Citrus Sinensis ID: 011787


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------
MAMASLARRKAYVLSRNLSNSSNGNVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
cHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHcccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccEEEEEEccccEEEEEccEEEEEccccccccccccccccEEEcccccccccccccEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEccEEEEEccccccccccccccccccccccccEEcccccccccccEEEEccccccccccccccHHHHHHHHHHccccccccccccccEEccccccccccccHHHHHHccccEEEEEccccccHHHcccccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHcccccc
cHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEcccEcccHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHcEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcEEEEcccccEEEEcccccEEEEccccEEEcccEEEccccccccccccEEEHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHccEEEEEccEEEEEEEccccEEEEEEcccEEEEEEEcEEEEcccccEEEccccccHHHHcccEcccccEccccccEcccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccHHHccEEEccccEEEEEEccHHHHHHHcccEEEEEEEccccHHHHHccccccEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHHHHcc
MAMASLARRKAYVLSRnlsnssngnvfkySFSLtrgfasasdendvvvigggPGGYVAAIKAAQLGLKTTCIEkrgalggtclnvgcipskallhssHMYHEAMHSFashgvkfssvevdlpammAQKDKAVSNLTRGIEGLFKKNKVTYVKGYgkfispsevsvdtieggntvvKGKNIIIatgsdvkslpgitidekrivsstgalalnevpKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVdlsgdgvkltlepaaggektILEADVVLVsagrtpftaglgldkigvetdkmgripvnerfatnipgvyaigdvipgpmlahkaeEDGVACVEFLagkhghvdydkvpgvvythpevasvgktEEQVKELGVEYrvgkfpflansrakaiDDAEGIVKILAEKEtdkilgvhimapnagELIHEAAmathdkpihi
MAMASLARRKAYVlsrnlsnssngnVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSnltrgieglfkknkvTYVKGYGkfispsevsvdtIEGGNTVVKGKNIIiatgsdvkslpgiTIDEKRIVSStgalalnevpkKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAAdivpsmdgeIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTlepaaggektiLEADVVLVSAGrtpftaglgldkigvetDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHpevasvgkteeqVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAmathdkpihi
MAMASLARRKAYVlsrnlsnssngnVFKYSFSLTRGFASASDENDvvvigggpggyvAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
***********************GNVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQF******QKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIH*************
**************************************SASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
MAMASLARRKAYVLSRNLSNSSNGNVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
*****LAR*KAYVLSR******NGNVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMASLARRKAYVLSRNLSNSSNGNVFKYSFSLTRGFASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDKPIHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query477 2.2.26 [Sep-21-2011]
Q9M5K3507 Dihydrolipoyl dehydrogena yes no 0.997 0.938 0.822 0.0
Q9M5K2507 Dihydrolipoyl dehydrogena no no 0.997 0.938 0.814 0.0
P31023501 Dihydrolipoyl dehydrogena N/A no 0.985 0.938 0.812 0.0
O17953495 Dihydrolipoyl dehydrogena yes no 0.911 0.878 0.579 1e-147
Q60HG3509 Dihydrolipoyl dehydrogena N/A no 0.979 0.917 0.561 1e-145
P09622509 Dihydrolipoyl dehydrogena yes no 0.979 0.917 0.561 1e-145
Q8CIZ7509 Dihydrolipoyl dehydrogena yes no 0.979 0.917 0.557 1e-144
P09623509 Dihydrolipoyl dehydrogena yes no 0.911 0.854 0.582 1e-143
Q5R4B1509 Dihydrolipoyl dehydrogena yes no 0.979 0.917 0.555 1e-143
P49819509 Dihydrolipoyl dehydrogena yes no 0.911 0.854 0.582 1e-143
>sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 Back     alignment and function desciption
 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/508 (82%), Positives = 455/508 (89%), Gaps = 32/508 (6%)

Query: 1   MAMASLARRKAYVLSRNLSNSSNGNVFKYSFSLTRGFASA-SDENDVVVIGGGPGGYVAA 59
           MAMASLARRKAY L+RNLSNS   +  ++SFSL+RGFAS+ SDENDVV+IGGGPGGYVAA
Sbjct: 1   MAMASLARRKAYFLTRNLSNSPT-DALRFSFSLSRGFASSGSDENDVVIIGGGPGGYVAA 59

Query: 60  IKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEV 119
           IKA+QLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEA HSFA+HG+K SSVEV
Sbjct: 60  IKASQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGIKVSSVEV 119

Query: 120 DLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKN 179
           DLPAM+AQKD AV NLTRGIEGLFKKNKVTYVKGYGKFISP+EVSV+TI+GGNT+VKGK+
Sbjct: 120 DLPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVETIDGGNTIVKGKH 179

Query: 180 IIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSE 239
           II+ATGSDVKSLPGITIDEK+IVSSTGAL+L+EVPKKL+VIGAGYIGLEMGSVW RLGSE
Sbjct: 180 IIVATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGRLGSE 239

Query: 240 VTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGE 299
           VTVVEFA DIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVV VD S DGVKLT+EPA GGE
Sbjct: 240 VTVVEFAGDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVSVDSSSDGVKLTVEPAEGGE 299

Query: 300 KTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGP 359
           ++ILEADVVLVSAGRTPFT+GL L+KIGVETDK GRI VN+RF +N+PGVYAIGDVIPGP
Sbjct: 300 QSILEADVVLVSAGRTPFTSGLDLEKIGVETDKAGRILVNDRFLSNVPGVYAIGDVIPGP 359

Query: 360 MLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGK 419
           MLAHKAEEDGVACVEF+AGKHGHVDYDKVPGVVYTHPEVASVGKTEEQ+K+ GV YRVGK
Sbjct: 360 MLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQLKKEGVSYRVGK 419

Query: 420 FPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIH--------------- 464
           FPF+ANSRAKAID+AEG+VKILA+KETDKILGVHIMAPNAGELIH               
Sbjct: 420 FPFMANSRAKAIDNAEGLVKILADKETDKILGVHIMAPNAGELIHEAVLAINYDASSEDI 479

Query: 465 ---------------EAAMATHDKPIHI 477
                          EAAMAT+DKPIHI
Sbjct: 480 ARVCHAHPTMSEALKEAAMATYDKPIHI 507




Lipoamide dehydrogenase is a component of the glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes. The pyruvate dehydrogenase complex contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 4
>sp|Q9M5K2|DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 Back     alignment and function description
>sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 Back     alignment and function description
>sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=2 SV=2 Back     alignment and function description
>sp|Q60HG3|DLDH_MACFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 Back     alignment and function description
>sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 Back     alignment and function description
>sp|Q8CIZ7|DLDH_CRIGR Dihydrolipoyl dehydrogenase, mitochondrial OS=Cricetulus griseus GN=DLD PE=2 SV=1 Back     alignment and function description
>sp|P09623|DLDH_PIG Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 Back     alignment and function description
>sp|Q5R4B1|DLDH_PONAB Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1 Back     alignment and function description
>sp|P49819|DLDH_CANFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis familiaris GN=DLD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
255556504510 dihydrolipoamide dehydrogenase, putative 0.997 0.933 0.863 0.0
134142802511 mitochondrial lipoamide dehydrogenase [P 1.0 0.933 0.843 0.0
211906492509 dihydrolipoamide dehydrogenase [Gossypiu 0.997 0.935 0.856 0.0
224099079511 precursor of dehydrogenase dihydrolipoam 1.0 0.933 0.845 0.0
118489203511 unknown [Populus trichocarpa x Populus d 1.0 0.933 0.845 0.0
15221044507 dihydrolipoyl dehydrogenase 1 [Arabidops 0.997 0.938 0.822 0.0
297852420505 F21D18.28 [Arabidopsis lyrata subsp. lyr 0.993 0.938 0.826 0.0
8778521505 F21D18.28 [Arabidopsis thaliana] 0.993 0.938 0.822 0.0
449459772506 PREDICTED: dihydrolipoyl dehydrogenase 1 0.995 0.938 0.830 0.0
30684419507 dihydrolipoyl dehydrogenase 2 [Arabidops 0.997 0.938 0.814 0.0
>gi|255556504|ref|XP_002519286.1| dihydrolipoamide dehydrogenase, putative [Ricinus communis] gi|223541601|gb|EEF43150.1| dihydrolipoamide dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/511 (86%), Positives = 463/511 (90%), Gaps = 35/511 (6%)

Query: 1   MAMASLARRKAYVLSRNLSNSSNGNVFKYSFSLT---RGFASA-SDENDVVVIGGGPGGY 56
           MAMAS ARRKAY+L+RN SNSS  +  +YSFSLT   RGFASA SDENDVVV+GGGPGGY
Sbjct: 1   MAMASFARRKAYLLTRNFSNSSP-DALRYSFSLTSFSRGFASAGSDENDVVVVGGGPGGY 59

Query: 57  VAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSS 116
           VAAIKAAQLGLKTTCIEKRG LGGTCLNVGCIPSKALLHSSHMYHEA HSFA+HGVKFSS
Sbjct: 60  VAAIKAAQLGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAQHSFANHGVKFSS 119

Query: 117 VEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVK 176
           VEVDLPAMM QKDKAV+NLTRGIEGLFKKNKV YVKGYGKFISPSEVSVDT++GGNTVVK
Sbjct: 120 VEVDLPAMMGQKDKAVANLTRGIEGLFKKNKVNYVKGYGKFISPSEVSVDTLDGGNTVVK 179

Query: 177 GKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARL 236
           GKNIIIATGSDVKSLPGITIDEK+IVSSTGALAL+E+PKKLVVIGAGYIGLEMGSVW RL
Sbjct: 180 GKNIIIATGSDVKSLPGITIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRL 239

Query: 237 GSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAA 296
           GSEVTVVEFA DIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVD SGDGVKLTLEPA+
Sbjct: 240 GSEVTVVEFAPDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLTLEPAS 299

Query: 297 GGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVI 356
           GG++TILEADVVLVSAGRTPFTAGLGLDKIGVETDK+GRIPVNE+FATN+PGV+AIGDV+
Sbjct: 300 GGDQTILEADVVLVSAGRTPFTAGLGLDKIGVETDKLGRIPVNEKFATNVPGVFAIGDVV 359

Query: 357 PGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYR 416
           PGPMLAHKAEEDGVACVEF+AGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVK LGVEYR
Sbjct: 360 PGPMLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKALGVEYR 419

Query: 417 VGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIH------------ 464
           VGKFPFLANSRAKAIDDAEG+VKILAEKETDKILGVHIMAPNAGELIH            
Sbjct: 420 VGKFPFLANSRAKAIDDAEGLVKILAEKETDKILGVHIMAPNAGELIHEAVLALAYGAAS 479

Query: 465 ------------------EAAMATHDKPIHI 477
                             EAAMATHDKPIHI
Sbjct: 480 EDIARVCHAHPTMSEALKEAAMATHDKPIHI 510




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|134142802|gb|ABO61735.1| mitochondrial lipoamide dehydrogenase [Populus tremuloides] Back     alignment and taxonomy information
>gi|211906492|gb|ACJ11739.1| dihydrolipoamide dehydrogenase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224099079|ref|XP_002311367.1| precursor of dehydrogenase dihydrolipoamide dehydrogenase 1 [Populus trichocarpa] gi|222851187|gb|EEE88734.1| precursor of dehydrogenase dihydrolipoamide dehydrogenase 1 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489203|gb|ABK96408.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|15221044|ref|NP_175237.1| dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] gi|30694221|ref|NP_849782.1| dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] gi|75264759|sp|Q9M5K3.2|DLDH1_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 1, mitochondrial; AltName: Full=Dihydrolipoamide dehydrogenase 1; AltName: Full=Glycine cleavage system L protein 1; AltName: Full=Pyruvate dehydrogenase complex E3 subunit 1; Short=E3-1; Short=PDC-E3 1; Flags: Precursor gi|12323085|gb|AAG51522.1|AC051631_2 lipoamide dehydrogenase, putative; 44693-46402 [Arabidopsis thaliana] gi|12704696|gb|AAF34795.3|AF228639_1 lipoamide dehydrogenase precursor [Arabidopsis thaliana] gi|332194118|gb|AEE32239.1| dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] gi|332194119|gb|AEE32240.1| dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297852420|ref|XP_002894091.1| F21D18.28 [Arabidopsis lyrata subsp. lyrata] gi|297339933|gb|EFH70350.1| F21D18.28 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|8778521|gb|AAF79529.1|AC023673_17 F21D18.28 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449459772|ref|XP_004147620.1| PREDICTED: dihydrolipoyl dehydrogenase 1, mitochondrial-like [Cucumis sativus] gi|449517359|ref|XP_004165713.1| PREDICTED: dihydrolipoyl dehydrogenase 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30684419|ref|NP_851005.1| dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana] gi|30684428|ref|NP_566570.3| dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana] gi|75264758|sp|Q9M5K2.1|DLDH2_ARATH RecName: Full=Dihydrolipoyl dehydrogenase 2, mitochondrial; AltName: Full=Dihydrolipoamide dehydrogenase 2; AltName: Full=Glycine cleavage system L protein 2; AltName: Full=Pyruvate dehydrogenase complex E3 subunit 2; Short=E3-2; Short=PDC-E3 2; Flags: Precursor gi|6984216|gb|AAF34796.1|AF228640_1 lipoamide dehydrogenase precursor [Arabidopsis thaliana] gi|332642404|gb|AEE75925.1| dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana] gi|332642406|gb|AEE75927.1| dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
TAIR|locus:2089030507 mtLPD2 "lipoamide dehydrogenas 0.981 0.923 0.827 3.6e-209
TAIR|locus:2023782507 mtLPD1 "mitochondrial lipoamid 0.981 0.923 0.831 9.8e-206
UNIPROTKB|P31023501 LPD "Dihydrolipoyl dehydrogena 0.968 0.922 0.831 1e-203
UNIPROTKB|Q9SPB1523 flbr "Dihydrolipoyl dehydrogen 0.968 0.883 0.840 4.4e-203
DICTYBASE|DDB_G0291648488 lpd "glycine cleavage system L 0.863 0.844 0.601 9.5e-135
WB|WBGene00010794495 dld-1 [Caenorhabditis elegans 0.911 0.878 0.554 5.9e-128
UNIPROTKB|P09622509 DLD "Dihydrolipoyl dehydrogena 0.863 0.809 0.590 7.6e-128
UNIPROTKB|F1N206509 DLD "Dihydrolipoyl dehydrogena 0.863 0.809 0.587 2e-127
UNIPROTKB|F1SAF0509 DLD "Dihydrolipoyl dehydrogena 0.863 0.809 0.585 4.2e-127
UNIPROTKB|F1PAR0509 DLD "Dihydrolipoyl dehydrogena 0.863 0.809 0.585 1.1e-126
TAIR|locus:2089030 mtLPD2 "lipoamide dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1966 (697.1 bits), Expect = 3.6e-209, Sum P(2) = 3.6e-209
 Identities = 389/470 (82%), Positives = 420/470 (89%)

Query:     1 MAMASLARRKAYVXXXXXXXXXXXXVFKYSFSLTRGFASA-SDENDXXXXXXXXXXXXAA 59
             MAMASLARRKAY              F++SFSLTRGFAS+ SD+ND            AA
Sbjct:     1 MAMASLARRKAYFLTRNISNSPTDA-FRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAA 59

Query:    60 IKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEV 119
             IKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEA H FA+HGVK SSVEV
Sbjct:    60 IKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEV 119

Query:   120 DLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKN 179
             DLPAM+AQKD AV NLTRG+EGLFKKNKV YVKGYGKF+SPSEVSVDTI+G N VVKGK+
Sbjct:   120 DLPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDTIDGENVVVKGKH 179

Query:   180 IIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSE 239
             II+ATGSDVKSLPGITIDEK+IVSSTGAL+L E+PKKL+VIGAGYIGLEMGSVW RLGSE
Sbjct:   180 IIVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSE 239

Query:   240 VTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDLSGDGVKLTLEPAAGGE 299
             VTVVEFAADIVP+MDGEIRKQFQRSLEKQKMKFMLKTKVVGVD SGDGVKL +EPA GGE
Sbjct:   240 VTVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGE 299

Query:   300 KTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGP 359
             +T LEADVVLVSAGRTPFT+GL L+KIGVETDK GRI VNERF+TN+ GVYAIGDVIPGP
Sbjct:   300 QTTLEADVVLVSAGRTPFTSGLDLEKIGVETDKGGRILVNERFSTNVSGVYAIGDVIPGP 359

Query:   360 MLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGK 419
             MLAHKAEEDGVACVEF+AGKHGHVDYDKVPGVVYT+PEVASVGKTEEQ+K+ GV Y VGK
Sbjct:   360 MLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASVGKTEEQLKKEGVSYNVGK 419

Query:   420 FPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAPNAGELIHEAAMA 469
             FPF+ANSRAKAID AEG+VKILA+KETDKILGVHIM+PNAGELIHEA +A
Sbjct:   420 FPFMANSRAKAIDTAEGMVKILADKETDKILGVHIMSPNAGELIHEAVLA 469


GO:0004148 "dihydrolipoyl dehydrogenase activity" evidence=IEA;ISS;IMP
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016668 "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005524 "ATP binding" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005747 "mitochondrial respiratory chain complex I" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0009060 "aerobic respiration" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2023782 mtLPD1 "mitochondrial lipoamide dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P31023 LPD "Dihydrolipoyl dehydrogenase, mitochondrial" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SPB1 flbr "Dihydrolipoyl dehydrogenase" [Vigna unguiculata (taxid:3917)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291648 lpd "glycine cleavage system L-protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00010794 dld-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P09622 DLD "Dihydrolipoyl dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N206 DLD "Dihydrolipoyl dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAF0 DLD "Dihydrolipoyl dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAR0 DLD "Dihydrolipoyl dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6GHY9DLDH_STAAR1, ., 8, ., 1, ., 40.44490.88250.8995yesno
Q9HN74DLDH_HALSA1, ., 8, ., 1, ., 40.39300.88050.8860yesno
P52992DLDH_CUPNH1, ., 8, ., 1, ., 40.49880.90350.9092yesno
O18480DLDH_MANSE1, ., 8, ., 1, ., 40.54870.90980.8732N/Ano
P0A9P3DLDH_SHIFL1, ., 8, ., 1, ., 40.42850.88880.8945yesno
Q9KPF6DLDH_VIBCH1, ., 8, ., 1, ., 40.42850.87420.8778yesno
O50286DLDH_VIBPA1, ., 8, ., 1, ., 40.44260.87420.8778yesno
O00087DLDH_SCHPO1, ., 8, ., 1, ., 40.56580.90560.8454yesno
P57303DLDH_BUCAI1, ., 8, ., 1, ., 40.39380.88050.8879yesno
P09623DLDH_PIG1, ., 8, ., 1, ., 40.58210.91190.8546yesno
P09622DLDH_HUMAN1, ., 8, ., 1, ., 40.56170.97900.9174yesno
P99084DLDH_STAAN1, ., 8, ., 1, ., 40.44490.88250.8995yesno
P09624DLDH_YEAST1, ., 8, ., 1, ., 40.54420.92450.8837yesno
Q5UWH2DLDH3_HALMA1, ., 8, ., 1, ., 40.42190.88250.8825yesno
P0A0E6DLDH_STAAM1, ., 8, ., 1, ., 40.44490.88250.8995yesno
P0A0E7DLDH_STAAW1, ., 8, ., 1, ., 40.44490.88250.8995yesno
Q9PJI3DLDH_CHLMU1, ., 8, ., 1, ., 40.40830.87840.9010yesno
Q9Z773DLDH_CHLPN1, ., 8, ., 1, ., 40.38790.88460.9154yesno
Q54EW8DLDH_DICDI1, ., 8, ., 1, ., 40.56630.88050.8606yesno
O84561DLDH_CHLTR1, ., 8, ., 1, ., 40.41430.87630.8989yesno
P0A0E8DLDH_STAAU1, ., 8, ., 1, ., 40.44490.88250.8995yesno
O08749DLDH_MOUSE1, ., 8, ., 1, ., 40.57530.91190.8546yesno
P49819DLDH_CANFA1, ., 8, ., 1, ., 40.58210.91190.8546yesno
Q8CIZ7DLDH_CRIGR1, ., 8, ., 1, ., 40.55740.97900.9174yesno
Q9M5K3DLDH1_ARATH1, ., 8, ., 1, ., 40.82280.99790.9388yesno
Q9M5K2DLDH2_ARATH1, ., 8, ., 1, ., 40.81490.99790.9388nono
O17953DLDH_CAEEL1, ., 8, ., 1, ., 40.57990.91190.8787yesno
Q60HG3DLDH_MACFA1, ., 8, ., 1, ., 40.56170.97900.9174N/Ano
Q04933DLDH_TRYBB1, ., 8, ., 1, ., 40.56730.86370.8601N/Ano
P43784DLDH_HAEIN1, ., 8, ., 1, ., 40.43090.88670.8849yesno
P31046DLDH3_PSEPU1, ., 8, ., 1, ., 40.54920.88670.9077yesno
Q6P6R2DLDH_RAT1, ., 8, ., 1, ., 40.58440.91190.8546yesno
P18925DLDH_AZOVI1, ., 8, ., 1, ., 40.48730.89510.8951yesno
P31023DLDH_PEA1, ., 8, ., 1, ., 40.81290.98530.9381N/Ano
P90597DLDH_TRYCR1, ., 8, ., 1, ., 40.57100.86160.8616N/Ano
P0A9P1DLDH_ECOL61, ., 8, ., 1, ., 40.42850.88880.8945yesno
Q9HUY1DLDH3_PSEAE1, ., 8, ., 1, ., 40.51640.88670.9057yesno
Q6GAB8DLDH_STAAS1, ., 8, ., 1, ., 40.44490.88250.8995yesno
Q5R4B1DLDH_PONAB1, ., 8, ., 1, ., 40.55530.97900.9174yesno
Q811C4DLDH_MESAU1, ., 8, ., 1, ., 40.58440.91190.9081N/Ano
Q5HGY8DLDH_STAAC1, ., 8, ., 1, ., 40.44490.88250.8995yesno
P21880DLDH1_BACSU1, ., 8, ., 1, ., 40.43450.88250.8957yesno
P95596DLDH_RHOCA1, ., 8, ., 1, ., 40.55280.83640.8788yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.8.1.40.994
3rd Layer1.8.10.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 0.0
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 0.0
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 0.0
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 0.0
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 0.0
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 0.0
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-180
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 1e-155
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 1e-117
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 1e-116
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-111
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 1e-109
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-108
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 1e-81
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 2e-73
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 1e-72
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 3e-70
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 3e-68
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 1e-67
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 1e-67
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 5e-67
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 1e-65
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 9e-60
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-58
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 2e-58
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 7e-56
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 8e-56
PLN02507499 PLN02507, PLN02507, glutathione reductase 2e-53
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 1e-47
PLN02546558 PLN02546, PLN02546, glutathione reductase 6e-43
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 7e-40
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 4e-38
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disu 1e-34
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 2e-23
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 7e-22
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-20
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 1e-20
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 8e-19
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 8e-16
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 3e-15
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 2e-14
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 3e-14
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 5e-14
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 3e-13
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 3e-13
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 4e-13
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 7e-13
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 3e-12
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 1e-11
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 2e-11
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 2e-10
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperox 3e-10
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 8e-10
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 3e-09
pfam01134391 pfam01134, GIDA, Glucose inhibited division protei 4e-09
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 2e-08
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 5e-08
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 2e-07
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 3e-07
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 4e-07
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 5e-07
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 7e-07
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 3e-06
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 6e-06
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 8e-06
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 8e-06
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-05
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 1e-05
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 1e-05
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 2e-05
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 2e-05
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 6e-05
PRK07843 557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrog 7e-05
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 7e-05
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 1e-04
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydroge 1e-04
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 1e-04
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 1e-04
PRK12842 574 PRK12842, PRK12842, putative succinate dehydrogena 2e-04
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 2e-04
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydroge 2e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 3e-04
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 3e-04
PRK12844 557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog 4e-04
PRK12835 584 PRK12835, PRK12835, 3-ketosteroid-delta-1-dehydrog 5e-04
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 6e-04
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 7e-04
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 9e-04
PRK07121492 PRK07121, PRK07121, hypothetical protein; Validate 0.001
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 0.001
PRK12839 572 PRK12839, PRK12839, hypothetical protein; Provisio 0.001
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 0.001
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.002
TIGR00031377 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mu 0.002
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 0.003
pfam01946229 pfam01946, Thi4, Thi4 family 0.004
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
 Score =  566 bits (1462), Expect = 0.0
 Identities = 231/437 (52%), Positives = 305/437 (69%), Gaps = 9/437 (2%)

Query: 41  SDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEK------RGALGGTCLNVGCIPSKALL 94
           S + DVVVIG GPGGYVAAI+AAQLGLK  CIE       + ALGGTCLNVGCIPSKALL
Sbjct: 2   SKQFDVVVIGAGPGGYVAAIRAAQLGLKVACIEAWKNPKGKPALGGTCLNVGCIPSKALL 61

Query: 95  HSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGY 154
            SS  +  A H FA HG+    V++D+  M+A+KDK V  +T GIEGLFKKNK+T +KG 
Sbjct: 62  ASSEEFENAGHHFADHGIHVDGVKIDVAKMIARKDKVVKKMTGGIEGLFKKNKITVLKGR 121

Query: 155 GKFISPSEVS--VDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNE 212
           G F+  ++    +       TV+  K++IIATGS+ + LPG+  D K I+ +TGAL   E
Sbjct: 122 GSFVGKTDAGYEIKVTGEDETVITAKHVIIATGSEPRHLPGVPFDNKIILDNTGALNFTE 181

Query: 213 VPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKF 272
           VPKKL VIGAG IGLE+GSVW RLG+EVT++E     + + D ++ K+  ++  KQ +  
Sbjct: 182 VPKKLAVIGAGVIGLELGSVWRRLGAEVTILEALPAFLAAADEQVAKEAAKAFTKQGLDI 241

Query: 273 MLKTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDK 332
            L  K+  +   G GV +    A G  +T LE D ++VS GR P T GLGL+ +G++ D+
Sbjct: 242 HLGVKIGEIKTGGKGVSVAYTDADGEAQT-LEVDKLIVSIGRVPNTDGLGLEAVGLKLDE 300

Query: 333 MGRIPVNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVV 392
            G IPV++   TN+P VYAIGDV+ GPMLAHKAEE+GVA  E +AG+ GH+DY+ +P V+
Sbjct: 301 RGFIPVDDHCRTNVPNVYAIGDVVRGPMLAHKAEEEGVAVAERIAGQKGHIDYNTIPWVI 360

Query: 393 YTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGV 452
           YT PE+A VGKTE+Q+K  GVEY+ GKFPF+AN RA A+ + +G VKI+A+ +TD+ILGV
Sbjct: 361 YTSPEIAWVGKTEQQLKAEGVEYKAGKFPFMANGRALAMGEPDGFVKIIADAKTDEILGV 420

Query: 453 HIMAPNAGELIHEAAMA 469
           H++ PNA ELI EA +A
Sbjct: 421 HVIGPNASELIAEAVVA 437


Length = 475

>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|217252 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|236111 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237224 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237221 PRK12835, PRK12835, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|237223 PRK12839, PRK12839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|232791 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 477
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PLN02507499 glutathione reductase 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PLN02546558 glutathione reductase 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
KOG4716503 consensus Thioredoxin reductase [Posttranslational 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 100.0
PRK12770352 putative glutamate synthase subunit beta; Provisio 100.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 100.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.98
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.98
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.98
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.97
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.97
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.97
PRK13984604 putative oxidoreductase; Provisional 99.97
PLN02852491 ferredoxin-NADP+ reductase 99.97
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.96
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.96
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.96
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.95
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.95
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.95
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.94
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.9
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.88
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.85
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.83
KOG2755334 consensus Oxidoreductase [General function predict 99.83
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.82
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.82
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.81
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.8
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.79
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.78
PTZ00188506 adrenodoxin reductase; Provisional 99.77
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.75
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 99.75
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.74
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 99.74
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.69
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.67
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.48
COG2081408 Predicted flavoproteins [General function predicti 99.41
PRK08401466 L-aspartate oxidase; Provisional 99.41
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.38
PRK09897534 hypothetical protein; Provisional 99.36
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.35
PRK12842 574 putative succinate dehydrogenase; Reviewed 99.34
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.34
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 99.34
PRK08275554 putative oxidoreductase; Provisional 99.32
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.28
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.27
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 99.26
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.26
PRK09077536 L-aspartate oxidase; Provisional 99.24
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.24
PRK07804541 L-aspartate oxidase; Provisional 99.23
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.23
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.21
PRK08071510 L-aspartate oxidase; Provisional 99.21
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.21
PRK07395 553 L-aspartate oxidase; Provisional 99.2
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.2
PRK06175433 L-aspartate oxidase; Provisional 99.18
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.17
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.16
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PLN02815 594 L-aspartate oxidase 99.15
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 99.11
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.1
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 99.1
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.08
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.05
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.0
PRK07512513 L-aspartate oxidase; Provisional 99.0
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.96
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.94
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.93
PRK11728393 hydroxyglutarate oxidase; Provisional 98.91
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.9
PLN02463447 lycopene beta cyclase 98.9
PRK08163396 salicylate hydroxylase; Provisional 98.88
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.88
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.87
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.86
PLN02661357 Putative thiazole synthesis 98.85
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.85
PRK10015429 oxidoreductase; Provisional 98.85
PRK06847375 hypothetical protein; Provisional 98.84
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.84
PRK08274 466 tricarballylate dehydrogenase; Validated 98.84
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.83
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.83
PRK10157428 putative oxidoreductase FixC; Provisional 98.83
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.82
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.82
COG0579429 Predicted dehydrogenase [General function predicti 98.8
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.78
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.78
PRK06184 502 hypothetical protein; Provisional 98.77
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.77
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.77
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.77
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.77
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.77
PRK06834488 hypothetical protein; Provisional 98.76
PRK09126392 hypothetical protein; Provisional 98.76
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.76
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.76
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.74
PRK07121492 hypothetical protein; Validated 98.72
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.72
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.72
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.72
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.71
PLN02697529 lycopene epsilon cyclase 98.7
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.69
PRK08013400 oxidoreductase; Provisional 98.69
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.69
PRK07190487 hypothetical protein; Provisional 98.68
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.68
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.67
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.66
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 98.66
PRK12839 572 hypothetical protein; Provisional 98.66
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.66
PRK06126 545 hypothetical protein; Provisional 98.66
PRK07588391 hypothetical protein; Provisional 98.65
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.65
PRK05257494 malate:quinone oxidoreductase; Validated 98.64
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.64
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.63
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.62
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.62
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.62
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.61
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.61
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.61
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.61
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.6
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.6
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.6
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.59
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.58
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.57
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.57
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.57
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.57
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.56
PRK11445351 putative oxidoreductase; Provisional 98.55
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.54
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.54
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.54
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.53
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.53
PRK08244493 hypothetical protein; Provisional 98.53
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.52
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.52
PRK06475400 salicylate hydroxylase; Provisional 98.5
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.5
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.5
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.49
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.47
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.46
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.45
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.44
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.44
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.43
PRK06185407 hypothetical protein; Provisional 98.43
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.43
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.42
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.42
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.42
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.42
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.42
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.41
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.41
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.41
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.4
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.39
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.39
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.38
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.38
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.38
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.37
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.37
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.37
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.37
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.36
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.35
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.35
PRK06996398 hypothetical protein; Provisional 98.34
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.33
PRK07236386 hypothetical protein; Provisional 98.33
PRK06753373 hypothetical protein; Provisional 98.32
PRK08294 634 phenol 2-monooxygenase; Provisional 98.32
PLN02985514 squalene monooxygenase 98.31
PRK07208479 hypothetical protein; Provisional 98.31
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.28
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.27
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.27
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.26
PRK07236386 hypothetical protein; Provisional 98.25
PRK06834 488 hypothetical protein; Provisional 98.25
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.25
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.24
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.22
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.21
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.21
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.17
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.17
PRK05868372 hypothetical protein; Validated 98.17
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.17
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 98.16
PRK08244 493 hypothetical protein; Provisional 98.16
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.13
PLN02568539 polyamine oxidase 98.13
PRK10262321 thioredoxin reductase; Provisional 98.13
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.13
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.12
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.12
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.12
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.12
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.12
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.12
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.11
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.11
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.11
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.1
PLN02268435 probable polyamine oxidase 98.1
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.1
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.1
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.1
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.1
PLN02576496 protoporphyrinogen oxidase 98.1
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.09
PTZ00367567 squalene epoxidase; Provisional 98.09
COG3349485 Uncharacterized conserved protein [Function unknow 98.09
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.08
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.08
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.08
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.07
PLN02529 738 lysine-specific histone demethylase 1 98.07
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.06
PRK07233434 hypothetical protein; Provisional 98.06
PRK05868372 hypothetical protein; Validated 98.05
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.04
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.04
PRK07045388 putative monooxygenase; Reviewed 98.04
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.04
PLN02463 447 lycopene beta cyclase 98.04
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.03
PLN02661357 Putative thiazole synthesis 98.03
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.02
PRK07190 487 hypothetical protein; Provisional 98.02
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.02
KOG2404 477 consensus Fumarate reductase, flavoprotein subunit 98.02
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.01
PRK10157 428 putative oxidoreductase FixC; Provisional 98.01
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.01
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.01
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.99
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.99
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.99
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.98
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.97
PRK12416463 protoporphyrinogen oxidase; Provisional 97.96
PRK06370463 mercuric reductase; Validated 97.95
TIGR02053463 MerA mercuric reductase. This model represents the 97.94
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.94
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.94
PRK06753373 hypothetical protein; Provisional 97.93
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.93
PRK06116450 glutathione reductase; Validated 97.92
PRK07538413 hypothetical protein; Provisional 97.92
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.9
KOG2853509 consensus Possible oxidoreductase [General functio 97.89
PLN02507499 glutathione reductase 97.89
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.89
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.88
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.88
PRK12831464 putative oxidoreductase; Provisional 97.86
PRK07846451 mycothione reductase; Reviewed 97.86
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.85
PRK14694468 putative mercuric reductase; Provisional 97.85
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.84
PLN02852 491 ferredoxin-NADP+ reductase 97.84
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.84
PLN02676487 polyamine oxidase 97.83
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.83
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.83
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.83
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.83
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.82
PRK09897 534 hypothetical protein; Provisional 97.81
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.8
PRK07045388 putative monooxygenase; Reviewed 97.79
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.78
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.78
PRK14727479 putative mercuric reductase; Provisional 97.78
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.78
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.78
PLN02697 529 lycopene epsilon cyclase 97.77
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.77
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.76
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.75
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.75
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 97.75
PTZ00052499 thioredoxin reductase; Provisional 97.74
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.74
PTZ00188 506 adrenodoxin reductase; Provisional 97.74
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.74
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.73
PLN02612567 phytoene desaturase 97.73
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.73
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.73
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.73
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.73
PRK07538413 hypothetical protein; Provisional 97.72
PLN02487569 zeta-carotene desaturase 97.72
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.71
PRK06996398 hypothetical protein; Provisional 97.7
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.7
PRK13748561 putative mercuric reductase; Provisional 97.68
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.68
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.67
PTZ00058561 glutathione reductase; Provisional 97.67
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.66
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 97.64
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.64
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.62
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.62
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.61
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.59
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.59
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.58
PLN02546558 glutathione reductase 97.58
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.56
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.56
PLN03000 881 amine oxidase 97.53
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.52
PRK11445351 putative oxidoreductase; Provisional 97.52
KOG2852380 consensus Possible oxidoreductase [General functio 97.49
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.47
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.46
PTZ00153659 lipoamide dehydrogenase; Provisional 97.45
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.45
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.44
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.44
PLN02976 1713 amine oxidase 97.43
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.38
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 97.38
PRK02106 560 choline dehydrogenase; Validated 97.38
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.37
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.36
COG3573 552 Predicted oxidoreductase [General function predict 97.35
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.35
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.32
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.32
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.32
PRK13984604 putative oxidoreductase; Provisional 97.3
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.28
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.26
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.23
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.23
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.21
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.17
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.17
PLN02985 514 squalene monooxygenase 97.13
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.1
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.08
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.08
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.98
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 96.96
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.95
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 96.92
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.91
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 96.91
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 96.88
PRK07233 434 hypothetical protein; Provisional 96.79
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 96.76
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 96.75
PRK08401 466 L-aspartate oxidase; Provisional 96.72
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 96.67
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.67
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 96.65
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 96.65
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.62
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 96.61
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.61
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 96.59
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.57
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.57
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 96.55
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.53
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 96.47
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 96.46
PLN02785587 Protein HOTHEAD 96.45
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 96.43
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.41
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 96.36
PRK08275 554 putative oxidoreductase; Provisional 96.35
PRK06175433 L-aspartate oxidase; Provisional 96.34
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.3
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 96.26
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.25
PRK07804 541 L-aspartate oxidase; Provisional 96.22
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 96.18
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 96.13
PTZ00367 567 squalene epoxidase; Provisional 96.09
PRK09231582 fumarate reductase flavoprotein subunit; Validated 96.02
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 96.01
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 95.95
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 95.94
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 95.93
PLN02815 594 L-aspartate oxidase 95.88
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.82
PRK08071510 L-aspartate oxidase; Provisional 95.82
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 95.8
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.69
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 95.64
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.62
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.58
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 95.56
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 95.54
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.44
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.2
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 95.17
PRK09077536 L-aspartate oxidase; Provisional 95.16
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.03
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.0
PRK06475 400 salicylate hydroxylase; Provisional 94.96
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.94
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.94
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.89
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.88
PRK06184 502 hypothetical protein; Provisional 94.85
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 94.82
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.76
PRK08163 396 salicylate hydroxylase; Provisional 94.72
PRK07395 553 L-aspartate oxidase; Provisional 94.72
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 94.69
PRK06847 375 hypothetical protein; Provisional 94.68
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=8.5e-80  Score=599.34  Aligned_cols=428  Identities=52%  Similarity=0.819  Sum_probs=396.3

Q ss_pred             CCCCcEEEECCChHHHHHHHHHHHCCCeEEEEecCCCCCceeeccCccCchhhhhhhHHHHHHHhhhhhCCccccccccC
Q 011787           41 SDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVD  120 (477)
Q Consensus        41 ~~~~dvvIIGgG~AGl~aA~~l~~~g~~V~lie~~~~~GG~~~~~~~~p~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~  120 (477)
                      +.+||++|||+||||..||.++++.|.+|++||+...+||+|+|.||+|+|.+++.+..++...+....+|+......++
T Consensus         2 ~~~yDvvVIG~GpaG~~aA~raa~~G~kvalvE~~~~lGGtCln~GCIPsK~Ll~~a~~~~~~~~~~~~~Gi~~~~~~id   81 (454)
T COG1249           2 MKEYDVVVIGAGPAGYVAAIRAAQLGLKVALVEKGERLGGTCLNVGCIPSKALLHAAEVIEEARHAAKEYGISAEVPKID   81 (454)
T ss_pred             CccccEEEECCCHHHHHHHHHHHhCCCCEEEEeecCCcCceEEeeCccccHHHHHHHHHHHHHhhcccccceecCCCCcC
Confidence            45799999999999999999999999999999997799999999999999999999999888776533678887766899


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhCCeEEEEeEEEEecCCEEEEEecCCceEEEEecEEEEccCCCCCCCCCCccCCce
Q 011787          121 LPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKR  200 (477)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~~~g~~~~i~~d~lvlAtG~~~~~~~g~~~~~~~  200 (477)
                      |.++..+++...+.+......++++++|+++.|++.+++++++.|...  +.+++.++++|||||++|..+|..+.++..
T Consensus        82 ~~~~~~~k~~v~~~~~~~~~~l~~~~~V~vi~G~a~f~~~~~v~V~~~--~~~~~~a~~iiIATGS~p~~~~~~~~~~~~  159 (454)
T COG1249          82 FEKLLARKDKVVRLLTGGVEGLLKKNGVDVIRGEARFVDPHTVEVTGE--DKETITADNIIIATGSRPRIPPGPGIDGAR  159 (454)
T ss_pred             HHHHHHHHHHHHHHHhhhHHHHHhhCCCEEEEEEEEECCCCEEEEcCC--CceEEEeCEEEEcCCCCCcCCCCCCCCCCe
Confidence            999999999988888888889999999999999999999999999866  347999999999999999988877777888


Q ss_pred             EecchhhhcccCCCCeeEEEcccHHHHHHHHHHHHcCCcEEEEEeCCCcCCCCCHHHHHHHHHHHHhcCcEEEeCceEEE
Q 011787          201 IVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVG  280 (477)
Q Consensus       201 ~~~~~~~~~~~~~~~~v~IiG~G~~g~e~a~~l~~~g~~Vtli~~~~~~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~  280 (477)
                      ++++++.+.+.+.|++++|||||++|+|+|..++++|.+||++++.++++|.+|+++++.+.+.|++.|+.+++++.+++
T Consensus       160 ~~~s~~~l~~~~lP~~lvIiGgG~IGlE~a~~~~~LG~~VTiie~~~~iLp~~D~ei~~~~~~~l~~~gv~i~~~~~v~~  239 (454)
T COG1249         160 ILDSSDALFLLELPKSLVIVGGGYIGLEFASVFAALGSKVTVVERGDRILPGEDPEISKELTKQLEKGGVKILLNTKVTA  239 (454)
T ss_pred             EEechhhcccccCCCEEEEECCCHHHHHHHHHHHHcCCcEEEEecCCCCCCcCCHHHHHHHHHHHHhCCeEEEccceEEE
Confidence            99998877777999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcCCeEEEEEeecCCCceEEEEcCEEEEeecCCCCCCCCCccccceeecCCCCeecCCCCCCCCCCeEEecccCCCCC
Q 011787          281 VDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPM  360 (477)
Q Consensus       281 i~~~~~~~~v~~~~~~~~~~~~i~~D~vi~a~G~~p~~~~l~~~~~gl~~~~~g~i~vd~~l~t~~~~vya~GD~~~~~~  360 (477)
                      ++..++++.+++++.   .+..+++|.+++|+|++||++.+.++++|++++++|+|.||+.++|++|+|||+|||++.|+
T Consensus       240 ~~~~~~~v~v~~~~g---~~~~~~ad~vLvAiGR~Pn~~~LgLe~~Gv~~~~rg~I~VD~~~~Tnvp~IyA~GDV~~~~~  316 (454)
T COG1249         240 VEKKDDGVLVTLEDG---EGGTIEADAVLVAIGRKPNTDGLGLENAGVELDDRGFIKVDDQMTTNVPGIYAIGDVIGGPM  316 (454)
T ss_pred             EEecCCeEEEEEecC---CCCEEEeeEEEEccCCccCCCCCChhhcCceECCCCCEEeCCccccCCCCEEEeeccCCCcc
Confidence            988777777777632   22289999999999999999999999999999999999999778899999999999999999


Q ss_pred             chhHHHHHHHHHHHHHcC-CCCCCCCCCCceEEEcCCCeeeecCCHHHHHHcCCCEEEEEEecCccccchhcCCCceEEE
Q 011787          361 LAHKAEEDGVACVEFLAG-KHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVK  439 (477)
Q Consensus       361 ~~~~A~~~g~~aa~~i~~-~~~~~~~~~~p~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k  439 (477)
                      ++|.|.+||++||+||++ .....++..+|+++|++|++++||+||+|+++.+++|++..+++....++....++.||+|
T Consensus       317 Lah~A~~eg~iaa~~i~g~~~~~~d~~~iP~~ift~Peia~VGlte~ea~~~g~~~~~~~~~f~~~~ra~~~~~~~G~~K  396 (454)
T COG1249         317 LAHVAMAEGRIAAENIAGGKRTPIDYRLIPSVVFTDPEIASVGLTEEEAKEAGIDYKVGKFPFAANGRAITMGETDGFVK  396 (454)
T ss_pred             cHhHHHHHHHHHHHHHhCCCCCcCcccCCCEEEECCCcceeeeCCHHHHHhcCCceEEEEeecccchhHHhccCCceEEE
Confidence            999999999999999997 4556789999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEECCCCeEEEEEEEcCChHHHHHHHHHHhcCC
Q 011787          440 ILAEKETDKILGVHIMAPNAGELIHEAAMATHDK  473 (477)
Q Consensus       440 ~~~~~~~~~i~G~~~~g~~~~~~~~~~~~~~~~~  473 (477)
                      +++|++|++|||+|++|++|+||||++++|+.+.
T Consensus       397 lv~d~~t~~IlGahivg~~A~ElI~~~~~a~~~g  430 (454)
T COG1249         397 LVVDKETGRILGAHIVGPGASELINEIALAIEMG  430 (454)
T ss_pred             EEEECCCCeEEEEEEECCCHHHHHHHHHHHHHCC
Confidence            9999999999999999999999999999999854



>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 0.0
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 1e-139
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 1e-139
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 1e-139
2qae_A468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 1e-128
1jeh_A478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 1e-123
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 1e-123
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-108
1lpf_A477 Three-Dimensional Structure Of Lipoamide Dehydrogen 1e-106
3lad_A476 Refined Crystal Structure Of Lipoamide Dehydrogenas 1e-106
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 1e-89
2eq6_A464 Crystal Structure Of Lipoamide Dehydrogenase From T 2e-87
1bhy_A482 Low Temperature Middle Resolution Structure Of P64k 2e-67
1ojt_A482 Structure Of Dihydrolipoamide Dehydrogenase Length 2e-67
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 3e-66
3ii4_A466 Structure Of Mycobacterial Lipoamide Dehydrogenase 3e-58
2a8x_A464 Crystal Structure Of Lipoamide Dehydrogenase From M 1e-57
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 4e-48
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 2e-47
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 4e-43
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 2e-42
2grt_A461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 3e-42
1grt_A478 Human Glutathione Reductase A34eR37W MUTANT Length 3e-42
3djg_X477 Catalytic Cycle Of Human Glutathione Reductase Near 4e-42
1bwc_A478 Structure Of Human Glutathione Reductase Complexed 4e-42
2aaq_A479 Crystal Structure Analysis Of The Human Glutahione 4e-42
1xan_A461 Human Glutathione Reductase In Complex With A Xanth 5e-42
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 7e-41
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 8e-41
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 8e-41
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 9e-41
1grg_A478 Substrate Binding And Catalysis By Glutathione Redu 1e-40
1dnc_A478 Human Glutathione Reductase Modified By Diglutathio 1e-40
1gsn_A478 Human Glutathione Reductase Modified By Dinitrosogl 2e-40
1k4q_A463 Human Glutathione Reductase Inactivated By Peroxyni 8e-40
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 1e-39
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 9e-39
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 9e-37
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 9e-37
1ger_A450 The Structure Of Glutathione Reductase From Escheri 5e-36
1tyt_A487 Crystal And Molecular Structure Of Crithidia Fascic 1e-35
1typ_A487 Substrate Interactions Between Trypanothione Reduct 1e-35
3h4k_A598 Crystal Structure Of The Wild Type Thioredoxin Glut 3e-35
2x8c_A598 Thioredoxin Glutathione Reductase From Schistosoma 4e-35
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 4e-35
2v6o_A596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 4e-35
1fea_A490 Unliganded Crithidia Fasciculata Trypanothione Redu 4e-35
2tpr_A490 X-ray Structure Of Trypanothione Reductase From Cri 5e-35
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 3e-33
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 4e-33
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 4e-33
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-33
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-33
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 5e-33
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 5e-32
3o0h_A484 Crystal Structure Of Glutathione Reductase From Bar 6e-32
3ic9_A492 The Structure Of Dihydrolipoamide Dehydrogenase Fro 2e-31
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 2e-30
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 2e-30
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 6e-30
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 6e-30
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 2e-29
1xdi_A499 Crystal Structure Of Lpda (Rv3303c) From Mycobacter 6e-29
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 4e-27
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 5e-25
1mo9_A523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 2e-17
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 4e-11
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 6e-11
4eqx_A437 Crystal Structure Of The C43s Mutant Of Staphylococ 2e-10
1yqz_A438 Structure Of Coenzyme A-Disulfide Reductase From St 2e-10
4emw_A436 Crystal Structure Of Staphylococcus Aureus Bound Wi 2e-10
4em3_A437 Crystal Structure Of Staphylococcus Aureus Bound Wi 2e-10
4eqs_A437 Crystal Structure Of The Y419f Mutant Of Staphyloco 2e-10
4eqr_A437 Crystal Structure Of The Y361f Mutant Of Staphyloco 2e-10
4eqw_A437 Crystal Structure Of The Y361f, Y419f Mutant Of Sta 3e-10
2bc0_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 2e-09
2bc1_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 2e-09
3ntd_A 565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 4e-09
3cty_A319 Crystal Structure Of T. Acidophilum Thioredoxin Red 7e-09
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 1e-08
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 2e-08
2q7v_A325 Crystal Structure Of Deinococcus Radiodurans Thiore 5e-08
4gcm_A312 Crystal Structure Of A Thioredoxine Reductase (Trxb 7e-08
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 2e-07
3oc4_A452 Crystal Structure Of A Pyridine Nucleotide-Disulfid 5e-07
3nt6_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 5e-07
3nta_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 6e-07
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 3e-06
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 3e-06
1fl2_A310 Catalytic Core Component Of The Alkylhydroperoxide 3e-06
3ef6_A410 Crystal Structure Of Toluene 2,3-Dioxygenase Reduct 4e-06
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 7e-06
1nhs_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 8e-06
1joa_A447 Nadh Peroxidase With Cysteine-Sulfenic Acid Length 9e-06
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 9e-06
1nhp_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 9e-06
1f8w_A447 Crystal Structure Of Nadh Peroxidase Mutant: R303m 2e-05
2a87_A335 Crystal Structure Of M. Tuberculosis Thioredoxin Re 4e-05
1hyu_A521 Crystal Structure Of Intact Ahpf Length = 521 2e-04
2v3a_A384 Crystal Structure Of Rubredoxin Reductase From Pseu 7e-04
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure

Iteration: 1

Score = 765 bits (1975), Expect = 0.0, Method: Compositional matrix adjust. Identities = 382/470 (81%), Positives = 411/470 (87%), Gaps = 30/470 (6%) Query: 38 ASASDENDXXXXXXXXXXXXAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSS 97 AS SDEND AAIKAAQLG KTTCIEKRGALGGTCLNVGCIPSKALLHSS Sbjct: 1 ASGSDENDVVIIGGGPGGYVAAIKAAQLGFKTTCIEKRGALGGTCLNVGCIPSKALLHSS 60 Query: 98 HMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF 157 HMYHEA HSFA+HGVK S+VE+DL AMM QKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF Sbjct: 61 HMYHEAKHSFANHGVKVSNVEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF 120 Query: 158 ISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKL 217 +SPSE+SVDTIEG NTVVKGK+IIIATGSDVKSLPG+TIDEK+IVSSTGALAL+E+PKKL Sbjct: 121 VSPSEISVDTIEGENTVVKGKHIIIATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKL 180 Query: 218 VVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTK 277 VVIGAGYIGLEMGSVW R+GSEVTVVEFA++IVP+MD EIRKQFQRSLEKQ MKF LKTK Sbjct: 181 VVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLKTK 240 Query: 278 VVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIP 337 VVGVD SGDGVKLT+EP+AGGE+TI+EADVVLVSAGRTPFT+GL LDKIGVETDK+GRI Sbjct: 241 VVGVDTSGDGVKLTVEPSAGGEQTIIEADVVLVSAGRTPFTSGLNLDKIGVETDKLGRIL 300 Query: 338 VNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPE 397 VNERF+TN+ GVYAIGDVIPGPMLAHKAEEDGVACVE+LAGK GHVDYDKVPGVVYT+PE Sbjct: 301 VNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEYLAGKVGHVDYDKVPGVVYTNPE 360 Query: 398 VASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAP 457 VASVGKTEEQVKE GVEYRVGKFPF+ANSRAKAID+AEG+VKI+AEKETDKILGVHIMAP Sbjct: 361 VASVGKTEEQVKETGVEYRVGKFPFMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAP 420 Query: 458 NAGELIH------------------------------EAAMATHDKPIHI 477 NAGELIH EAAMAT+DKPIHI Sbjct: 421 NAGELIHEAAIALQYDASSEDIARVCHAHPTMSEAIKEAAMATYDKPIHI 470
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|1BHY|A Chain A, Low Temperature Middle Resolution Structure Of P64k From Masc Data Length = 482 Back     alignment and structure
>pdb|1OJT|A Chain A, Structure Of Dihydrolipoamide Dehydrogenase Length = 482 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|3II4|A Chain A, Structure Of Mycobacterial Lipoamide Dehydrogenase Bound To A Triazaspirodimethoxybenzoyl Inhibitor Length = 466 Back     alignment and structure
>pdb|2A8X|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Mycobacterium Tuberculosis Length = 464 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From Colwellia Psychrerythraea 34h. Length = 492 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|1XDI|A Chain A, Crystal Structure Of Lpda (Rv3303c) From Mycobacterium Tuberculosis Length = 499 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|4EQX|A Chain A, Crystal Structure Of The C43s Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|1YQZ|A Chain A, Structure Of Coenzyme A-Disulfide Reductase From Staphylococcus Aureus Refined At 1.54 Angstrom Resolution Length = 438 Back     alignment and structure
>pdb|4EMW|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Etvc-Coa Length = 436 Back     alignment and structure
>pdb|4EM3|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Mevs-Coa Length = 437 Back     alignment and structure
>pdb|4EQS|A Chain A, Crystal Structure Of The Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQR|A Chain A, Crystal Structure Of The Y361f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQW|A Chain A, Crystal Structure Of The Y361f, Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|2BC0|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: Wild-Type Nox Length = 490 Back     alignment and structure
>pdb|2BC1|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: C44s Nox Length = 490 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|3CTY|A Chain A, Crystal Structure Of T. Acidophilum Thioredoxin Reductase Length = 319 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|2Q7V|A Chain A, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase Length = 325 Back     alignment and structure
>pdb|4GCM|A Chain A, Crystal Structure Of A Thioredoxine Reductase (Trxb) From Staphylococcus Aureus Subsp. Aureus Mu50 At 1.80 A Resolution Length = 312 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|3OC4|A Chain A, Crystal Structure Of A Pyridine Nucleotide-Disulfide Family Oxidoreductase From The Enterococcus Faecalis V583 Length = 452 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|1FL2|A Chain A, Catalytic Core Component Of The Alkylhydroperoxide Reductase Ahpf From E.Coli Length = 310 Back     alignment and structure
>pdb|3EF6|A Chain A, Crystal Structure Of Toluene 2,3-Dioxygenase Reductase Length = 410 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHS|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1JOA|A Chain A, Nadh Peroxidase With Cysteine-Sulfenic Acid Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHP|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1F8W|A Chain A, Crystal Structure Of Nadh Peroxidase Mutant: R303m Length = 447 Back     alignment and structure
>pdb|2A87|A Chain A, Crystal Structure Of M. Tuberculosis Thioredoxin Reductase Length = 335 Back     alignment and structure
>pdb|1HYU|A Chain A, Crystal Structure Of Intact Ahpf Length = 521 Back     alignment and structure
>pdb|2V3A|A Chain A, Crystal Structure Of Rubredoxin Reductase From Pseudomonas Aeruginosa. Length = 384 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 0.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 0.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 0.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 0.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 0.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 0.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 0.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 0.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 0.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 0.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 0.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 0.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 0.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 0.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 0.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 0.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 0.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 1e-177
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 1e-155
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 1e-152
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 1e-149
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 1e-147
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 1e-147
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 1e-143
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-142
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-142
4dna_A463 Probable glutathione reductase; structural genomic 1e-140
1fec_A490 Trypanothione reductase; redox-active center, oxid 1e-137
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 1e-136
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 1e-134
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 2e-36
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 2e-36
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 6e-36
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 5e-35
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 6e-35
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 9e-35
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 2e-34
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 4e-34
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 1e-33
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 5e-32
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 9e-26
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 4e-24
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 7e-24
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 1e-23
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 2e-23
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 4e-23
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 1e-22
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 2e-21
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 4e-21
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 3e-20
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 5e-20
4fk1_A304 Putative thioredoxin reductase; structural genomic 8e-20
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-19
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-19
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 1e-19
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 4e-19
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 8e-19
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-18
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-16
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 8e-16
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 2e-05
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 4e-15
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 8e-05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 7e-15
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 6e-13
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 2e-12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 5e-12
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 4e-04
3r9u_A315 Thioredoxin reductase; structural genomics, center 8e-12
3r9u_A315 Thioredoxin reductase; structural genomics, center 6e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 4e-10
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 5e-10
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 2e-09
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 1e-08
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 3e-08
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 5e-08
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 5e-08
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 7e-08
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 8e-08
2gqf_A401 Hypothetical protein HI0933; structural genomics, 2e-07
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-07
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-07
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 3e-07
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 4e-07
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 8e-07
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 1e-06
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 2e-06
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 3e-06
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 3e-06
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 4e-06
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 5e-06
3atr_A453 Conserved archaeal protein; saturating double bond 6e-06
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 6e-06
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 7e-06
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 8e-06
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 8e-06
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 1e-05
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 2e-05
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-05
2ywl_A180 Thioredoxin reductase related protein; uncharacter 2e-05
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 2e-05
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 4e-05
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 7e-05
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 1e-04
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 1e-04
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-04
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 2e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 3e-04
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 3e-04
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 4e-04
2bry_A497 NEDD9 interacting protein with calponin homology a 6e-04
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 7e-04
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 7e-04
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 7e-04
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 8e-04
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 9e-04
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
 Score =  770 bits (1991), Expect = 0.0
 Identities = 392/470 (83%), Positives = 422/470 (89%), Gaps = 30/470 (6%)

Query: 38  ASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSS 97
           AS SDENDVV+IGGGPGGYVAAIKAAQLG KTTCIEKRGALGGTCLNVGCIPSKALLHSS
Sbjct: 1   ASGSDENDVVIIGGGPGGYVAAIKAAQLGFKTTCIEKRGALGGTCLNVGCIPSKALLHSS 60

Query: 98  HMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF 157
           HMYHEA HSFA+HGVK S+VE+DL AMM QKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF
Sbjct: 61  HMYHEAKHSFANHGVKVSNVEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKF 120

Query: 158 ISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKL 217
           +SPSE+SVDTIEG NTVVKGK+IIIATGSDVKSLPG+TIDEK+IVSSTGALAL+E+PKKL
Sbjct: 121 VSPSEISVDTIEGENTVVKGKHIIIATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKL 180

Query: 218 VVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTK 277
           VVIGAGYIGLEMGSVW R+GSEVTVVEFA++IVP+MD EIRKQFQRSLEKQ MKF LKTK
Sbjct: 181 VVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLKTK 240

Query: 278 VVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIP 337
           VVGVD SGDGVKLT+EP+AGGE+TI+EADVVLVSAGRTPFT+GL LDKIGVETDK+GRI 
Sbjct: 241 VVGVDTSGDGVKLTVEPSAGGEQTIIEADVVLVSAGRTPFTSGLNLDKIGVETDKLGRIL 300

Query: 338 VNERFATNIPGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPE 397
           VNERF+TN+ GVYAIGDVIPGPMLAHKAEEDGVACVE+LAGK GHVDYDKVPGVVYT+PE
Sbjct: 301 VNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEYLAGKVGHVDYDKVPGVVYTNPE 360

Query: 398 VASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDAEGIVKILAEKETDKILGVHIMAP 457
           VASVGKTEEQVKE GVEYRVGKFPF+ANSRAKAID+AEG+VKI+AEKETDKILGVHIMAP
Sbjct: 361 VASVGKTEEQVKETGVEYRVGKFPFMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAP 420

Query: 458 NAGELI------------------------------HEAAMATHDKPIHI 477
           NAGELI                               EAAMAT+DKPIHI
Sbjct: 421 NAGELIHEAAIALQYDASSEDIARVCHAHPTMSEAIKEAAMATYDKPIHI 470


>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Length = 338 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 100.0
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 100.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.98
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.98
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.98
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.97
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.97
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.96
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.95
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.94
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.93
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.9
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.85
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.83
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.73
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.72
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.61
2cul_A232 Glucose-inhibited division protein A-related PROT 99.58
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.58
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.45
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.39
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.33
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.33
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.28
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.23
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.17
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.16
3dme_A369 Conserved exported protein; structural genomics, P 99.13
2cul_A232 Glucose-inhibited division protein A-related PROT 99.08
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.03
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.02
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.0
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.97
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.96
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.96
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.94
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.93
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.93
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.92
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.92
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.91
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.9
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.89
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.89
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.88
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.86
2bry_A497 NEDD9 interacting protein with calponin homology a 98.86
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.85
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.85
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.84
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.83
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.82
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.82
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.81
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.8
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.77
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.75
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.75
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.74
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.74
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.74
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.73
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.71
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.68
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.67
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.66
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.65
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.62
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.61
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.61
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.6
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.59
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.59
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.58
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.57
3atr_A453 Conserved archaeal protein; saturating double bond 98.56
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.56
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.56
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.56
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.55
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.55
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.55
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.55
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.55
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.54
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.54
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.53
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.52
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.52
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.51
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.51
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.5
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.49
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.48
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.48
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.48
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.47
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.46
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.45
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.44
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.41
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.39
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.38
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.38
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.37
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.37
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.36
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.36
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.35
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.35
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.34
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.33
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.32
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.32
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.31
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.3
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.3
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.3
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.3
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.3
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.29
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.29
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.29
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.28
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.28
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.27
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.27
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.26
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.26
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.25
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.25
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.25
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.24
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.24
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.23
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.23
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.21
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.2
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.2
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.19
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.19
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.19
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.19
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.19
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.18
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.18
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.18
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.17
3atr_A 453 Conserved archaeal protein; saturating double bond 98.17
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.16
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.16
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.16
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.16
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.16
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.15
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.14
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.14
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.13
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.13
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.13
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.13
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.12
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.12
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.11
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.11
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.11
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.11
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.11
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.09
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.08
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.08
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.08
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.08
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.07
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.07
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.06
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.05
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.05
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.03
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.03
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.03
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.03
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.03
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.03
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.99
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.99
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.97
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.97
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.97
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.96
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.96
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.96
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.96
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.96
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.95
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.95
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.94
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.93
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.93
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.92
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.92
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.91
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.91
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.9
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.88
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.88
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.88
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.87
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.85
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.85
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.84
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.84
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.82
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.82
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.81
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.79
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.79
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 97.79
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.78
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.78
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.76
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.75
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.75
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.75
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.73
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.73
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.71
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.7
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.7
4dna_A463 Probable glutathione reductase; structural genomic 97.66
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.64
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 97.63
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.62
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.6
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.58
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.57
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.55
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.53
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.52
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.5
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.49
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.49
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.49
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.45
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.42
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.4
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.38
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.38
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.32
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.29
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.24
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.22
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.19
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.17
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.12
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.07
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.07
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.02
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.02
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.97
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.97
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.94
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.93
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.93
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.85
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.75
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.75
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.74
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.67
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.67
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.25
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.08
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.04
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.77
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.65
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.47
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.35
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.32
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.28
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 94.99
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 94.74
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.29
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.13
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 94.08
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.05
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.04
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.0
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 94.0
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 93.99
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.93
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.85
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.84
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 93.68
3dme_A 369 Conserved exported protein; structural genomics, P 93.66
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.61
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.61
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.57
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 93.54
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.52
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 93.51
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.46
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 93.43
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 93.38
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 93.33
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 93.3
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 93.25
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.25
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 93.25
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.17
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.16
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.13
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 93.1
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 93.06
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.06
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.01
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.98
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 92.96
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 92.96
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.9
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 92.79
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 92.78
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 92.73
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.65
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.58
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.57
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 92.51
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 92.47
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 92.45
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.34
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.32
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 92.31
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 92.28
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 92.26
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 92.25
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 92.22
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 92.19
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.19
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 92.18
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 92.14
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.12
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 92.1
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 92.07
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.06
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 91.92
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 91.85
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 91.82
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.73
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.66
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.65
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.63
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 91.57
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.56
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.54
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 91.54
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.54
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 91.5
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 91.49
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 91.34
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 91.25
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 91.23
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.21
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.19
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 91.18
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.14
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.14
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.13
3qha_A296 Putative oxidoreductase; seattle structural genomi 91.08
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 91.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 90.95
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 90.91
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.91
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 90.9
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.89
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.85
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 90.66
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 90.61
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 90.5
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.45
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 90.44
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.44
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 90.33
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 90.32
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 90.3
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 90.27
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 90.23
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 90.22
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.2
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.05
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 90.05
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 90.04
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.98
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 89.98
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.96
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 89.94
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 89.88
3l6d_A306 Putative oxidoreductase; structural genomics, prot 89.83
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 89.83
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.81
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 89.71
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.68
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 89.67
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.66
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.62
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 89.49
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 89.49
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.43
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 89.38
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 89.37
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 89.36
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.36
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 89.15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 89.13
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 89.06
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 88.94
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.83
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.82
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 88.79
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
Probab=100.00  E-value=2.8e-71  Score=562.68  Aligned_cols=437  Identities=56%  Similarity=0.922  Sum_probs=399.6

Q ss_pred             CCCCCCCCcEEEECCChHHHHHHHHHHHCCCeEEEEecCCCCCceeeccCccCchhhhhhhHHHHHHHhhhhhCCccccc
Q 011787           37 FASASDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSS  116 (477)
Q Consensus        37 ~~~~~~~~dvvIIGgG~AGl~aA~~l~~~g~~V~lie~~~~~GG~~~~~~~~p~~~l~~~~~~~~~~~~~~~~~g~~~~~  116 (477)
                      +.+++.++||+||||||||++||..|++.|++|+|||+++.+||+|.+.+|+|++.++.....+......+..+++....
T Consensus        19 ~~~~m~~~dVvVIGgG~aGl~aA~~la~~G~~V~liEk~~~~GG~~~~~gciP~k~l~~~~~~~~~~~~~~~~~g~~~~~   98 (491)
T 3urh_A           19 YFQSMMAYDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHQAQHGLEALGVEVAN   98 (491)
T ss_dssp             -------CCEEEECCSHHHHHHHHHHHHTTCCEEEEESSSSSSHHHHHHSHHHHHHHHHHHHHHHHHHHSSGGGTEECCC
T ss_pred             chhhcccCCEEEECCCHHHHHHHHHHHHCCCeEEEEecCCCCCCccccccchhhHHHHHHHHHHHHHHhhHhhcCcccCC
Confidence            44455679999999999999999999999999999999899999999999999999998888888777767788888777


Q ss_pred             cccChHHHHHHHHHHHHHHHHHHHHHhhhCCeEEEEeEEEEecCCEEEEEecCCceEEEEecEEEEccCCCCCCCCCCc-
Q 011787          117 VEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGIT-  195 (477)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~~~g~~~~i~~d~lvlAtG~~~~~~~g~~-  195 (477)
                      ..++|..+..+.......+...+...+++.+++++.+.+.+++++.+.|.+.+|...++.||+||||||++|+.+|++. 
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~g~~~~~~~~~~~v~~~~g~~~~~~~d~lViATGs~p~~ipg~~~  178 (491)
T 3urh_A           99 PKLNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKGEEQVLEAKNVVIATGSDVAGIPGVEV  178 (491)
T ss_dssp             CEECHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEESEEEECSSSEEEEECTTSCEEEEECSEEEECCCEECCCBTTBCC
T ss_pred             CccCHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEEEEEEEEecCCEEEEEeCCCceEEEEeCEEEEccCCCCCCCCCccc
Confidence            7899999999999999888888888899999999999999999999999988876678999999999999998888876 


Q ss_pred             -cCCceEecchhhhcccCCCCeeEEEcccHHHHHHHHHHHHcCCcEEEEEeCCCcCCCCCHHHHHHHHHHHHhcCcEEEe
Q 011787          196 -IDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFML  274 (477)
Q Consensus       196 -~~~~~~~~~~~~~~~~~~~~~v~IiG~G~~g~e~a~~l~~~g~~Vtli~~~~~~~~~~~~~~~~~~~~~l~~~gv~~~~  274 (477)
                       .+...++++.+...+...+++++|||+|++|+|+|..|++.|.+|+++++.+++++.+++++.+.+.+.+++.||++++
T Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~vvViGgG~~g~E~A~~l~~~g~~Vtlv~~~~~~l~~~d~~~~~~l~~~l~~~gV~v~~  258 (491)
T 3urh_A          179 AFDEKTIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAKQLQRMLTKQGIDFKL  258 (491)
T ss_dssp             CCCSSSEECHHHHTSCSSCCSEEEEECCSHHHHHHHHHHHHHTCEEEEECSSSSSSSSSCHHHHHHHHHHHHHTTCEEEC
T ss_pred             ccCCeeEEehhHhhhhhhcCCeEEEECCCHHHHHHHHHHHHcCCEEEEEeccccccccCCHHHHHHHHHHHHhCCCEEEE
Confidence             4567789999998888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEEEEcCCeEEEEEeecCCCceEEEEcCEEEEeecCCCCCCCCCccccceeecCCCCeecCCCCCCCCCCeEEecc
Q 011787          275 KTKVVGVDLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGD  354 (477)
Q Consensus       275 ~~~v~~i~~~~~~~~v~~~~~~~~~~~~i~~D~vi~a~G~~p~~~~l~~~~~gl~~~~~g~i~vd~~l~t~~~~vya~GD  354 (477)
                      ++++.+++.+++++.+.+.+..+++.+++++|.|++|+|++|+++.+.++..|+.++++|+|.||+++||++|+|||+||
T Consensus       259 ~~~v~~i~~~~~~~~v~~~~~~~g~~~~i~~D~Vi~a~G~~p~~~~l~l~~~g~~~~~~G~i~vd~~~~t~~~~IyA~GD  338 (491)
T 3urh_A          259 GAKVTGAVKSGDGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGD  338 (491)
T ss_dssp             SEEEEEEEEETTEEEEEEEETTSCCCEEEEESEEEECCCCEECCTTSCHHHHTCCBCTTSCBCCCTTCBCSSTTEEECGG
T ss_pred             CCeEEEEEEeCCEEEEEEEecCCCceEEEEcCEEEEeeCCccCCCccCchhcCceECCCCCEeECCCCCCCCCCEEEEEe
Confidence            99999999888888887765333445789999999999999999987778889999999999999999999999999999


Q ss_pred             cCCCCCchhHHHHHHHHHHHHHcCCCCCCCCCCCceEEEcCCCeeeecCCHHHHHHcCCCEEEEEEecCccccchhcCCC
Q 011787          355 VIPGPMLAHKAEEDGVACVEFLAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDDA  434 (477)
Q Consensus       355 ~~~~~~~~~~A~~~g~~aa~~i~~~~~~~~~~~~p~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  434 (477)
                      |++.|.+++.|..||++||+||++...++++..+|+++|++|+++++|+||+||++.|+++.++.+++....++.+.+++
T Consensus       339 ~~~~~~~~~~A~~~g~~aa~~i~g~~~~~~~~~~p~~~~~~p~~a~vGlte~~a~~~g~~~~~~~~~~~~~~~~~~~~~~  418 (491)
T 3urh_A          339 VVRGPMLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKIGKFPFTANGRARAMLQT  418 (491)
T ss_dssp             GSSSCCCHHHHHHHHHHHHHHHTTSCCCCCTTCCCEEECSSSCEEEEECCHHHHHHTTCCEEEEEEEGGGCHHHHHTTCC
T ss_pred             cCCCccchhHHHHHHHHHHHHHcCCCcccCCCCCCEEEEccCCeEEEeCCHHHHHhCCCCEEEEEEecCcchhhhcCCCC
Confidence            99999999999999999999999987778899999999999999999999999999999999999999999999988888


Q ss_pred             ceEEEEEEECCCCeEEEEEEEcCChHHHHHHHHHHhcCC
Q 011787          435 EGIVKILAEKETDKILGVHIMAPNAGELIHEAAMATHDK  473 (477)
Q Consensus       435 ~~~~k~~~~~~~~~i~G~~~~g~~~~~~~~~~~~~~~~~  473 (477)
                      +|++|+++|+++++|||+|++|++|.|+|+.+++||.++
T Consensus       419 ~g~~k~i~~~~~~~ilG~~~~g~~a~e~i~~~~~ai~~~  457 (491)
T 3urh_A          419 DGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFG  457 (491)
T ss_dssp             CCEEEEEEETTTCBEEEEEEESTTHHHHHHHHHHHHHTT
T ss_pred             cEEEEEEEECCCCEEEEEEEECCCHHHHHHHHHHHHHCC
Confidence            999999999999999999999999999999999999854



>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 477
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-40
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 5e-19
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-39
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-31
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 8e-35
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-28
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 2e-33
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 2e-33
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 3e-17
d1dxla3123 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenas 1e-32
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-31
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 7e-26
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 6e-31
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 4e-22
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 8e-05
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 3e-29
d3lada3124 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenas 9e-28
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 9e-28
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-27
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-15
d1v59a3123 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenas 1e-27
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-27
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-27
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-26
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 5e-22
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 5e-26
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-25
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 1e-23
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 4e-25
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 1e-21
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 3e-24
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-23
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 6e-12
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 1e-22
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 2e-20
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 3e-22
d1mo9a3140 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl c 7e-22
d1ojta3128 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenas 2e-21
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 2e-21
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 2e-14
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 6e-21
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 1e-20
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 3e-20
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-12
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 2e-19
d1ebda3115 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenas 9e-19
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 1e-18
d1gesa3115 d.87.1.1 (A:336-450) Glutathione reductase {Escher 9e-18
d1feca3128 d.87.1.1 (A:358-485) Trypanothione reductase {Crit 9e-18
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 1e-17
d1h6va3133 d.87.1.1 (A:367-499) Mammalian thioredoxin reducta 2e-17
d1xdia2118 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenas 2e-17
d1onfa3119 d.87.1.1 (A:377-495) Glutathione reductase {Plasmo 3e-17
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 4e-17
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 4e-17
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 1e-16
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 1e-16
d3grsa3115 d.87.1.1 (A:364-478) Glutathione reductase {Human 4e-16
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 4e-16
d1lvla3123 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenas 4e-15
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 5e-15
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 1e-14
d1nhpa3126 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus 2e-14
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 2e-14
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 1e-13
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-13
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 3e-05
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 5e-13
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-12
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 4e-12
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 3e-11
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 8e-11
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 2e-10
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 2e-10
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-10
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 6e-10
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 7e-10
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 2e-09
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 2e-09
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-09
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 6e-08
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 3e-09
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 4e-09
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 4e-09
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 4e-09
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-05
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 6e-09
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 9e-09
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 1e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-08
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 4e-08
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 1e-07
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-07
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 5e-07
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 3e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 5e-07
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 9e-07
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 4e-06
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 4e-06
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 6e-06
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 7e-06
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 7e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 1e-05
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-05
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 2e-05
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 3e-05
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 3e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 5e-05
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 2e-04
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 2e-04
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 5e-04
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 6e-04
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 6e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 6e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.002
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.002
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 0.003
d1kyqa1150 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferr 0.003
d1mv8a2202 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pse 0.004
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.004
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Glutathione reductase
species: Escherichia coli [TaxId: 562]
 Score =  142 bits (359), Expect = 2e-40
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 18/221 (8%)

Query: 45  DVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAM 104
           D + IGGG GG  +  +AA  G K   IE    LGGTC+NVGC+P K + H++ +     
Sbjct: 4   DYIAIGGGSGGIASINRAAMYGQKCALIEA-KELGGTCVNVGCVPKKVMWHAAQIREAIH 62

Query: 105 HSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVS 164
                +G   +  + +   ++A +   +  +    E +  KN V  +KG+ +F+      
Sbjct: 63  MYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDA---- 118

Query: 165 VDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGAL-----------ALNEV 213
             T+E     +   +I+IATG    S P    ++   + + G               N  
Sbjct: 119 -KTLEVNGETITADHILIATGG-RPSHPREPANDNINLEAAGVKTNEKGYIVVDKYQNTN 176

Query: 214 PKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMD 254
            + +  +G     +E+  V    G  ++   F       +D
Sbjct: 177 IEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLD 217


>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 124 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 123 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 140 Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 128 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 115 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 128 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 119 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 123 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 126 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 150 Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 100.0
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 100.0
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 100.0
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.98
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.97
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.97
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.97
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.97
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.96
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.96
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.96
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.95
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.95
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.94
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.87
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.85
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.84
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.84
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.84
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.83
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.83
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.82
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.81
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.81
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.81
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.8
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.8
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.79
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.79
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.79
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.79
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.79
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.78
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 99.78
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.77
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.77
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.77
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.76
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 99.76
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.75
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.75
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.73
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.72
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 99.71
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.71
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.71
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.7
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 99.68
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.64
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.63
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.63
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.63
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.62
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.62
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.59
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 99.54
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.54
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.52
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.51
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.51
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.47
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.46
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.42
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.39
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.36
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.35
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.31
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.3
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.28
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.27
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.26
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.25
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.25
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.24
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.24
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.21
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.21
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.18
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.17
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.16
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.16
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.12
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.07
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.07
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.07
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.07
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.06
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.05
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.05
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.03
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.03
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.02
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.0
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.99
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.94
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.93
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.93
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.92
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.92
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.89
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.86
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.84
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.83
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.82
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.82
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.81
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.79
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.76
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.75
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.75
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.73
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.71
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.71
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.71
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.71
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.68
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.66
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.65
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.64
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.64
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.63
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.62
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.57
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.57
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.56
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.52
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.48
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.47
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 98.39
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.36
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.34
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.32
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.29
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.28
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.2
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.16
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.09
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.07
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.07
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.96
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.94
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.92
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.92
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.86
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.84
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.81
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.75
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.7
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.69
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.68
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.61
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.61
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.54
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.53
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.52
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.5
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.48
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.45
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.44
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.37
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.33
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.33
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.33
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.31
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.19
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.11
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.11
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.89
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.83
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.81
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.76
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.57
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.54
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.47
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.46
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.42
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.41
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.34
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.34
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.3
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.23
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.22
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.19
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.17
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.99
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.95
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.94
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.92
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.68
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.61
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.59
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.56
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.51
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 95.5
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.42
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.37
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 95.27
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 95.27
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.26
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.24
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.24
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.17
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.16
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 95.12
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.08
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.07
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.06
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.03
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.9
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.82
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 94.81
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.67
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.6
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 94.48
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.48
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.42
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.42
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.4
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.32
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.03
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.02
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.0
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.94
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.92
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.72
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.67
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.4
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.37
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 93.29
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.08
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.82
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.77
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 92.64
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.52
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 92.5
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.44
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 92.41
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.4
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.38
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.22
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.2
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.97
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.87
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 91.8
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.77
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.77
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.72
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.71
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.7
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.66
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.65
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.61
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 91.61
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.59
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.55
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.47
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.42
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.12
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.03
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 90.94
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.64
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.6
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.36
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.3
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 90.27
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.25
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.25
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.16
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.93
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 89.83
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.71
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.32
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 89.26
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 89.08
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 88.92
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.7
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.64
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.49
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.45
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 88.42
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 88.41
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.35
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 88.31
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 88.28
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.24
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.17
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 88.13
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.11
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.84
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.77
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 87.71
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.68
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.63
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.23
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 87.05
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 86.74
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 86.14
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.05
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 85.89
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.6
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.59
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.55
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 85.28
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 85.04
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 84.84
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.6
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 84.43
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.34
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.01
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 83.79
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 83.6
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 83.53
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.52
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.38
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 83.3
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 82.79
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.65
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.45
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 82.29
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 82.21
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 82.07
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 81.85
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 81.69
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.52
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 81.48
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 81.46
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 81.13
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 81.02
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 80.79
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 80.62
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 80.54
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 80.39
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 80.35
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 80.28
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 80.14
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Dihydrolipoamide dehydrogenase
species: Garden pea (Pisum sativum) [TaxId: 3888]
Probab=100.00  E-value=1.7e-34  Score=259.32  Aligned_cols=219  Identities=89%  Similarity=1.363  Sum_probs=195.1

Q ss_pred             CCCcEEEECCChHHHHHHHHHHHCCCeEEEEecCCCCCceeeccCccCchhhhhhhHHHHHHHhhhhhCCccccccccCh
Q 011787           42 DENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDL  121 (477)
Q Consensus        42 ~~~dvvIIGgG~AGl~aA~~l~~~g~~V~lie~~~~~GG~~~~~~~~p~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~~  121 (477)
                      .+|||+||||||||++||..+++.|.+|+|||+++.+||+|.+.+|+|++.+.............+...++......+.+
T Consensus         2 ~~yDvvVIGgGpaGl~aA~~aa~~G~kV~vie~~~~~GG~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~g~~~~~~~~~~   81 (221)
T d1dxla1           2 DENDVVIIGGGPGGYVAAIKAAQLGFKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGVKVSNVEIDL   81 (221)
T ss_dssp             CCCCEEEECCSHHHHHHHHHHHHHTCCEEEEECSSSSCCSHHHHSHHHHHHHHHHHHHHHHHHHTHHHHTEEESCEEECH
T ss_pred             CcCCEEEECCCHHHHHHHHHHHHCCCcEEEEEecCCCCCeeecchhhhhhhhhHhHHHHHHHhhhhhhcCeecccceecH
Confidence            57999999999999999999999999999999999999999999999999988888887777777777888777777788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhCCeEEEEeEEEEecCCEEEEEecCCceEEEEecEEEEccCCCCCCCCCCccCCceE
Q 011787          122 PAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRI  201 (477)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~~~g~~~~i~~d~lvlAtG~~~~~~~g~~~~~~~~  201 (477)
                      .....+.......+...+...+...+++++.+...+.++..............+.+|++|||||++|             
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~a~~VIiATGs~~-------------  148 (221)
T d1dxla1          82 AAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDTIEGENTVVKGKHIIIATGSDV-------------  148 (221)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTCEEEESCEEEEETTEEEECCSSSCCEEEECSEEEECCCEEE-------------
T ss_pred             HHHHHHHHHHHHHHhhHHHHhhhcCCeEEEEeccccccccccccccccccccccccceEEEeECCCc-------------
Confidence            8888888777777888888888889999999999999888887776666668899999999999753             


Q ss_pred             ecchhhhcccCCCCeeEEEcccHHHHHHHHHHHHcCCcEEEEEeCCCcCCCCCHHHHHHHHHHHHhcCcEEEeCceEEEE
Q 011787          202 VSSTGALALNEVPKKLVVIGAGYIGLEMGSVWARLGSEVTVVEFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGV  281 (477)
Q Consensus       202 ~~~~~~~~~~~~~~~v~IiG~G~~g~e~a~~l~~~g~~Vtli~~~~~~~~~~~~~~~~~~~~~l~~~gv~~~~~~~v~~i  281 (477)
                                                                                                      
T Consensus       149 --------------------------------------------------------------------------------  148 (221)
T d1dxla1         149 --------------------------------------------------------------------------------  148 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             EEcCCeEEEEEeecCCCceEEEEcCEEEEeecCCCCCCCCCccccceeecCCCCeecCCCCCCCCCCeEEecccCCCCCc
Q 011787          282 DLSGDGVKLTLEPAAGGEKTILEADVVLVSAGRTPFTAGLGLDKIGVETDKMGRIPVNERFATNIPGVYAIGDVIPGPML  361 (477)
Q Consensus       282 ~~~~~~~~v~~~~~~~~~~~~i~~D~vi~a~G~~p~~~~l~~~~~gl~~~~~g~i~vd~~l~t~~~~vya~GD~~~~~~~  361 (477)
                                                    .|+.|+++.+.++++|++++++|+|.||+++||++|+|||+|||+++|.+
T Consensus       149 ------------------------------~gr~p~~~~l~l~~~gv~~~~~G~i~vd~~~~T~v~gi~A~GDv~~g~~l  198 (221)
T d1dxla1         149 ------------------------------KGRTPFTSGLNLDKIGVETDKLGRILVNERFSTNVSGVYAIGDVIPGPML  198 (221)
T ss_dssp             ------------------------------CCEEECCTTSCCTTTTCCBCSSSCBCCCTTCBCSSTTEEECSTTSSSCCC
T ss_pred             ------------------------------cCccccCCCCChHhcCceEcCCCcEEeCCCcccCCCCEEEEeccCCCccc
Confidence                                          16678998888899999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHcCCCCCC
Q 011787          362 AHKAEEDGVACVEFLAGKHGHV  383 (477)
Q Consensus       362 ~~~A~~~g~~aa~~i~~~~~~~  383 (477)
                      ++.|..+|+.||++|+++..++
T Consensus       199 ~~~A~~~g~~aa~~i~g~~~~~  220 (221)
T d1dxla1         199 AHKAEEDGVACVEYLAGKVGHV  220 (221)
T ss_dssp             HHHHHHHHHHHHHHHTTSCCCC
T ss_pred             HHHHHHHHHHHHHHHcCCCCCC
Confidence            9999999999999999887543



>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure