Citrus Sinensis ID: 011717
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| 22331647 | 983 | ABC transporter A family member 2 [Arabi | 0.995 | 0.485 | 0.730 | 0.0 | |
| 4741190 | 1011 | ABC-type transport-like protein [Arabido | 0.995 | 0.471 | 0.730 | 0.0 | |
| 297819380 | 982 | hypothetical protein ARALYDRAFT_485135 [ | 0.995 | 0.485 | 0.726 | 0.0 | |
| 449440766 | 976 | PREDICTED: ABC transporter A family memb | 0.997 | 0.489 | 0.760 | 0.0 | |
| 356516766 | 967 | PREDICTED: ABC transporter A family memb | 0.997 | 0.494 | 0.725 | 0.0 | |
| 225456711 | 958 | PREDICTED: ABC transporter A family memb | 0.995 | 0.497 | 0.782 | 0.0 | |
| 326501630 | 964 | predicted protein [Hordeum vulgare subsp | 0.991 | 0.492 | 0.700 | 0.0 | |
| 357147716 | 965 | PREDICTED: ABC transporter A family memb | 0.991 | 0.492 | 0.693 | 0.0 | |
| 225456709 | 950 | PREDICTED: ABC transporter A family memb | 0.979 | 0.493 | 0.769 | 0.0 | |
| 147841474 | 909 | hypothetical protein VITISV_033311 [Viti | 0.979 | 0.515 | 0.769 | 0.0 |
| >gi|22331647|ref|NP_190357.2| ABC transporter A family member 2 [Arabidopsis thaliana] gi|75327852|sp|Q84K47.1|AB2A_ARATH RecName: Full=ABC transporter A family member 2; Short=ABC transporter ABCA.2; Short=AtABCA2; AltName: Full=ABC2 homolog 1 gi|28393591|gb|AAO42215.1| putative ABC transporter protein [Arabidopsis thaliana] gi|28973103|gb|AAO63876.1| putative ABC transporter protein [Arabidopsis thaliana] gi|332644802|gb|AEE78323.1| ABC transporter A family member 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 756 bits (1952), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 350/479 (73%), Positives = 407/479 (84%), Gaps = 2/479 (0%)
Query: 1 MRNNPGRAIPSSKVMSFRTAAEVDDWLYSNPMRCPGALHFVDRNATTISYGIQTNSTPIE 60
M+NNPGR+IP KV SF VD WL +NP+ PGALHF++RNAT ISYGIQTNSTP
Sbjct: 111 MKNNPGRSIPIEKVRSFVDPEAVDTWLMANPLLVPGALHFIERNATVISYGIQTNSTPEM 170
Query: 61 MRGRYEDPTFKFQIPLQLAAEREIARSLVGDPNFSWVVGLKEFAHPPGEIFSAVARIGPT 120
RGR+EDPTFKFQIPLQ+AAEREIARSL+GDPNF+WVVG KEF HP E A+ IGPT
Sbjct: 171 NRGRFEDPTFKFQIPLQIAAEREIARSLIGDPNFNWVVGFKEFPHPTIEAIVALDTIGPT 230
Query: 121 FFLAVAMFGFVFQISSLVTEKELKLRQVMTMMGLYDSAYWLSWLTWEGTLVLLSSLFIVI 180
FFLAVAMFGFV QISSL+TEKELKLRQ MTMMG++D+AYWLSWLTWEG L +S+L V+
Sbjct: 231 FFLAVAMFGFVLQISSLITEKELKLRQAMTMMGVFDTAYWLSWLTWEGILTAISALLTVL 290
Query: 181 FGMMFQFDFFLNNSFAVLFLLFFLFELNMTGFAFMFSAFISKSSSSTTIGFSVFIVGFLT 240
FGMMFQFDFFL NSF V+FLLF LF+ N+ G AFM SAFISKS+S+TT+GF VF+VGF+T
Sbjct: 291 FGMMFQFDFFLKNSFPVVFLLFMLFQFNLIGLAFMLSAFISKSTSATTVGFFVFLVGFVT 350
Query: 241 QLVTAFGFPYSDQFSNTYRTIWSLFPPNLLAEALQLLSDATETPQDIGISWSRRAECAPN 300
QL T+ GFPY+ ++S R +WSLFPPN ++ L+LL+DAT TPQD GISWS+RAEC PN
Sbjct: 351 QLATSSGFPYAKKYSRMIRALWSLFPPNTFSQGLKLLADATSTPQDPGISWSKRAECGPN 410
Query: 301 -DTECVITINDIYIWLVATFFVWFILAIYLDNIIPNAAGVRKSTFYFLKPGYWTGKGGNK 359
DT CV+TINDIY+WL+ TFF+WF+LA+Y DNI PNA+GVRKS FYFLKPGYWTGKGGN+
Sbjct: 411 DDTGCVLTINDIYLWLLGTFFLWFVLALYFDNITPNASGVRKSIFYFLKPGYWTGKGGNR 470
Query: 360 IEEGSICSCVGSVPPMEHITPDDEDVLEEENMVKQQIRESIPDPNVAVQIRGLVKTFPGT 419
+EEG ICSC+GSVPP++HITPDDEDVLEEE +VKQ E + DPNVAVQIRGL KT+PGT
Sbjct: 471 VEEGGICSCIGSVPPVDHITPDDEDVLEEETLVKQHSMEGLVDPNVAVQIRGLAKTYPGT 530
Query: 420 RKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTISCLTGITPVTGGDG 478
K G CCKC+KTSP+HA+KGLW+NIAKDQLFCLLGPNGAGKTTTI+CLTG+ PVTGGD
Sbjct: 531 TKFG-CCKCKKTSPFHALKGLWMNIAKDQLFCLLGPNGAGKTTTINCLTGLFPVTGGDA 588
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|4741190|emb|CAB41856.1| ABC-type transport-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297819380|ref|XP_002877573.1| hypothetical protein ARALYDRAFT_485135 [Arabidopsis lyrata subsp. lyrata] gi|297323411|gb|EFH53832.1| hypothetical protein ARALYDRAFT_485135 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449440766|ref|XP_004138155.1| PREDICTED: ABC transporter A family member 2-like [Cucumis sativus] gi|449477295|ref|XP_004154984.1| PREDICTED: ABC transporter A family member 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356516766|ref|XP_003527064.1| PREDICTED: ABC transporter A family member 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225456711|ref|XP_002274102.1| PREDICTED: ABC transporter A family member 2 isoform 1 [Vitis vinifera] gi|297734007|emb|CBI15254.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|326501630|dbj|BAK02604.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|357147716|ref|XP_003574455.1| PREDICTED: ABC transporter A family member 2-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|225456709|ref|XP_002274135.1| PREDICTED: ABC transporter A family member 2 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147841474|emb|CAN62102.1| hypothetical protein VITISV_033311 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| TAIR|locus:2100367 | 983 | ABCA2 "ATP-binding cassette A2 | 0.993 | 0.484 | 0.667 | 2.7e-180 | |
| UNIPROTKB|E1BKP0 | 1562 | ABCA5 "Uncharacterized protein | 0.290 | 0.088 | 0.315 | 5.8e-19 | |
| UNIPROTKB|E2R172 | 1642 | ABCA5 "Uncharacterized protein | 0.162 | 0.047 | 0.344 | 7.1e-18 | |
| UNIPROTKB|Q8WWZ7 | 1642 | ABCA5 "ATP-binding cassette su | 0.167 | 0.048 | 0.388 | 1e-17 | |
| UNIPROTKB|E7ETD3 | 1643 | ABCA5 "ATP-binding cassette su | 0.167 | 0.048 | 0.388 | 1.1e-17 | |
| ZFIN|ZDB-GENE-050517-5 | 1673 | abca5 "ATP-binding cassette, s | 0.127 | 0.036 | 0.444 | 2.1e-16 | |
| UNIPROTKB|K7EPM3 | 917 | ABCA5 "ATP-binding cassette su | 0.167 | 0.087 | 0.388 | 3.3e-16 | |
| MGI|MGI:2386607 | 1642 | Abca5 "ATP-binding cassette, s | 0.183 | 0.053 | 0.350 | 4.6e-16 | |
| UNIPROTKB|E1BY40 | 1646 | ABCA5 "Uncharacterized protein | 0.131 | 0.038 | 0.367 | 7.6e-16 | |
| DICTYBASE|DDB_G0291994 | 877 | abcA1 "ABC transporter A famil | 0.210 | 0.115 | 0.339 | 1.5e-15 |
| TAIR|locus:2100367 ABCA2 "ATP-binding cassette A2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1750 (621.1 bits), Expect = 2.7e-180, P = 2.7e-180
Identities = 319/478 (66%), Positives = 371/478 (77%)
Query: 1 MRNNPGRAIPSSKVMSFRTAAEVDDWLYSNPMRCPGALHFVDRNATTISYGIQTNSTPIE 60
M+NNPGR+IP KV SF VD WL +NP+ PGALHF++RNAT ISYGIQTNSTP
Sbjct: 111 MKNNPGRSIPIEKVRSFVDPEAVDTWLMANPLLVPGALHFIERNATVISYGIQTNSTPEM 170
Query: 61 MRGRYEDPTFKFQIPLQLAAEREIARSLVGDPNFSWVVGLKEFAHPPGEIFSAVARIGPT 120
RGR+EDPTFKFQIPLQ+AAEREIARSL+GDPNF+WVVG KEF HP E A+ IGPT
Sbjct: 171 NRGRFEDPTFKFQIPLQIAAEREIARSLIGDPNFNWVVGFKEFPHPTIEAIVALDTIGPT 230
Query: 121 FFLAVAMFGFVFQISSLVTEKELKLRQVMTMMGLYDSAYWLSWLTWEGTLVLLSSLFIVI 180
FFLAVAMFGFV QISSL+TEKELKLRQ MTMMG++D+AYWLSWLTWEG L +S+L V+
Sbjct: 231 FFLAVAMFGFVLQISSLITEKELKLRQAMTMMGVFDTAYWLSWLTWEGILTAISALLTVL 290
Query: 181 FGMMFQFDXXXXXXXXXXXXXXXXXXXXMTGXXXXXXXXXXXXXXXXXXXXXXXIVGFLT 240
FGMMFQFD + G +VGF+T
Sbjct: 291 FGMMFQFDFFLKNSFPVVFLLFMLFQFNLIGLAFMLSAFISKSTSATTVGFFVFLVGFVT 350
Query: 241 QLVTAFGFPYSDQFSNTYRTIWSLFPPNLLAEALQLLSDATETPQDIGISWSRRAECAPN 300
QL T+ GFPY+ ++S R +WSLFPPN ++ L+LL+DAT TPQD GISWS+RAEC PN
Sbjct: 351 QLATSSGFPYAKKYSRMIRALWSLFPPNTFSQGLKLLADATSTPQDPGISWSKRAECGPN 410
Query: 301 D-TECVITINDIYIWLVATFFVWFILAIYLDNIIPNAAGVRKSTFYFLKPGYWTGKGGNK 359
D T CV+TINDIY+WL+ TFF+WF+LA+Y DNI PNA+GVRKS FYFLKPGYWTGKGGN+
Sbjct: 411 DDTGCVLTINDIYLWLLGTFFLWFVLALYFDNITPNASGVRKSIFYFLKPGYWTGKGGNR 470
Query: 360 IEEGSICSCVGSVPPMEHITPDDEDVLEEENMVKQQIRESIPDPNVAVQIRGLVKTFPGT 419
+EEG ICSC+GSVPP++HITPDDEDVLEEE +VKQ E + DPNVAVQIRGL KT+PGT
Sbjct: 471 VEEGGICSCIGSVPPVDHITPDDEDVLEEETLVKQHSMEGLVDPNVAVQIRGLAKTYPGT 530
Query: 420 RKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTISCLTGITPVTGGD 477
K GCC KC+KTSP+HA+KGLW+NIAKDQLFCLLGPNGAGKTTTI+CLTG+ PVTGGD
Sbjct: 531 TKFGCC-KCKKTSPFHALKGLWMNIAKDQLFCLLGPNGAGKTTTINCLTGLFPVTGGD 587
|
|
| UNIPROTKB|E1BKP0 ABCA5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R172 ABCA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WWZ7 ABCA5 "ATP-binding cassette sub-family A member 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ETD3 ABCA5 "ATP-binding cassette sub-family A member 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050517-5 abca5 "ATP-binding cassette, sub-family A (ABC1), member 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EPM3 ABCA5 "ATP-binding cassette sub-family A member 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2386607 Abca5 "ATP-binding cassette, sub-family A (ABC1), member 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BY40 ABCA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291994 abcA1 "ABC transporter A family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| ATATH1 | ATATH1; ATPase, coupled to transmembrane movement of substances / transporter; member of ATH subfamily (983 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| ATNAP5 | • | 0.677 | |||||||||
| ABC1At | • | 0.623 | |||||||||
| AT1G08400 | • | 0.563 | |||||||||
| MAG2 | • | 0.538 | |||||||||
| anac053 | • | 0.513 | |||||||||
| AtSec20 | • | 0.510 | |||||||||
| ATZW10 | • | 0.435 | |||||||||
| CCMH | • | 0.435 | |||||||||
| GCN1 | • | • | 0.420 | ||||||||
| AT5G35690 | • | 0.419 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 2e-23 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 3e-18 | |
| pfam12698 | 278 | pfam12698, ABC2_membrane_3, ABC-2 family transport | 2e-13 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 5e-11 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 1e-10 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 3e-10 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 3e-10 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 2e-09 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 2e-08 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 7e-08 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 8e-08 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 1e-07 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 1e-07 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 1e-07 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 2e-07 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 2e-07 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 2e-07 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 3e-07 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 3e-07 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 5e-07 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 6e-07 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 8e-07 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 1e-06 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 1e-06 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 1e-06 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 3e-06 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 5e-06 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 5e-06 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 6e-06 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 6e-06 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 6e-06 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 9e-06 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 9e-06 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 1e-05 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 1e-05 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 2e-05 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 2e-05 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 2e-05 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 2e-05 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 2e-05 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 3e-05 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 7e-05 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 7e-05 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 9e-05 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 9e-05 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 1e-04 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 1e-04 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 1e-04 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 1e-04 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 2e-04 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 2e-04 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 2e-04 | |
| pfam01061 | 210 | pfam01061, ABC2_membrane, ABC-2 type transporter | 3e-04 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 3e-04 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 5e-04 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 5e-04 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 5e-04 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 6e-04 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 6e-04 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 6e-04 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 7e-04 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 8e-04 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 8e-04 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 0.001 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 0.001 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 0.001 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 0.001 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 0.001 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 0.001 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 0.001 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 0.002 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 0.003 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 0.003 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 0.004 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 0.004 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 0.004 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 0.004 | |
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 0.004 | |
| COG4167 | 267 | COG4167, SapF, ABC-type antimicrobial peptide tran | 0.004 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 0.004 |
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
Score = 104 bits (260), Expect = 2e-23
Identities = 90/362 (24%), Positives = 152/362 (41%), Gaps = 30/362 (8%)
Query: 116 RIGPTFFLAVAMFGFVFQISSLVTEKELKLRQVMTMMGLYDSAYWLSWLTWEGTLVLLSS 175
R P F + ++ + S+V EKEL+L++ + G+ ++ W +W +++ +S
Sbjct: 653 RCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSI 712
Query: 176 LFIVIFGMMFQFDFFLNNSFAVLFLLFFLFELNMTGFAFMFSAFISKSSSSTTIGFSVFI 235
+ IF M + ++ F +LFL F F+ S F SK+S + ++
Sbjct: 713 FLLTIFIMHGRI-LHYSDPF-ILFLFLLAFSTATIMQCFLLSTFFSKASLAAACSGVIYF 770
Query: 236 VGFLTQLVTAFGFPYSDQFSNTYRTIWSLFPPNLLAEALQLLSDATETPQDIGISWSRRA 295
+L ++ F + D+ + +T SL P + L E Q +G+ WS
Sbjct: 771 TLYLPHILC---FAWQDRMTADLKTAVSLLSPVAFGFGTEYLVRFEE--QGLGLQWSNIG 825
Query: 296 ECAPNDTECVITINDIYIWLVATFFVWFILAIYLDNIIPNAAGVRKSTFYFLKPGYWTGK 355
E ++ + L A ++ +LA YLD + P G ++ L+ YW G
Sbjct: 826 NSPLEGDEFSFLLSMKMMLLDAA--LYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGG 883
Query: 356 GGNKIEEGSICSCVGSVPPMEHITPDDEDVLEEENMVKQQIRESIPDPNVAVQIRGLVKT 415
G E ++ E +T + ED E + +P V ++ LVK
Sbjct: 884 EGCSTREER------ALEKTEPLTEEMEDPEHPEGINDSFFERELPGLVPGVCVKNLVKI 937
Query: 416 F-PGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTISCLTGITPVT 474
F P R A+ L + ++Q+ LG NGAGKTTT+S LTG+ P T
Sbjct: 938 FEPSGRP--------------AVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPT 983
Query: 475 GG 476
G
Sbjct: 984 SG 985
|
This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease [Transport and binding proteins, Other]. Length = 2272 |
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|221721 pfam12698, ABC2_membrane_3, ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 100.0 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 100.0 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 100.0 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.73 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 99.69 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 99.68 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 99.66 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 99.63 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.63 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.6 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 99.59 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 99.58 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.56 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.54 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.54 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 99.52 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.52 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 99.51 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 99.5 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 99.5 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.5 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.49 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 99.48 | |
| PF12698 | 344 | ABC2_membrane_3: ABC-2 family transporter protein; | 99.47 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 99.47 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 99.46 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 99.46 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.46 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.46 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 99.46 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.45 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 99.45 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 99.45 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 99.45 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 99.45 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.45 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.44 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.44 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.44 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.44 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.44 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.44 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 99.44 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.44 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.43 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.43 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.43 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.43 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.43 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.43 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 99.43 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.43 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.42 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.42 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.42 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.42 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.42 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.42 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.42 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 99.42 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 99.42 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.42 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 99.42 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 99.41 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 99.41 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 99.41 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 99.41 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.41 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.41 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.41 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.41 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.41 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.41 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.41 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 99.41 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 99.4 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.4 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.4 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.4 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.4 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.4 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 99.4 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.4 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.4 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 99.4 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 99.4 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 99.4 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.4 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 99.4 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.4 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.4 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.4 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 99.4 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 99.39 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 99.39 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.39 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.39 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 99.39 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.39 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.39 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.39 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.39 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.38 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.38 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.38 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.38 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.38 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.38 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.38 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.38 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.38 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 99.38 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.38 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 99.38 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.38 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 99.38 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 99.38 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.38 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.38 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.37 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 99.37 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 99.37 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.37 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 99.37 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.37 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.37 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 99.36 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.36 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 99.36 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.36 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.36 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.36 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.36 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.35 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.35 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 99.35 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.34 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.34 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.34 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 99.34 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 99.34 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.34 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.34 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.33 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 99.33 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.33 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.33 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.33 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.33 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.33 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.33 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.33 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.33 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 99.33 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 99.33 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.33 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.32 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.32 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 99.32 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.32 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.32 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.32 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.31 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.31 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.31 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.31 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.31 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.31 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.31 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.3 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.3 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.3 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 99.3 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.3 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 99.3 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.3 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.3 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.3 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.29 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.29 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.29 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.29 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.28 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.28 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.28 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.28 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.28 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.28 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.27 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.27 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.27 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.27 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.27 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.27 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.27 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.27 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.27 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.27 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.26 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.26 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.26 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 99.26 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.26 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.25 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.24 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 99.24 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.23 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.23 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.21 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.21 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.21 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.2 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.2 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.17 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.15 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.14 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.13 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.12 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.12 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.11 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.1 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.1 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.08 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.07 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.06 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.06 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.06 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.06 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.06 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.05 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.05 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.05 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.05 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.05 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.05 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.04 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.04 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.04 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.03 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.03 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.03 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.03 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.03 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.02 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.01 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.0 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 98.99 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 98.99 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.98 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 98.98 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 98.96 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 98.96 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 98.95 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 98.94 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 98.94 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 98.94 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.93 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 98.9 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 98.89 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.88 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 98.87 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 98.87 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.86 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.8 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 98.8 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.79 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.77 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.77 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.76 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.76 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 98.75 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 98.75 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.73 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 98.71 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.7 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 98.7 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 98.69 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.67 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.66 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 98.66 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 98.64 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 98.61 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.6 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 98.57 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 98.56 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 98.51 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.49 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 98.47 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.46 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.44 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 98.43 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 98.42 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 98.28 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.26 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 98.26 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 98.25 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 98.19 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.16 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.11 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 98.1 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 98.1 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 98.08 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.04 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.03 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 98.0 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 97.98 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 97.97 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 97.96 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 97.96 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 97.9 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 97.89 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 97.89 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 97.88 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 97.86 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.85 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 97.84 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 97.81 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 97.81 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.81 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.79 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 97.79 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 97.78 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.77 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.77 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 97.76 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 97.76 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 97.75 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 97.74 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 97.71 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 97.71 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.71 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 97.71 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 97.7 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 97.66 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 97.61 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 97.6 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 97.59 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 97.59 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 97.58 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.57 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 97.56 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 97.52 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.5 | |
| TIGR00025 | 232 | Mtu_efflux ABC transporter efflux protein, DrrB fa | 97.48 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 97.43 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.42 | |
| TIGR01247 | 236 | drrB daunorubicin resistance ABC transporter membr | 97.41 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 97.37 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 97.34 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 97.32 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.32 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 97.29 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 97.29 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 97.26 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.21 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 97.19 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 97.17 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.13 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 97.12 | |
| TIGR01291 | 253 | nodJ ABC-2 type transporter, NodJ family. Nearly a | 97.1 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 97.09 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 97.09 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 97.02 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 97.0 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.98 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 96.97 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 96.95 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.88 | |
| TIGR01248 | 152 | drrC daunorubicin resistance protein C. The model | 96.84 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 96.78 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 96.72 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.65 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 96.64 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.59 | |
| TIGR03861 | 253 | phenyl_ABC_PedC alcohol ABC transporter, permease | 96.55 | |
| TIGR03518 | 240 | ABC_perm_GldF gliding motility-associated ABC tran | 96.48 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 96.39 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 96.36 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.31 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.29 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 96.29 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.28 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.27 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.07 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.04 | |
| COG0842 | 286 | ABC-type multidrug transport system, permease comp | 96.01 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 95.99 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 95.98 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.95 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.95 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 95.93 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 95.92 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.91 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.87 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 95.85 | |
| PF12679 | 277 | ABC2_membrane_2: ABC-2 family transporter protein | 95.69 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.66 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.57 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.57 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 95.57 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 95.55 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 95.55 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.55 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 95.48 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 95.48 | |
| COG1668 | 407 | NatB ABC-type Na+ efflux pump, permease component | 95.43 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 95.2 | |
| TIGR03062 | 208 | pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa | 95.2 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 95.2 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 95.14 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 95.06 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 94.8 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 94.74 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 94.73 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.68 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 94.48 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.45 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 94.32 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.32 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.11 | |
| PTZ00202 | 550 | tuzin; Provisional | 94.04 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.03 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 93.97 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 93.92 | |
| PF12730 | 232 | ABC2_membrane_4: ABC-2 family transporter protein | 93.83 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.78 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.64 | |
| KOG4181 | 491 | consensus Uncharacterized conserved protein [Funct | 93.59 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 93.41 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 93.32 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 93.14 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 93.04 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.77 | |
| KOG3905 | 473 | consensus Dynein light intermediate chain [Cell mo | 92.7 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 92.58 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 92.54 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 92.49 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 92.22 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 92.09 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 92.01 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 91.96 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 91.83 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 91.8 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 91.71 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 91.68 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.57 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 91.56 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 91.5 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 91.44 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.39 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 91.21 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 91.14 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 91.07 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 90.4 | |
| PRK13853 | 789 | type IV secretion system protein VirB4; Provisiona | 90.31 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.19 | |
| PLN02200 | 234 | adenylate kinase family protein | 90.11 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 90.09 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 89.83 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 89.74 | |
| PRK15066 | 257 | inner membrane transport permease; Provisional | 89.62 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 89.42 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 89.39 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 89.07 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 89.06 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 89.0 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 88.98 | |
| PF03379 | 215 | CcmB: CcmB protein; InterPro: IPR003544 Within mit | 88.83 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 88.82 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 88.8 | |
| PLN02772 | 398 | guanylate kinase | 88.8 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 88.74 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 88.68 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 88.67 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 88.36 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 88.16 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 88.1 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 88.02 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 88.01 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 87.98 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 87.94 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 87.92 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 87.84 | |
| COG3451 | 796 | VirB4 Type IV secretory pathway, VirB4 components | 87.51 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 87.19 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 86.88 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 86.84 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 86.78 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 86.69 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 86.68 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 86.59 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 86.57 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 86.51 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 86.31 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 86.23 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 86.16 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 86.09 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 85.97 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 85.92 |
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-65 Score=590.73 Aligned_cols=442 Identities=23% Similarity=0.347 Sum_probs=336.9
Q ss_pred CCCCceeecCCHHHHHHHHHh--CCCcccEEEEeeCCC------CCeeEEEEEEcCccc--c--------CCCCC----C
Q 011717 9 IPSSKVMSFRTAAEVDDWLYS--NPMRCPGALHFVDRN------ATTISYGIQTNSTPI--E--------MRGRY----E 66 (479)
Q Consensus 9 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~av~F~~~~------~~~~~Y~i~~n~~~~--~--------~~~~~----~ 66 (479)
+..|++++++||++|++..+. +.+.++|||+|++.. +.+++|+||+|.+.. . ..++. .
T Consensus 520 ~~~d~~~~~~~~~~~~~~~~~l~~~~~~~agI~F~~~~~~~~~~p~~v~y~IR~~~~~~~~t~~~~~~~w~~g~~~~~~~ 599 (2272)
T TIGR01257 520 LVLDKFESYDDEVQLTQRALSLLEENRFWAGVVFPDMYPWTSSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVE 599 (2272)
T ss_pred eeccceecCCCHHHHHHHHHHHhhcCCeEEEEEeCCCcccccCCCCceEEEEecCccccCcchhhccccccCCCCCCccc
Confidence 467899999999999997743 556789999997652 367999999997732 1 11222 2
Q ss_pred CCCcc--chhHHHHHHHHHHHHHHhCCCCcceeeeeeccCCCCchhH---HHHHhhhHHHHHHHHHHHHHHHHHHHHHHH
Q 011717 67 DPTFK--FQIPLQLAAEREIARSLVGDPNFSWVVGLKEFAHPPGEIF---SAVARIGPTFFLAVAMFGFVFQISSLVTEK 141 (479)
Q Consensus 67 ~~~~~--~~l~lq~ai~~ai~~~~~~~~~~~~~~~~~~~p~p~~~~~---~~~~~~~~~~~~~~~~~~~~~~v~~iV~EK 141 (479)
||.|+ .|+++|++||+||++..++.. ....+..++||+|++... ..+...+|+++++++++++..+++.+|.||
T Consensus 600 ~~~Y~~~GFl~lQ~ai~~aii~~~~~~~-~~~~v~~q~~P~P~y~~d~~l~~~~~~~pl~~~la~~~~~~~lv~~iV~EK 678 (2272)
T TIGR01257 600 DFRYIWGGFAYLQDMVEQGITRSQMQAE-PPVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEK 678 (2272)
T ss_pred cccHHHhhHHHHHHHHHHHHHHhhcCCC-cccceeeeeCCCCCeeccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34453 489999999999999877532 345688999999998643 345678899999999999999999999999
Q ss_pred HHhHHHHHHHhCcChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccCchHHHHHHHHHHHHHHHHHHHHHHHhcC
Q 011717 142 ELKLRQVMTMMGLYDSAYWLSWLTWEGTLVLLSSLFIVIFGMMFQFDFFLNNSFAVLFLLFFLFELNMTGFAFMFSAFIS 221 (479)
Q Consensus 142 e~klke~m~~mGl~~~~yWls~fi~~~~~~~i~~~~~ii~~~~~~~~~f~~~~~~~l~ll~~l~g~s~i~~~~~~S~fF~ 221 (479)
|+|+||.|+||||++++||+|||+..++.+++++++++++.. ...+|..+++.++|+++++|++++|++||++|+||+
T Consensus 679 E~rlKE~MkiMGL~~~~~w~sWfi~~~~~~~i~~~l~~~il~--~~~~~~~s~~~~lfl~~~~y~~s~I~~~fliS~fFs 756 (2272)
T TIGR01257 679 ELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIM--HGRILHYSDPFILFLFLLAFSTATIMQCFLLSTFFS 756 (2272)
T ss_pred HHHHHHHHHHhCCchHHHHHHHHHHHHHHHHHHHHHHHHHHh--hCceeecCChHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence 999999999999999999999999999988887766554432 345788899999999999999999999999999999
Q ss_pred CchhhhHHHHHHHHHHHHHHHHHhhccccCcccchhhhhhheecChHHHHHHHHHHHHhcCCCCCcccccccCccCCCCC
Q 011717 222 KSSSSTTIGFSVFIVGFLTQLVTAFGFPYSDQFSNTYRTIWSLFPPNLLAEALQLLSDATETPQDIGISWSRRAECAPND 301 (479)
Q Consensus 222 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~P~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~ 301 (479)
++++|+.++.+++++.+++..+. +.+.+..+...++++|++||.+|+.|+..++..+ .++.|++|+++...+..+
T Consensus 757 ka~~A~~~~~li~f~~~lp~~~~---~~~~~~~~~~~~~~~sL~sp~af~~g~~~i~~~e--~~~~G~~w~n~~~~~~~~ 831 (2272)
T TIGR01257 757 KASLAAACSGVIYFTLYLPHILC---FAWQDRMTADLKTAVSLLSPVAFGFGTEYLVRFE--EQGLGLQWSNIGNSPLEG 831 (2272)
T ss_pred chHHHHHHHHHHHHHHHHHHHHH---hhcccccCHHHHHHHHhcCHHHHHHHHHHHHHHh--hhCCCcccccccccccCC
Confidence 99999999888877766554321 1223344556778889999999999999998864 457789999987654322
Q ss_pred CcccccHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCcccccccccccCCCCCCccccCccccccCCCCCCCCCCCC
Q 011717 302 TECVITINDIYIWLVATFFVWFILAIYLDNIIPNAAGVRKSTFYFLKPGYWTGKGGNKIEEGSICSCVGSVPPMEHITPD 381 (479)
Q Consensus 302 ~~~~~~~~~~~~~l~~~~~ly~lL~~yld~v~p~~~g~~~~~~f~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 381 (479)
+ .++++..+.||++|+++|++|+||+|+|+|++||++|||+|+++++||+++.+....... .....+...++
T Consensus 832 d--~~s~~~~~~ml~~d~~lY~lL~~Yld~V~PgeyG~~kpw~F~~~~syW~~~~~~~~~~~~------~~~~~~~~~~~ 903 (2272)
T TIGR01257 832 D--EFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREER------ALEKTEPLTEE 903 (2272)
T ss_pred C--CccHHHHHHHHHHHHHHHHHHHHHHhhcCcCCCCCCCCcccccchhhhcCCccccccccc------ccccccccccc
Confidence 2 367888899999999999999999999999999999999999999999764321100000 00000000000
Q ss_pred ChhhHHHHHHHHhhhhcCCCCCCceEEEecceEEcCCCCccccccccCCCCCcceeeeeEEEEeCCcEEEEECCCCCcHH
Q 011717 382 DEDVLEEENMVKQQIRESIPDPNVAVQIRGLVKTFPGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKT 461 (479)
Q Consensus 382 d~dv~~e~~~~~~~~~~~~~~~~~~i~i~~l~K~y~~~~~~~~~~~~~~~~~~~AV~~lsl~v~~gei~~LLG~NGAGKT 461 (479)
.+|...++.......++++.+....++++||+|.|+++ .+.||+|+||++++|||++|+||||||||
T Consensus 904 ~~~~~~~~~~~~~~~E~~~~~~~~~L~I~nLsK~y~~~-------------~k~aL~~lsl~I~~Gei~aLLG~NGAGKS 970 (2272)
T TIGR01257 904 MEDPEHPEGINDSFFERELPGLVPGVCVKNLVKIFEPS-------------GRPAVDRLNITFYENQITAFLGHNGAGKT 970 (2272)
T ss_pred cccccccccccccccccccCCCCceEEEEeEEEEecCC-------------CceEEEeeEEEEcCCcEEEEECCCCChHH
Confidence 00100000000001112223346789999999999532 12699999999999999999999999999
Q ss_pred HHHHHHhCCCCCCCcccC
Q 011717 462 TTISCLTGITPVTGGDGC 479 (479)
Q Consensus 462 Tt~~mLtG~~~pTsG~a~ 479 (479)
|+++||+|+.+||+|+++
T Consensus 971 TLLkiLaGLl~PtsG~I~ 988 (2272)
T TIGR01257 971 TTLSILTGLLPPTSGTVL 988 (2272)
T ss_pred HHHHHHhcCCCCCceEEE
Confidence 999999999999999874
|
This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. |
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12698 ABC2_membrane_3: ABC-2 family transporter protein; PDB: 2P0S_B 3CNI_A | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR01291 nodJ ABC-2 type transporter, NodJ family | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR01248 drrC daunorubicin resistance protein C | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein | Back alignment and domain information |
|---|
| >TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF12679 ABC2_membrane_2: ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1668 NatB ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12730 ABC2_membrane_4: ABC-2 family transporter protein | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG4181 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG3905 consensus Dynein light intermediate chain [Cell motility] | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13853 type IV secretion system protein VirB4; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15066 inner membrane transport permease; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF03379 CcmB: CcmB protein; InterPro: IPR003544 Within mitochondria and bacteria, a family of related proteins is involved in the assembly of periplasmic c-type cytochromes: these include CycK [], CcmF [,], NrfE [] and CcbS [] | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 479 | ||||
| 1ji0_A | 240 | Crystal Structure Analysis Of The Abc Transporter F | 6e-05 |
| >pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 1e-12 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 1e-11 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 1e-09 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 3e-08 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 6e-08 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 1e-07 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 1e-07 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 2e-07 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 4e-07 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 2e-06 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 2e-06 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 1e-05 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 6e-05 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 1e-04 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 7e-05 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 2e-04 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 2e-04 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 3e-04 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 3e-04 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 4e-04 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 6e-04 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 8e-04 |
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
Score = 66.8 bits (164), Expect = 1e-12
Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 15/72 (20%)
Query: 406 AVQIRGLVKTFPGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTIS 465
AV ++ L K +KG+ I + ++F L+GPNGAGKTTT+
Sbjct: 15 AVVVKDLRKRIGKKE---------------ILKGISFEIEEGEIFGLIGPNGAGKTTTLR 59
Query: 466 CLTGITPVTGGD 477
++ + + G
Sbjct: 60 IISTLIKPSSGI 71
|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 99.57 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 99.57 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 99.56 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 99.55 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 99.55 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 99.55 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 99.54 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 99.54 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 99.54 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 99.54 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 99.54 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 99.53 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 99.52 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.51 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.51 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 99.5 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 99.5 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 99.5 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 99.49 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 99.49 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 99.49 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 99.48 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.48 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 99.48 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 99.48 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 99.47 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 99.47 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 99.46 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 99.46 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 99.41 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 99.4 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 99.39 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.38 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.34 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 99.27 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.24 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.24 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.23 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.22 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.21 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.21 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.2 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.16 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.15 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.15 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.15 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.14 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.01 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 99.0 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 98.94 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 98.93 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 98.86 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.85 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.85 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.82 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.8 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 98.79 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.79 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.74 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.74 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.72 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 98.68 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 98.68 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 98.68 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 98.6 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 98.56 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.55 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 98.52 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 98.52 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 98.48 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.45 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 98.43 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 98.39 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.37 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 98.35 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.31 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.29 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.29 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 98.28 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 98.26 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 98.22 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 98.21 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 98.19 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 98.17 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 98.17 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.13 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 98.05 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.05 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 98.04 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 98.01 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 98.0 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.99 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 97.97 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.9 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 97.89 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.89 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.87 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.84 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 97.8 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 97.8 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.76 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.69 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.68 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.67 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.64 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.63 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.63 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.6 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.59 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.59 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.51 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 97.48 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.37 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.33 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.23 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.2 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.19 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.14 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.07 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.96 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 96.94 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.92 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 96.76 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.75 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.75 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.69 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 96.69 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.54 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 96.47 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.45 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.27 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.19 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.91 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.9 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 95.85 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.79 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.2 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 94.93 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 94.85 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 94.54 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 94.42 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.2 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 94.13 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 94.1 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.06 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 93.84 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 93.58 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.22 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 93.14 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 92.6 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 92.38 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 92.31 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 92.26 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 92.16 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 92.11 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.02 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 92.0 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 91.92 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 91.86 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 91.68 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 91.64 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 91.3 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.19 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 91.03 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 90.99 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 90.96 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 90.9 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 90.84 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 90.83 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 90.68 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 90.38 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 90.19 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 89.86 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 89.65 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 89.59 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 89.42 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 89.27 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 89.25 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 89.23 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 89.2 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 89.05 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 88.99 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 88.84 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 87.63 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 87.55 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 87.3 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 87.18 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 87.08 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 86.68 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 86.49 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 86.35 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 86.33 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 86.06 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 85.9 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 85.86 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 85.6 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 85.59 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 85.49 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 85.44 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 85.19 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 85.17 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 85.14 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 84.95 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 84.75 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 84.54 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 84.45 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 84.39 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 84.02 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 83.75 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 83.63 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 83.53 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 83.42 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 82.78 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 82.76 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 82.56 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 82.36 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 82.28 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 82.24 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 82.18 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 81.9 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 81.7 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 81.05 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 80.37 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 80.34 |
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
Probab=99.57 E-value=1.6e-15 Score=151.45 Aligned_cols=64 Identities=23% Similarity=0.473 Sum_probs=56.8
Q ss_pred CceEEEecceEEcCCCCccccccccCCCCCcceeeeeEEEEeCCcEEEEECCCCCcHHHHHHHHhCCCCCCCccc
Q 011717 404 NVAVQIRGLVKTFPGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTISCLTGITPVTGGDG 478 (479)
Q Consensus 404 ~~~i~i~~l~K~y~~~~~~~~~~~~~~~~~~~AV~~lsl~v~~gei~~LLG~NGAGKTTt~~mLtG~~~pTsG~a 478 (479)
+..++++||+|.|+++ ++.+.|++|+||+|++||++||+|+|||||||++++|+|+.+||+|++
T Consensus 22 ~~mi~v~~ls~~y~~~-----------~~~~~aL~~vsl~i~~Gei~~IiGpnGaGKSTLlr~i~GL~~p~~G~I 85 (366)
T 3tui_C 22 KHMIKLSNITKVFHQG-----------TRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSV 85 (366)
T ss_dssp -CCEEEEEEEEEEECS-----------SSEEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEE
T ss_pred CceEEEEeEEEEeCCC-----------CCCeEEEEeeEEEEcCCCEEEEEcCCCchHHHHHHHHhcCCCCCceEE
Confidence 4579999999999642 123479999999999999999999999999999999999999999986
|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 479 | ||||
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 6e-11 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 1e-10 | |
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 7e-10 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 9e-10 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 8e-09 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 1e-08 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 1e-08 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 1e-08 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 4e-08 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 6e-08 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 8e-08 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 1e-07 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 1e-07 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 9e-07 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 2e-06 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 4e-06 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 5e-06 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 9e-06 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 2e-05 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 3e-04 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 0.001 |
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Putative ABC transporter TM0544 species: Thermotoga maritima [TaxId: 2336]
Score = 60.4 bits (146), Expect = 6e-11
Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 15/71 (21%)
Query: 406 AVQIRGLVKTFPGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTIS 465
AV ++ L K +KG+ I + ++F L+GPNGAGKTTT+
Sbjct: 2 AVVVKDLRKRIGKK---------------EILKGISFEIEEGEIFGLIGPNGAGKTTTLR 46
Query: 466 CLTGITPVTGG 476
++ + + G
Sbjct: 47 IISTLIKPSSG 57
|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.71 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.7 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 99.69 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 99.68 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 99.66 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.66 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.65 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.63 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 99.63 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 99.52 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 99.52 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 99.49 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 99.46 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 99.42 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 99.27 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.54 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.15 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 93.77 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 93.31 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 93.08 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.15 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 90.86 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.83 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.5 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 90.47 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 89.79 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 89.62 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.57 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 88.28 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 88.25 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 87.85 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 86.55 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 86.09 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 86.0 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 84.25 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 83.86 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 83.67 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 82.66 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 82.32 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 81.03 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 80.87 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 80.82 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 80.46 |
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Branched chain aminoacid ABC transporter species: Thermotoga maritima, TM1139 [TaxId: 2336]
Probab=99.71 E-value=2.8e-18 Score=160.21 Aligned_cols=61 Identities=33% Similarity=0.607 Sum_probs=56.6
Q ss_pred CceEEEecceEEcCCCCccccccccCCCCCcceeeeeEEEEeCCcEEEEECCCCCcHHHHHHHHhCCCCCCCcccC
Q 011717 404 NVAVQIRGLVKTFPGTRKIGCCCKCQKTSPYHAIKGLWVNIAKDQLFCLLGPNGAGKTTTISCLTGITPVTGGDGC 479 (479)
Q Consensus 404 ~~~i~i~~l~K~y~~~~~~~~~~~~~~~~~~~AV~~lsl~v~~gei~~LLG~NGAGKTTt~~mLtG~~~pTsG~a~ 479 (479)
+..++++||+|.|++ ++||+|+||+|++|||+||+||||||||||+++|+|+++|++|+++
T Consensus 4 d~~Lev~~l~k~yg~---------------~~al~~vs~~i~~Gei~~liGpnGaGKSTl~~~i~Gl~~p~~G~I~ 64 (240)
T d1ji0a_ 4 DIVLEVQSLHVYYGA---------------IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKII 64 (240)
T ss_dssp SEEEEEEEEEEEETT---------------EEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHTTSSCCSEEEEE
T ss_pred ceEEEEeeEEEEECC---------------EEEEeeeeEEECCCCEEEEECCCCCcHHHHHHHHhCCCCCCccEEE
Confidence 568999999999953 2699999999999999999999999999999999999999999873
|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|