158
225426352 598 PREDICTED: uncharacterized protein LOC10 0.954 0.765 0.619 1e-156
255537779 597 protein binding protein, putative [Ricin 0.962 0.773 0.645 1e-156
449464060 586 PREDICTED: uncharacterized protein LOC10 0.987 0.808 0.568 1e-140
297803756 590 hypothetical protein ARALYDRAFT_492485 [ 0.958 0.779 0.513 1e-116
186701224 600 leucine-rich repeat family protein [Arab 0.979 0.783 0.524 1e-116
326513166 627 predicted protein [Hordeum vulgare subsp 0.954 0.730 0.492 1e-111
42567079 597 leucine-rich repeat-containing protein [ 0.975 0.783 0.504 1e-110
215769345483 unnamed protein product [Oryza sativa Ja 0.960 0.954 0.471 1e-107
>gi|356513289|ref|XP_003525346.1| PREDICTED: uncharacterized protein LOC100814174 [Glycine max] Back     alignment and taxonomy information
 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 377/471 (80%), Gaps = 3/471 (0%)

Query: 1   MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGG 60
           M+ L+ELDLSRC KV DAG+ H+LSI  LE+L +SET +TA G+ LL+SL+NLS+LDLGG
Sbjct: 112 MSSLQELDLSRCFKVNDAGINHILSIPNLERLRISETSVTAKGVKLLASLKNLSLLDLGG 171

Query: 61  LPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSL 120
           LPV D+ L SLQVL +L Y+DLWGS++SN+GA+VL  FP+L++LNLAWT VTKLP +S L
Sbjct: 172 LPVDDVALTSLQVLKRLHYIDLWGSKISNKGASVLNTFPKLTYLNLAWTSVTKLPKLSFL 231

Query: 121 ECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSR 180
           E LN+SNCTIDSILE  ++KAPLAK+ L+G  F+NE EA LY  T+ LSFLDV+NSS  R
Sbjct: 232 EYLNMSNCTIDSILE--DDKAPLAKLILSGAMFMNEAEALLYANTNFLSFLDVANSSFHR 289

Query: 181 FCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNL 240
           F FL++MK +EHL+LSS M+GDDSVEMVAC G NL++LNLS TR SSAG+GILAGH+P+L
Sbjct: 290 FFFLSKMKVIEHLNLSSCMMGDDSVEMVACAGGNLKSLNLSGTRVSSAGLGILAGHVPHL 349

Query: 241 EILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHL 300
           EILSLS T +DD AIS++SMMPSLK +D+SNT+IKGF+ Q   + + +LSL ALQNL  L
Sbjct: 350 EILSLSQTPVDDTAISFISMMPSLKDVDLSNTNIKGFLHQGRTDVNSLLSLMALQNLK-L 408

Query: 301 ERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTN 360
           ERLNLE TQV D  L+PLS+F+EL +LSL++ASL D+SL+ LSS+ KLTNLSI DAVLTN
Sbjct: 409 ERLNLEHTQVRDEALYPLSSFQELRYLSLKSASLADISLYYLSSIPKLTNLSICDAVLTN 468

Query: 361 SGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSP 420
            GL  FK P +LKLLDL G WLLTED IL FC+ HP++EV HEL  + P +Q G N  SP
Sbjct: 469 YGLDMFKAPETLKLLDLKGCWLLTEDTILSFCRNHPQVEVRHELGTLFPVNQNGLNHSSP 528

Query: 421 SRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDS 471
           SR++ +   + +K+D +P+S  F+DQRLKYSR+ELL LQ++SL LA   +S
Sbjct: 529 SRSTSKTMQMTKKKDQIPLSPYFVDQRLKYSRDELLALQFTSLPLASSSES 579

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742329|emb|CBI34478.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225426352|ref|XP_002266070.1| PREDICTED: uncharacterized protein LOC100261612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537779|ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449464060|ref|XP_004149747.1| PREDICTED: uncharacterized protein LOC101203036 [Cucumis sativus] gi|449505065|ref|XP_004162366.1| PREDICTED: uncharacterized protein LOC101225004 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297803756|ref|XP_002869762.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] gi|297315598|gb|EFH46021.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186701224|gb|ACC91251.1| leucine-rich repeat family protein [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|326513166|dbj|BAK06823.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|42567079|ref|NP_194115.3| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|20466546|gb|AAM20590.1| unknown protein [Arabidopsis thaliana] gi|22136448|gb|AAM91302.1| unknown protein [Arabidopsis thaliana] gi|51971383|dbj|BAD44356.1| putative protein [Arabidopsis thaliana] gi|332659411|gb|AEE84811.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|215769345|dbj|BAH01574.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
TAIR|locus:2138131597 AT4G23840 "AT4G23840" [Arabido 0.935 0.752 0.485 1.3e-102
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.720 0.591 0.293 6.4e-23
UNIPROTKB|Q723K6 800 inlA "Internalin-A" [Listeria 0.618 0.371 0.285 1.7e-11
TAIR|locus:2143320642 AT5G27920 "AT5G27920" [Arabido 0.706 0.528 0.260 2.5e-09
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.568 0.252 0.264 3.2e-09
UNIPROTKB|F1P5J3733 TLR2-2 "Toll-like receptor" [G 0.522 0.342 0.276 1.5e-08
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.587 0.293 0.255 9.2e-08
UNIPROTKB|Q9DGB6 781 TLR2-2 "Toll-like receptor 2 t 0.512 0.314 0.270 1e-07
TIGR_CMR|BA_1346 542 BA_1346 "internalin, putative" 0.483 0.428 0.273 1.1e-07
WB|WBGene00022129542 lron-11 [Caenorhabditis elegan 0.622 0.551 0.267 1.1e-07
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1017 (363.1 bits), Expect = 1.3e-102, P = 1.3e-102
 Identities = 223/459 (48%), Positives = 293/459 (63%)

Query:     1 MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGG 60
             +T L ELDLSRC KVTDAGMKHL S+  L+KLW+S+TG+T  GI+LL+SL+ LS+LDLGG
Sbjct:   110 LTSLTELDLSRCFKVTDAGMKHLQSVVNLKKLWISQTGVTEVGISLLASLKKLSLLDLGG 169

Query:    61 LPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSL 120
             LPVTD  L SLQ LTKLEYLD+WGS V+N+GA  +  F  LSFLNL+WT +T+ PNI  L
Sbjct:   170 LPVTDQNLISLQALTKLEYLDIWGSNVTNQGAVSILKFSNLSFLNLSWTSITQTPNIPHL 229

Query:   121 ECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSR 180
             ECL+++ CTI S  + + + A L K+ L+G  F  E E+  +   S +++LDVS +SL  
Sbjct:   230 ECLHMNTCTIVSEPKTHSSLASLKKLVLSGANFSAETESLSFTNKSCITYLDVSKTSLKN 289

Query:   181 FCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNL 240
             F FL  M  LEHLDLSS+  GDDSV  VACVG NL+NLN+S+T+ + +GVG LAGH+P L
Sbjct:   290 FSFLETMFNLEHLDLSSTAFGDDSVGFVACVGENLKNLNVSDTQITPSGVGNLAGHVPQL 349

Query:   241 EILSLSGTQIDDYAISYMSM-MPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNH 299
             E LS+S T +DD +I  +S  MP +K +D+      GF   +  + +   SL ALQ+L  
Sbjct:   350 ETLSMSQTFVDDLSILLISTTMPCIKALDLGMNSTLGFYYLISPQEEKEKSLAALQSLTS 409

Query:   300 LERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLT 359
             LE L+LE   + D  L  LS+   L HLSL + SLTD +LH LSSL  L +L +RD VLT
Sbjct:   410 LETLSLEHPYLGDKALSGLSSLTGLTHLSLTSTSLTDSTLHHLSSLPNLVSLGVRDGVLT 469

Query:   360 NSGLGSFKPPRSXXXXXXXXXXXXTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPS 419
             ++GL  F+PP              T+D I   CK +P I+V HE +    S  +  N   
Sbjct:   470 SNGLEKFRPPNRLRTLDLQGCWLLTKDDIAGLCKRYPHIKVRHEHA---DSSSLDQNQLL 526

Query:   420 P-SRTSLRASLVKQKQDPMPMS-----HSFLDQRLKYSR 452
             P S T      V ++ +  P S      SFLDQR+KY+R
Sbjct:   527 PRSSTPQSFGKVARRNNQRPESSVAVPRSFLDQRVKYNR 565
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q723K6 inlA "Internalin-A" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
TAIR|locus:2143320 AT5G27920 "AT5G27920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5J3 TLR2-2 "Toll-like receptor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DGB6 TLR2-2 "Toll-like receptor 2 type-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1346 BA_1346 "internalin, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
WB|WBGene00022129 lron-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00006759001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (629 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00001958001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (353 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-07
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 51.4 bits (123), Expect = 8e-07
 Identities = 102/425 (24%), Positives = 160/425 (37%), Gaps = 80/425 (18%)

Query: 25  SISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWG 84
           SI  LE L LS   L+ +    + S  +L VLDLGG  +   +  SL  LT LE+L L  
Sbjct: 138 SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS 197

Query: 85  SQVSNRGAAVLKMFPRLSFLNLAWTGVT-KLPN----ISSLECLNLS-NCTIDSILEGNE 138
           +Q+  +    L     L ++ L +  ++ ++P     ++SL  L+L  N     I     
Sbjct: 198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG 257

Query: 139 NKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFC--FLTQMKALEHLDLS 196
           N   L  + L            ++    L+S LD+S++SLS      + Q++ LE L L 
Sbjct: 258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS-LDLSDNSLSGEIPELVIQLQNLEILHLF 316

Query: 197 SSMIGDDSVEMVACVGANLRNLNLSNTRFSSA----------------GVGILAGHLP-- 238
           S+         +  +   L+ L L + +FS                      L G +P  
Sbjct: 317 SNNFTGKIPVALTSL-PRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG 375

Query: 239 -----NLEILSLSGTQIDDYAISYMSMMPSLK------------------------FIDI 269
                NL  L L    ++      +    SL+                        F+DI
Sbjct: 376 LCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDI 435

Query: 270 SNTDIKGFIQQVGAETDLVLSLTALQNLN-----------------HLERLNLEQTQVSD 312
           SN +++G I     +      + +LQ L+                  LE L+L + Q S 
Sbjct: 436 SNNNLQGRINSRKWD------MPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSG 489

Query: 313 ATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSL 372
           A    L +  EL+ L L    L+     +LSS  KL +L +    L+     SF     L
Sbjct: 490 AVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL 549

Query: 373 KLLDL 377
             LDL
Sbjct: 550 SQLDL 554

Length = 968
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 480
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.49
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.4
KOG4341483 consensus F-box protein containing LRR [General fu 99.36
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.23
KOG4341483 consensus F-box protein containing LRR [General fu 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.93
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
PLN03150623 hypothetical protein; Provisional 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
PLN03150623 hypothetical protein; Provisional 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.74
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
PRK15386426 type III secretion protein GogB; Provisional 97.82
PRK15386426 type III secretion protein GogB; Provisional 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
KOG4308478 consensus LRR-containing protein [Function unknown 97.61
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.56
KOG4308478 consensus LRR-containing protein [Function unknown 97.56
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.48
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.12
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.06
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.75
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.09
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.61
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.74
smart0037026 LRR Leucine-rich repeats, outliers. 90.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.62
smart0037026 LRR Leucine-rich repeats, outliers. 89.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.88
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.76
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 86.95
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.64
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 84.47
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.61
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.45
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-43  Score=324.43  Aligned_cols=392  Identities=20%  Similarity=0.257  Sum_probs=347.3

Q ss_pred             CCcEEecCCCCCCChhhHHhhhCCCCCcEEEcCCCcCCHHHHHHHcCCCCCCEEEcCCCCCCHHHHhhccCCCCCCEEEc
Q 011674            3 CLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDL   82 (480)
Q Consensus         3 ~L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l   82 (480)
                      .-+.|+|++| .+.+..+..|.++++|+.+++..|.++. +|...+...+|+.|+|.+|.|..+-...++-++.|+.|||
T Consensus        79 ~t~~LdlsnN-kl~~id~~~f~nl~nLq~v~l~~N~Lt~-IP~f~~~sghl~~L~L~~N~I~sv~se~L~~l~alrslDL  156 (873)
T KOG4194|consen   79 QTQTLDLSNN-KLSHIDFEFFYNLPNLQEVNLNKNELTR-IPRFGHESGHLEKLDLRHNLISSVTSEELSALPALRSLDL  156 (873)
T ss_pred             ceeeeecccc-ccccCcHHHHhcCCcceeeeeccchhhh-cccccccccceeEEeeeccccccccHHHHHhHhhhhhhhh
Confidence            3467999999 7898999999999999999999999987 4555556777999999999999888889999999999999


Q ss_pred             cCCcCCchhhHhhcCCCCCcEEEccccCCCCCC-----CCCCCCEEEcCCCcccchhccCC-CCCCccEEEccCCCCCCh
Q 011674           83 WGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLP-----NISSLECLNLSNCTIDSILEGNE-NKAPLAKISLAGTTFINE  156 (480)
Q Consensus        83 ~~~~i~~~~~~~l~~l~~L~~L~l~~n~l~~l~-----~~~~L~~L~l~~~~l~~~~~~~~-~~~~L~~L~l~~~~~~~~  156 (480)
                      +.|.|+.+....|..-.++++|+|++|.++.+.     .+.+|-.|.+++|.++.+|...+ .+++|+.|+|..|.+..+
T Consensus       157 SrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~iriv  236 (873)
T KOG4194|consen  157 SRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIV  236 (873)
T ss_pred             hhchhhcccCCCCCCCCCceEEeeccccccccccccccccchheeeecccCcccccCHHHhhhcchhhhhhccccceeee
Confidence            999999876667777789999999999999765     67799999999999999999988 599999999999988644


Q ss_pred             hHHHhhhcCCCceEEEccCCccCcc--hhhccCCCCCeeeCcCCCCCChhHHHHHhhcCCCcEEEccCCCCCcchHHHHh
Q 011674          157 REAFLYIETSLLSFLDVSNSSLSRF--CFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILA  234 (480)
Q Consensus       157 ~~~~~~~~~~~L~~L~l~~~~l~~~--~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~  234 (480)
                       .+..|.++++|+.|.+..|.+..+  ..|..+.++++|+++.|++....-.++..+ .+|+.|++++|.|..+.+..+ 
T Consensus       237 -e~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgL-t~L~~L~lS~NaI~rih~d~W-  313 (873)
T KOG4194|consen  237 -EGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGL-TSLEQLDLSYNAIQRIHIDSW-  313 (873)
T ss_pred             -hhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhhhccccccc-chhhhhccchhhhheeecchh-
Confidence             346788999999999999999988  688899999999999999998777777777 999999999999998888776 


Q ss_pred             cCCCCCcEEEccCCCCChHHHHHhhcCCCccEEEccCccccccccccccchhhhhcHHHhhcCCCCCEEeCCCCCccccc
Q 011674          235 GHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDAT  314 (480)
Q Consensus       235 ~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~  314 (480)
                      +.+++|++|+|+.|+++...+..|..+..|++|+++.|.+......            +|.++.+|++|+|++|.+...+
T Consensus       314 sftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~------------af~~lssL~~LdLr~N~ls~~I  381 (873)
T KOG4194|consen  314 SFTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLAEG------------AFVGLSSLHKLDLRSNELSWCI  381 (873)
T ss_pred             hhcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHHhh------------HHHHhhhhhhhcCcCCeEEEEE
Confidence            6799999999999999999999999999999999999999887666            8999999999999999887654


Q ss_pred             c---ccccccccCceeecCCCCCChhhHHhhcCCCCCCEEEecCCccCcccccCCCCCCCCcEEEcCCCcccCHHHHHHH
Q 011674          315 L---FPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQF  391 (480)
Q Consensus       315 ~---~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~  391 (480)
                      .   ..|.++++|++|+|.+|++..+...+|.++++|++|+|.+|.|..+-+.+|..+ .|++|.+..-.++|||.+.|+
T Consensus       382 EDaa~~f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~NaiaSIq~nAFe~m-~Lk~Lv~nSssflCDCql~Wl  460 (873)
T KOG4194|consen  382 EDAAVAFNGLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAIASIQPNAFEPM-ELKELVMNSSSFLCDCQLKWL  460 (873)
T ss_pred             ecchhhhccchhhhheeecCceeeecchhhhccCcccceecCCCCcceeecccccccc-hhhhhhhcccceEEeccHHHH
Confidence            3   347789999999999999999988999999999999999999999999999988 999999999999999999999


Q ss_pred             HHhCCceeeeeeeccccCCCC
Q 011674          392 CKMHPRIEVWHELSVICPSDQ  412 (480)
Q Consensus       392 ~~~~~~l~~~~~~~~~~~~~~  412 (480)
                      .+|.-+..+.......|..+.
T Consensus       461 ~qWl~~~~lq~sv~a~CayPe  481 (873)
T KOG4194|consen  461 AQWLYRRKLQSSVIAKCAYPE  481 (873)
T ss_pred             HHHHHhcccccceeeeccCCc
Confidence            988876666655555555443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-06
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-04
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 154/317 (48%), Gaps = 54/317 (17%)
Query: 42  DGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSN-RGAAVLKMFPR 100
           DG+  L+   NL+ ++     +TD+    L+ LTKL  + +  +Q+++    A L     
Sbjct: 57  DGVEYLN---NLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIADITPLANLTNLTG 111
Query: 101 LSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAF 160
           L+  N   T +  L N+++L  L LS+ TI  I             +L+G T + +    
Sbjct: 112 LTLFNNQITDIDPLKNLTNLNRLELSSNTISDI------------SALSGLTSLQQ---- 155
Query: 161 LYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNL 220
                  LSF   S++ ++    L  +  LE LD+SS+ + D SV  +A +  NL +L  
Sbjct: 156 -------LSF---SSNQVTDLKPLANLTTLERLDISSNKVSDISV--LAKL-TNLESLIA 202
Query: 221 SNTRFSS-AGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQ 279
           +N + S    +GIL     NL+ LSL+G Q+ D  I  ++ + +L  +D++N  I     
Sbjct: 203 TNNQISDITPLGILT----NLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAP 256
Query: 280 QVGAE--TDLVL------SLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRN 331
             G    T+L L      +++ L  L  L  L L + Q+ D  + P+S  K L +L+L  
Sbjct: 257 LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED--ISPISNLKNLTYLTLYF 314
Query: 332 ASLTDVSLHQLSSLSKL 348
            +++D+S   +SSL+KL
Sbjct: 315 NNISDIS--PVSSLTKL 329
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-22
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-20
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-18
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-22
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-20
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-19
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-18
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-17
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-16
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-15
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-14
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-04
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
 Score =  108 bits (271), Expect = 2e-25
 Identities = 70/366 (19%), Positives = 137/366 (37%), Gaps = 24/366 (6%)

Query: 27  STLEKLWLSETGLTADGIALLS--SLQNLSVLDLGGLPVTDLVLRSLQVLTK--LEYLDL 82
           +  + L    T         L   ++Q+L +     +   D+     + L +  +E ++L
Sbjct: 202 AVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINL 261

Query: 83  WGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLP----NISSLECLNLSNCTIDSILEGN- 137
                 N  +     F  L  L+L  T +++LP     +S+L+ L LS    +++ + + 
Sbjct: 262 QKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISA 321

Query: 138 ENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRF----CFLTQMKALEHL 193
            N   L  +S+ G T   E           L  LD+S+  +         L  +  L+ L
Sbjct: 322 SNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSL 381

Query: 194 DLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDY 253
           +LS +       E        L  L+L+ TR           +L  L++L+LS + +D  
Sbjct: 382 NLSYNEPLSLKTEAFKEC-PQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSLLDIS 440

Query: 254 AISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDA 313
           +      +P+L+ +++                  +    +LQ L  LE L L    +S  
Sbjct: 441 SEQLFDGLPALQHLNLQGNHFPKGN---------IQKTNSLQTLGRLEILVLSFCDLSSI 491

Query: 314 TLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLK 373
                ++ K + H+ L +  LT  S+  LS L  +  L++    ++             +
Sbjct: 492 DQHAFTSLKMMNHVDLSHNRLTSSSIEALSHLKGIY-LNLASNHISIILPSLLPILSQQR 550

Query: 374 LLDLHG 379
            ++L  
Sbjct: 551 TINLRQ 556
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.63
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-42  Score=355.21  Aligned_cols=382  Identities=21%  Similarity=0.203  Sum_probs=249.7

Q ss_pred             CCCCcEEecCCCCCCChhhHHhhhCCCCCcEEEcCCCcCCHHHHHHHcCCCCCCEEEcCCCCCCHHHHhhccCCCCCCEE
Q 011674            1 MTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYL   80 (480)
Q Consensus         1 l~~L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L   80 (480)
                      +++|++|+|++| .++...+..|.++++|++|++++|.+++..+..|+++++|++|++++|.+++..+..|.++++|++|
T Consensus        56 l~~L~~L~Ls~n-~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~l~~~~~~~l~~L~~L  134 (606)
T 3t6q_A           56 LINLTFLDLTRC-QIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGPKALKHLFFIQTGISSIDFIPLHNQKTLESL  134 (606)
T ss_dssp             CTTCSEEECTTC-CCCEECTTTTTTCTTCCEEECTTCCCSEECTTTTSSCTTCCEEECTTSCCSCGGGSCCTTCTTCCEE
T ss_pred             CccceEEECCCC-ccceeChhhccCccccCeeeCCCCcccccChhhhcccccccEeeccccCcccCCcchhccCCcccEE
Confidence            356777777776 4665556666667777777777766666556666666666666666666665544555555555555


Q ss_pred             EccCCcCC------------------------chhhHhhcCCCCCc--EEEccccCCCC---------------------
Q 011674           81 DLWGSQVS------------------------NRGAAVLKMFPRLS--FLNLAWTGVTK---------------------  113 (480)
Q Consensus        81 ~l~~~~i~------------------------~~~~~~l~~l~~L~--~L~l~~n~l~~---------------------  113 (480)
                      ++++|.+.                        +..+..+..+++|+  +|++++|.+..                     
T Consensus       135 ~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n~l~~~~~~~~~~~~L~~L~l~~~~~  214 (606)
T 3t6q_A          135 YLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIEPGAFDSAVFQSLNFGGTQN  214 (606)
T ss_dssp             ECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTCCCCEECTTTTTTCEEEEEECTTCSC
T ss_pred             ECCCCcccccCcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCCccCccChhHhhhccccccccCCchh
Confidence            55554444                        33344444455554  44444433221                     


Q ss_pred             -----------------------------------------------------------CCCCCCCCEEEcCCCcccchh
Q 011674          114 -----------------------------------------------------------LPNISSLECLNLSNCTIDSIL  134 (480)
Q Consensus       114 -----------------------------------------------------------l~~~~~L~~L~l~~~~l~~~~  134 (480)
                                                                                 +..+++|++|++++|.+..+|
T Consensus       215 ~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~lp  294 (606)
T 3t6q_A          215 LLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELP  294 (606)
T ss_dssp             HHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSCCTTTTTTCTTCSEEECTTSCCSCCC
T ss_pred             HHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCccCHHHhccccCCCEEeccCCccCCCC
Confidence                                                                       223567888888888888888


Q ss_pred             ccCCCCCCccEEEccCCCCCChhHHHhhhcCCCceEEEccCCccCcc---hhhccCCCCCeeeCcCCCCCC---------
Q 011674          135 EGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRF---CFLTQMKALEHLDLSSSMIGD---------  202 (480)
Q Consensus       135 ~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~---~~~~~~~~L~~L~l~~n~l~~---------  202 (480)
                      ..+..+++|++|++++|.+...++. .+.++++|++|++++|.+...   ..+..+++|++|++++|.+..         
T Consensus       295 ~~l~~l~~L~~L~l~~n~l~~~~~~-~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~  373 (606)
T 3t6q_A          295 SGLVGLSTLKKLVLSANKFENLCQI-SASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLR  373 (606)
T ss_dssp             SSCCSCTTCCEEECTTCCCSBGGGG-CGGGCTTCSEEECCSCSSCCBCCSSTTTTCTTCCEEECCSSCCCEEEESTTTTT
T ss_pred             hhhcccccCCEEECccCCcCcCchh-hhhccCcCCEEECCCCCcccccchhhhhccCcCCEEECCCCccccccCcchhcc
Confidence            8888888888888888888766442 234566666666666654421   224445555555555554443         


Q ss_pred             -----------------hhHHHHHhhcCCCcEEEccCCCCCcchHHHHhcCCCCCcEEEccCCCCChHHHHHhhcCCCcc
Q 011674          203 -----------------DSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLK  265 (480)
Q Consensus       203 -----------------~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~  265 (480)
                                       ..+..+..+ ++|++|++++|.+....+...+..+++|+.|++++|.+.+..+..+..+++|+
T Consensus       374 ~l~~L~~L~l~~n~l~~~~~~~~~~l-~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~  452 (606)
T 3t6q_A          374 NLSHLQSLNLSYNEPLSLKTEAFKEC-PQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQ  452 (606)
T ss_dssp             TCTTCCEEECCSCSCEEECTTTTTTC-TTCSEEECTTCCEECCTTCCTTTTCTTCCEEECTTCCCBTTCTTTTTTCTTCC
T ss_pred             cCCCCCEEECCCCcCCcCCHHHhcCC-ccCCeEECCCCcCCCcccchhhhCcccCCEEECCCCccCCcCHHHHhCCCCCC
Confidence                             333333333 45555555555544433333234456666666666666655555666666777


Q ss_pred             EEEccCccccccccccccchhhhhcHHHhhcCCCCCEEeCCCCCccccccccccccccCceeecCCCCCChhhHHhhcCC
Q 011674          266 FIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSL  345 (480)
Q Consensus       266 ~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l  345 (480)
                      +|++++|.+.+....         ....+..+++|++|++++|.+++..+..+..+++|++|++++|++++..+..+..+
T Consensus       453 ~L~L~~n~l~~~~~~---------~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l  523 (606)
T 3t6q_A          453 HLNLQGNHFPKGNIQ---------KTNSLQTLGRLEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSSSIEALSHL  523 (606)
T ss_dssp             EEECTTCBCGGGEEC---------SSCGGGGCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCGGGGGGGTTC
T ss_pred             EEECCCCCCCccccc---------cchhhccCCCccEEECCCCccCccChhhhccccCCCEEECCCCccCcCChhHhCcc
Confidence            777777766542110         01257788899999999999888888888889999999999999988888888899


Q ss_pred             CCCCEEEecCCccCcccccCCCCCCCCcEEEcCCCcccCHHHHHHHHHhC
Q 011674          346 SKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMH  395 (480)
Q Consensus       346 ~~L~~L~l~~n~i~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~  395 (480)
                      ++| +|++++|.+++..+..+..+++|+.+++++|++.|++...++..+.
T Consensus       524 ~~L-~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~~~c~c~~~~~~~w~  572 (606)
T 3t6q_A          524 KGI-YLNLASNHISIILPSLLPILSQQRTINLRQNPLDCTCSNIYFLEWY  572 (606)
T ss_dssp             CSC-EEECCSSCCCCCCGGGHHHHHTSSEEECTTCCEECSGGGHHHHHHH
T ss_pred             ccc-EEECcCCcccccCHhhcccCCCCCEEeCCCCCccccCCcHHHHHHH
Confidence            999 9999999998887777777889999999999999888866665543
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 480
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 55.8 bits (133), Expect = 5e-09
 Identities = 64/374 (17%), Positives = 131/374 (35%), Gaps = 42/374 (11%)

Query: 31  KLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNR 90
           K  L +T +T       + L  ++ L    L +  +    ++ L  L  ++   +Q++  
Sbjct: 26  KTVLGKTNVT--DTVSQTDLDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLT-- 79

Query: 91  GAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAP-------- 142
               LK   +L  + +    +  +  +++L  L       + I + +  K          
Sbjct: 80  DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 143 ----LAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSS 198
               ++ IS        ++ +F    T L    +++                    L++ 
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 199 MIGDDSVEMVA-----CVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDY 253
                +   ++      +  NL  L+L+  +    G       L NL  L L+  QI + 
Sbjct: 200 ESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGT---LASLTNLTDLDLANNQISN- 255

Query: 254 AISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSL--------TALQNLNHLERLNL 305
            ++ +S +  L  + +    I       G      L L        + + NL +L  L L
Sbjct: 256 -LAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL 314

Query: 306 EQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGS 365
               +SD  + P+S+  +L  L   N  ++DVS   L++L+ +  LS     +  S L  
Sbjct: 315 YFNNISD--ISPVSSLTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQI--SDLTP 368

Query: 366 FKPPRSLKLLDLHG 379
                 +  L L+ 
Sbjct: 369 LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.3
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.94
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=2.8e-28  Score=233.84  Aligned_cols=318  Identities=23%  Similarity=0.333  Sum_probs=223.2

Q ss_pred             CCCCcEEEcCCCcCCHHHHHHHcCCCCCCEEEcCCCCCCHHHHhhccCCCCCCEEEccCCcCCchhhHhhcCCCCCcEEE
Q 011674           26 ISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLN  105 (480)
Q Consensus        26 ~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~l~~l~~L~~L~  105 (480)
                      +.+|++|++++++|+..  ..+..+++|++|++++|.+++..  .++++++|++|++++|.+.+..+  ++.+++|+.|+
T Consensus        43 l~~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l~--~l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~  116 (384)
T d2omza2          43 LDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIADITP--LANLTNLTGLT  116 (384)
T ss_dssp             HTTCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCCG--GGTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEE
T ss_pred             hCCCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCCc--cccCCcccccccccccccccccc--ccccccccccc
Confidence            45566666666666542  23556666666666666666542  36666666666666666655332  55666666666


Q ss_pred             ccccCCCCCC---CCCCCCEEEcCCCcccchh--------------------ccCCCCCCccEEEccCCCCCChhHHHhh
Q 011674          106 LAWTGVTKLP---NISSLECLNLSNCTIDSIL--------------------EGNENKAPLAKISLAGTTFINEREAFLY  162 (480)
Q Consensus       106 l~~n~l~~l~---~~~~L~~L~l~~~~l~~~~--------------------~~~~~~~~L~~L~l~~~~~~~~~~~~~~  162 (480)
                      ++++.++++.   ....+.......+.+..+.                    ..+.............+......   .+
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~  193 (384)
T d2omza2         117 LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDIS---VL  193 (384)
T ss_dssp             CCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCG---GG
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccccc---cc
Confidence            6666555433   2233333333333222111                    11112233333444444333222   23


Q ss_pred             hcCCCceEEEccCCccCcchhhccCCCCCeeeCcCCCCCChhHHHHHhhcCCCcEEEccCCCCCcchHHHHhcCCCCCcE
Q 011674          163 IETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEI  242 (480)
Q Consensus       163 ~~~~~L~~L~l~~~~l~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~  242 (480)
                      ..+++++.+.+++|.+..+.....+++|++|++++|.++...  .+..+ ++|+.|++++|.+++...  + ..+++|++
T Consensus       194 ~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~--~l~~l-~~L~~L~l~~n~l~~~~~--~-~~~~~L~~  267 (384)
T d2omza2         194 AKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG--TLASL-TNLTDLDLANNQISNLAP--L-SGLTKLTE  267 (384)
T ss_dssp             GGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG--GGGGC-TTCSEEECCSSCCCCCGG--G-TTCTTCSE
T ss_pred             ccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc--hhhcc-cccchhccccCccCCCCc--c-cccccCCE
Confidence            467899999999999998887888899999999999888653  34555 899999999999888764  2 46899999


Q ss_pred             EEccCCCCChHHHHHhhcCCCccEEEccCccccccccccccchhhhhcHHHhhcCCCCCEEeCCCCCccccccccccccc
Q 011674          243 LSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFK  322 (480)
Q Consensus       243 L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~  322 (480)
                      |+++++.+++..  .+..++.++.++++.|.+.+..              .+..+++++.|++++|++++..  .+..++
T Consensus       268 L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~--------------~~~~~~~l~~L~ls~n~l~~l~--~l~~l~  329 (384)
T d2omza2         268 LKLGANQISNIS--PLAGLTALTNLELNENQLEDIS--------------PISNLKNLTYLTLYFNNISDIS--PVSSLT  329 (384)
T ss_dssp             EECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCG--------------GGGGCTTCSEEECCSSCCSCCG--GGGGCT
T ss_pred             eeccCcccCCCC--cccccccccccccccccccccc--------------ccchhcccCeEECCCCCCCCCc--ccccCC
Confidence            999999988654  3678889999999999987652              4678899999999999998753  378899


Q ss_pred             cCceeecCCCCCChhhHHhhcCCCCCCEEEecCCccCcccccCCCCCCCCcEEEcCCC
Q 011674          323 ELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGG  380 (480)
Q Consensus       323 ~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~~~~~~~L~~l~l~~n  380 (480)
                      +|++|++++|++++..  .+..+++|++|++++|++++..+  +..+++|+.|+|++|
T Consensus       330 ~L~~L~L~~n~l~~l~--~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         330 KLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             TCCEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCEEECCCCCCCCCh--hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            9999999999998753  58899999999999999987643  678899999999987
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure