Citrus Sinensis ID: 011820

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------

MKSGMAIKLFIFVPLIVLGLGVRCYGEGEMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSFI

cccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccHHHHcccccEEEccccccccccccccccccccccEEEEEccccEEcccHHHHccccccEEEEEccEEcccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHccccccccEEEccccccEEEccccccccccHHHHHHcccccccccccccccccccccccccccccHHHcccccccccccccccHHHHccccccEEEccccccccccHHHHHHHHHHHHcc

ccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHccccccEEEEcccccccccccccccHHHcccccccEEEccccccccccccccccccHHHccccccEEEEccccccccccccHHHccccccEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccHHHccccccEEEEEccccccccccccHHHccccHEEEcccccccccccHHHHcHHHHHHHHHcc

MKSGMAIKLFIFVPLIVLGlgvrcygegemeaapmEKAEQEALYTAIKGFvgnwwngsnlypdpcgwtpiegvscdiydDLWYITALSFgslhdnslgcvtnVEFREQLFELKhlkslsffncftssqqhpttipisgwenlagsleslefrsnpgltgpiptslGHLMKLRSLVLLenglsgelptnlgrlsnlKKLVVsgnwlngripdsfGYLSELLILDLsrnslsgplplslggltsllkfdlsnnqlegkipkeigylknitlldlrnnkfSGELTKSLQEMYSLEemvfsnnpiggdlksLEWKNLQNLVILdlsntglagevPEFMAELKRLRFLglsnnkltgtispklatmpCVSALylngnnlsgelqfSEWFYGKmgrrfgawnnpnlcypsglmstshiplgvkpcqqevtllqphsknllggenlnqNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSFI

MKSGMAIKLFIFVPLIVLGLGVRCYGEGEMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSgelptnlgrlsnLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNkltgtispklaTMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSFI

MKSGMAIKLFIFVPLIVLGLGVRCYGEGEMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDlsrnslsgplplslggltsllKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWvlllqllmmvlllSFI

*****AIKLFIFVPLIVLGLGVRCYGEGEM*********QEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSF*

******IKLFIFVPLIVLGLGVRCYGE***************************WNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSFI

*KSGMAIKLFIFVPLIVLGLGVRCYGEGEMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSYSVNGFWWVLLLQLLMMVLLLSFI

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi

iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHi

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo

SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi

SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		477	2.2.26 [Sep-21-2011]
Q5PP26		424	Piriformospora indica-ins	no	no	0.811	0.912	0.613	1e-131
Q9SSD1		496	Protein TOO MANY MOUTHS O	no	no	0.748	0.719	0.372	2e-51
C0LGQ5		1249	LRR receptor-like serine/	no	no	0.433	0.165	0.409	6e-35
Q9LVP0		1102	Probable leucine-rich rep	no	no	0.666	0.288	0.318	1e-31
Q8VZG8		1045	Probable LRR receptor-lik	no	no	0.607	0.277	0.343	2e-31
Q9FIZ3		1252	LRR receptor-like serine/	no	no	0.341	0.130	0.382	7e-31
Q9C9H7		847	Receptor-like protein 12	no	no	0.507	0.285	0.378	7e-31
Q9LHP4		1141	Receptor-like protein kin	no	no	0.549	0.229	0.360	2e-30
C0LGP4		1010	Probable LRR receptor-lik	no	no	0.448	0.211	0.382	6e-30
C0LGV1		1135	LRR receptor-like serine/	no	no	0.501	0.210	0.347	1e-29

>sp\|Q5PP26\|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1	Back alignment and function desciption

 Score =  470 bits (1209), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 244/398 (61%), Positives = 300/398 (75%), Gaps = 11/398 (2%)

Query: 29  EMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALS 88
           + E APM+K E+EALY+AI+GFVG+ WNGS LYPDPCGWTPI+GVSCDIY+DLWY+T LS
Sbjct: 30  DSEEAPMDKREREALYSAIQGFVGDSWNGSALYPDPCGWTPIQGVSCDIYNDLWYVTDLS 89

Query: 89  FGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISG-WENLAGSLE 147
            G +++NSL C ++++ R +LFELKHL+SLSFFNCF S    P  I     W N A +LE
Sbjct: 90  LGLIYENSLPCSSSLQIRPELFELKHLRSLSFFNCFIS----PMVIAKEELWTNFASNLE 145

Query: 148 SLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNG 207
           SLEFRSNPGL G +P ++G+L KL+SLV+LENG SGELP ++  L  LK+LV +GN   G
Sbjct: 146 SLEFRSNPGLIGELPETIGNLTKLKSLVVLENGFSGELPASICNLKRLKRLVFAGNSFAG 205

Query: 208 RIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNI 267
            IP+ F  L ELLILDLSRNS SG LP S G L SLLK DLSNN LEG +P+E+G+LKN+
Sbjct: 206 MIPNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNL 265

Query: 268 TLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIG-GDLKSLEWKNLQNLVILDLSNTGL 326
           TLLDLRNN+FSG L+K+++ + SL E+V SNNP+G  D+    W  + NLV+LDLS  GL
Sbjct: 266 TLLDLRNNRFSGGLSKNIENIQSLTELVLSNNPMGEEDMVGTNWGKMSNLVVLDLSKMGL 325

Query: 327 AGEVPEFMAELKRLRFLGLSNNKLTGTI-SPKLATMPCVSALYLNGNNLSGELQFSEWFY 385
            GE+P  +  LKRLRFLGL+NN LTG + S KL  +PC+ ALY+NGNNL+GEL+FS  FY
Sbjct: 326 RGEIPTSLTNLKRLRFLGLNNNNLTGFVPSKKLEALPCLGALYINGNNLTGELRFSTKFY 385

Query: 386 GKMGRRFGAWNNPNLCYP-SGLMSTSHI---PLGVKPC 419
            KMGRRF A  NPNLC P   +MS SH    PLGVKPC
Sbjct: 386 EKMGRRFKASKNPNLCQPLEMVMSESHKHLSPLGVKPC 423

Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9SSD1\|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1	Back alignment and function description

>sp\|C0LGQ5\|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1	Back alignment and function description

>sp\|Q8VZG8\|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3	Back alignment and function description

>sp\|Q9FIZ3\|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2	Back alignment and function description

>sp\|Q9C9H7\|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2	Back alignment and function description

>sp\|Q9LHP4\|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1	Back alignment and function description

>sp\|C0LGP4\|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1	Back alignment and function description

>sp\|C0LGV1\|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		477
255566807		443	serine-threonine protein kinase, plant-t	0.928	1.0	0.688	1e-180
147815740		584	hypothetical protein VITISV_038921 [Viti	0.962	0.785	0.699	1e-178
359473008		446	PREDICTED: piriformospora indica-insensi	0.928	0.993	0.712	1e-177
224101663		406	predicted protein [Populus trichocarpa]	0.849	0.997	0.719	1e-170
356576273		443	PREDICTED: piriformospora indica-insensi	0.928	1.0	0.661	1e-163
297737882		477	unnamed protein product [Vitis vinifera]	0.846	0.846	0.689	1e-161
356535577		443	PREDICTED: piriformospora indica-insensi	0.928	1.0	0.645	1e-159
356496010		432	PREDICTED: piriformospora indica-insensi	0.895	0.988	0.640	1e-157
356499743		433	PREDICTED: piriformospora indica-insensi	0.893	0.983	0.647	1e-156
357443135		499	Piriformospora indica-insensitive protei	0.903	0.863	0.613	1e-145

>gi\|255566807\|ref\|XP_002524387.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi\|223536348\|gb\|EEF37998.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/443 (68%), Positives = 366/443 (82%)

Query: 35  MEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHD 94
           ME  E+ ALY+AI+GFVGNWWNGS+LYPDPCGWTPI+GVSCDI+D LWY+T LS G +HD
Sbjct: 1   MEDGERAALYSAIQGFVGNWWNGSDLYPDPCGWTPIQGVSCDIFDGLWYVTDLSIGPIHD 60

Query: 95  NSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSN 154
           NS  C  N EFR  LF+L H+KSLSFFNCF S  +HP TIP   WE LA +LE LEFRSN
Sbjct: 61  NSFDCSLNAEFRPHLFQLTHIKSLSFFNCFLSPFKHPITIPTKNWEKLAANLEKLEFRSN 120

Query: 155 PGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGRIPDSFG 214
           PGL G +PT+ G L+KL+SLVLLENGL+GELP+N G L+NLK+LV++GNW +GRIPDSFG
Sbjct: 121 PGLIGRVPTTFGGLIKLQSLVLLENGLTGELPSNFGALANLKRLVLAGNWFSGRIPDSFG 180

Query: 215 YLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRN 274
            LS+LLILDLSRN LSGPLP + GG++SLLK D SNNQLEG +P EIGYLKN+TLLDLRN
Sbjct: 181 RLSQLLILDLSRNLLSGPLPSTFGGMSSLLKLDCSNNQLEGNLPVEIGYLKNLTLLDLRN 240

Query: 275 NKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFM 334
           NKFSG LTKSLQEM+SLEEM  SNNPI GDL ++EW+ LQNLVILDLSN  LAGE+P  +
Sbjct: 241 NKFSGGLTKSLQEMFSLEEMALSNNPIHGDLHAIEWQKLQNLVILDLSNMALAGEIPISI 300

Query: 335 AELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGA 394
            +LK+LRFLGLSNN LTG IS KLAT+PCVSALYLNGNNL+G LQFSE FY  +G RFGA
Sbjct: 301 TKLKKLRFLGLSNNNLTGNISAKLATLPCVSALYLNGNNLTGALQFSEEFYKNLGSRFGA 360

Query: 395 WNNPNLCYPSGLMSTSHIPLGVKPCQQEVTLLQPHSKNLLGGENLNQNAHFMASLGFSSY 454
           WNNPNLC+P  L+STSH+P GVKPCQQ+VTLL+  S + L  +  +Q++HF+ SLGFSSY
Sbjct: 361 WNNPNLCFPVWLISTSHVPYGVKPCQQQVTLLESISDSKLSNDKSDQSSHFVVSLGFSSY 420

Query: 455 SVNGFWWVLLLQLLMMVLLLSFI 477
            ++GF W+ ++++ M++LL S +
Sbjct: 421 GIDGFLWIFIVEIFMVLLLNSLL 443

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147815740\|emb\|CAN74874.1\| hypothetical protein VITISV_038921 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359473008\|ref\|XP_002278514.2\| PREDICTED: piriformospora indica-insensitive protein 2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224101663\|ref\|XP_002312373.1\| predicted protein [Populus trichocarpa] gi\|222852193\|gb\|EEE89740.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356576273\|ref\|XP_003556257.1\| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|297737882\|emb\|CBI27083.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356535577\|ref\|XP_003536321.1\| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356496010\|ref\|XP_003516863.1\| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356499743\|ref\|XP_003518696.1\| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max]	Back alignment and taxonomy information

>gi\|357443135\|ref\|XP_003591845.1\| Piriformospora indica-insensitive protein [Medicago truncatula] gi\|355480893\|gb\|AES62096.1\| Piriformospora indica-insensitive protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		477
TAIR\|locus:2012433		432	AT1G68780 [Arabidopsis thalian	0.821	0.907	0.568	3.2e-120
TAIR\|locus:2102330		475	AT3G25670 [Arabidopsis thalian	0.867	0.871	0.547	5.2e-120
TAIR\|locus:2031880		424	AT1G13230 [Arabidopsis thalian	0.846	0.952	0.558	9.8e-119
TAIR\|locus:2016319		496	TMM "TOO MANY MOUTHS" [Arabido	0.748	0.719	0.350	1.4e-46
TAIR\|locus:2052367		462	RLP29 "receptor like protein 2	0.836	0.863	0.329	1.3e-45
TAIR\|locus:2139880		450	RIC7 "ROP-interactive CRIB mot	0.800	0.848	0.315	5.6e-45
TAIR\|locus:2138268		1045	AT4G08850 [Arabidopsis thalian	0.607	0.277	0.309	3.5e-30
TAIR\|locus:2120362		1249	GSO1 "GASSHO1" [Arabidopsis th	0.465	0.177	0.369	4.8e-30
TAIR\|locus:2085949		1141	AT3G24240 [Arabidopsis thalian	0.549	0.229	0.334	5.3e-30
TAIR\|locus:2079157		1011	AT3G47580 [Arabidopsis thalian	0.490	0.231	0.337	8.9e-30

TAIR\|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1183 (421.5 bits), Expect = 3.2e-120, P = 3.2e-120
 Identities = 225/396 (56%), Positives = 287/396 (72%)

Query:    29 EMEAAPMEKAEQEALYTAIKGFVGNWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALS 88
             E + +PMEK EQ ALY+ I+GFVG  WNGS LYPDPCGWTPI+GV+CDIYD+LWY+TALS
Sbjct:    32 ESDGSPMEKTEQAALYSTIQGFVGESWNGSYLYPDPCGWTPIQGVTCDIYDELWYVTALS 91

Query:    89 FGSLHDNSLGCVTNVEFREQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLES 148
             FG++ DNSL C  +   R QLFELKHLKSLS FNCFT+  ++  +I    W +L+ SLE 
Sbjct:    92 FGTMKDNSLACSESPVIRPQLFELKHLKSLSLFNCFTTPNRYLASISDEKWLDLSKSLER 151

Query:   149 LEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNWLNGR 208
             LE RSNPGL G +P+ + +L  L+SLV+LEN L+G LP NL +L+ L++LV+SGN   GR
Sbjct:   152 LEIRSNPGLIGELPSVITNLTNLQSLVVLENKLTGPLPVNLAKLTRLRRLVLSGNRFTGR 211

Query:   209 IPDSFGYLSELLILDXXXXXXXXXXXXXXXXXXXXXKFDLSNNQLEGKIPKEIGYLKNIT 268
             IP+ +G L+ LLILD                     K DLSNN LEGK+P+E+  LKN+T
Sbjct:   212 IPEVYG-LTGLLILDVSRNFLSGALPLSVGGLYSLLKLDLSNNYLEGKLPRELESLKNLT 270

Query:   269 LLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAG 328
             LLDLRNN+ SG L+K +QEM SL E+V SNN + GDL  ++W+NL+NLV+LDLSNTGL G
Sbjct:   271 LLDLRNNRLSGGLSKEIQEMTSLVELVLSNNRLAGDLTGIKWRNLKNLVVLDLSNTGLKG 330

Query:   329 EVPEFMAELKRLRFLGLSNNKLTGTISPKLAT-MPCVSALYLNGNNLSGELQFSEWFYGK 387
             E+P  + ELK+LRFLGLSNN L G + P++ T MP +SALY+NGNN+SGEL+FS +FY +
Sbjct:   331 EIPGSILELKKLRFLGLSNNNLGGKLIPQMETEMPSLSALYVNGNNISGELEFSRYFYER 390

Query:   388 MGRRFGAWNNPNLCYPSGLMS--TSHIPLGVKPCQQ 421
             MGRR G W NPNLCY        + H+P GV  C++
Sbjct:   391 MGRRLGVWGNPNLCYNGDETKNLSDHVPFGVNQCKR 426

GO:0005886 "plasma membrane" evidence=ISM

GO:0007165 "signal transduction" evidence=IC;RCA

GO:0002237 "response to molecule of bacterial origin" evidence=RCA

GO:0010103 "stomatal complex morphogenesis" evidence=RCA

GO:0048443 "stamen development" evidence=RCA

TAIR\|locus:2102330 AT3G25670 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031880 AT1G13230 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2016319 TMM "TOO MANY MOUTHS" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139880 RIC7 "ROP-interactive CRIB motif-containing protein 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		477
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-35
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-34
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-34
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-25
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	3e-16
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-15
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-12
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	7e-12
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	8e-11
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	4e-09
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	8e-08
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-07
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	1e-07
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	5e-07
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	2e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	6e-04

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

 Score =  138 bits (349), Expect = 7e-35
 Identities = 103/317 (32%), Positives = 148/317 (46%), Gaps = 42/317 (13%)

Query: 96  SLGCVTNVEFR------------EQLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLA 143
           SLG + N+++               +F L+ L SL   +   S +     I +       
Sbjct: 255 SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ------ 308

Query: 144 GSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGN 203
            +LE L   SN   TG IP +L  L +L+ L L  N  SGE+P NLG+ +NL  L +S N
Sbjct: 309 -NLEILHLFSN-NFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN 366

Query: 204 WLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGY 263
            L G IP+       L  L L  NSL G +P SLG   SL +  L +N   G++P E   
Sbjct: 367 NLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK 426

Query: 264 LKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDL-KSLEWKNLQNLVI---- 318
           L  +  LD+ NN   G +     +M SL+ +  + N   G L  S   K L+NL +    
Sbjct: 427 LPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQ 486

Query: 319 -----------------LDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATM 361
                            L LS   L+GE+P+ ++  K+L  L LS+N+L+G I    + M
Sbjct: 487 FSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM 546

Query: 362 PCVSALYLNGNNLSGEL 378
           P +S L L+ N LSGE+
Sbjct: 547 PVLSQLDLSQNQLSGEI 563

Length = 968

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		477
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.94
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.93
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.92
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.92
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.87
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.86
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.84
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.82
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.81
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.81
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.81
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.8
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.8
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.79
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.79
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.78
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.77
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.73
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.69
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.68
PLN03150		623	hypothetical protein; Provisional	99.55
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.4
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.36
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.34
PLN03150		623	hypothetical protein; Provisional	99.33
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.32
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.25
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.17
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	99.16
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.15
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.1
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.0
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.0
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.98
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.89
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.86
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.77
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.74
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.71
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.64
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.63
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.62
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.62
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.49
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.4
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.35
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.29
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.24
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.22
PF08263		43	LRRNT_2: Leucine rich repeat N-terminal domain; In	98.07
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.02
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.89
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.89
PRK15386		426	type III secretion protein GogB; Provisional	97.88
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.88
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.79
PRK15386		426	type III secretion protein GogB; Provisional	97.57
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.41
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.39
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.99
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.86
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.82
KOG4341		483	consensus F-box protein containing LRR [General fu	96.77
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.74
KOG4341		483	consensus F-box protein containing LRR [General fu	96.52
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.39
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.17
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.03
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.92
KOG4308		478	consensus LRR-containing protein [Function unknown	95.53
KOG4308		478	consensus LRR-containing protein [Function unknown	95.48
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.44
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.04
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.87
KOG0473		326	consensus Leucine-rich repeat protein [Function un	88.01
KOG0473		326	consensus Leucine-rich repeat protein [Function un	87.24
KOG3864		221	consensus Uncharacterized conserved protein [Funct	87.06
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	86.55
smart00370		26	LRR Leucine-rich repeats, outliers.	86.55
KOG3864		221	consensus Uncharacterized conserved protein [Funct	85.7
smart00370		26	LRR Leucine-rich repeats, outliers.	84.6
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	84.6
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	84.35

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=6.2e-42  Score=387.85  Aligned_cols=317  Identities=34%  Similarity=0.570  Sum_probs=186.6

Q ss_pred             HHHHHHHHHHHhcCCC-----CCCCCCCCCCCCCCCCCCCCcEeCCCCCceEEEEEecCCCCCCCCccccccccchhccC
Q 011820           37 KAEQEALYTAIKGFVG-----NWWNGSNLYPDPCGWTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFREQLFE  111 (477)
Q Consensus        37 ~~~~~aL~~~~~~~~~-----~~W~~~~~~~d~C~w~~~~Gv~C~~~~~~~~v~~L~l~~~~~~~l~~~~~g~i~~~l~~  111 (477)
                      ++|++||++||+++.+     .+|+..   .|||.|.   ||+|+.. +  +|+.|++..   +.+    .|.+++.+..
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~---~~~c~w~---gv~c~~~-~--~v~~L~L~~---~~i----~~~~~~~~~~   91 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSS---ADVCLWQ---GITCNNS-S--RVVSIDLSG---KNI----SGKISSAIFR   91 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCC---CCCCcCc---ceecCCC-C--cEEEEEecC---CCc----cccCChHHhC
Confidence            4799999999998753     358643   5899995   9999853 2  799999863   222    3556677777


Q ss_pred             CCCCCEEEcccCCCCCCCCCCccChhhhhhcCCCccEEEccCCCCCCCCchhhhcCCCCCcEEEcccCCCCCccchhcCC
Q 011820          112 LKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGR  191 (477)
Q Consensus       112 l~~L~~L~Ls~n~~~~~~~~~~ip~~~~~~~~~~L~~L~Ls~n~~l~g~ip~~l~~l~~L~~L~Ls~n~l~~~ip~~l~~  191 (477)
                      +++|++|++++|.+.+     .+|...+.. +++|++|+|++| .+++.+|.  +.+++|++|+|++|.+++.+|..+++
T Consensus        92 l~~L~~L~Ls~n~~~~-----~ip~~~~~~-l~~L~~L~Ls~n-~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~  162 (968)
T PLN00113         92 LPYIQTINLSNNQLSG-----PIPDDIFTT-SSSLRYLNLSNN-NFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGS  162 (968)
T ss_pred             CCCCCEEECCCCccCC-----cCChHHhcc-CCCCCEEECcCC-ccccccCc--cccCCCCEEECcCCcccccCChHHhc
Confidence            7777777777776654     566554322 356666666665 45555543  33555555555555555555555555


Q ss_pred             CCCCcEEEeecccCCCCCcccccCCccccEeeeecccCCCCccccccCCcCCcEEecccCcCCCCCchhhcCCCCCCEee
Q 011820          192 LSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLD  271 (477)
Q Consensus       192 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~  271 (477)
                      +++|++|++++|.+.+.+|..+.++++|++|++++|.+++.+|..+.++++|++|++++|.+++.+|..++++++|++|+
T Consensus       163 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  242 (968)
T PLN00113        163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLD  242 (968)
T ss_pred             CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEE
Confidence            55555555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             ccCCcCCccchHHhhcCCCCCEEEcccCCCCCcCChhhhcCCCCccEEEccCCCCCCCchhhhcCCCCCCEEecccccCC
Q 011820          272 LRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGLSNNKLT  351 (477)
Q Consensus       272 Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i~~~~~~~l~~L~~L~Ls~n~l~~~ip~~l~~l~~L~~L~Ls~N~l~  351 (477)
                      +++|.+++.+|..+.++++|++|++++|.+.+.+|. .+..+++|++|++++|.+++.+|..+..+++|+.|++++|.++
T Consensus       243 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        243 LVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP-SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             CcCceeccccChhHhCCCCCCEEECcCCeeeccCch-hHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            555555555555555555555555555555544443 3444555555555555555555555555555555555555555


Q ss_pred             CCChhhcCCCCCCCEEEeeCCcCeeecC
Q 011820          352 GTISPKLATMPCVSALYLNGNNLSGELQ  379 (477)
Q Consensus       352 g~ip~~l~~l~~L~~L~Ls~N~l~g~ip  379 (477)
                      +.+|..+..+++|+.|++++|+++|.+|
T Consensus       322 ~~~~~~~~~l~~L~~L~L~~n~l~~~~p  349 (968)
T PLN00113        322 GKIPVALTSLPRLQVLQLWSNKFSGEIP  349 (968)
T ss_pred             CcCChhHhcCCCCCEEECcCCCCcCcCC
Confidence            5555555555555555555555555544

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		477
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		5e-15
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		5e-15
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		2e-13
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		3e-06

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 82/284 (28%), Positives = 123/284 (43%), Gaps = 46/284 (16%) Query: 140 ENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLV 199 +N +L+ L ++N G TG IP +L + +L SL L N LSG +P++LG LS L+ L Sbjct: 387 QNPKNTLQELYLQNN-GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLK 445 Query: 200 VSGNWLNGRIPDSFGYLSELLILDXXXXXXXXXXXXXXXXXXXXXKFDLSNNQLEGKIPK 259 + N L G IP Y+ L L LSNN+L G+IPK Sbjct: 446 LWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK 505 Query: 260 EIGYLKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVI- 318 IG L+N+ +L L NN FSG + L + SL + + N G + + +K + Sbjct: 506 WIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN 565 Query: 319 -------LDLSNTGL------AGEVPEFMA----ELKRLR-------------------- 341 + + N G+ AG + EF +L RL Sbjct: 566 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF 625 Query: 342 -------FLGLSNNKLTGTISPKLATMPCVSALYLNGNNLSGEL 378 FL +S N L+G I ++ +MP + L L N++SG + Sbjct: 626 DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI 669

PyMOL of 3riz

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		477
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	7e-63
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-51
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-45
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-52
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-51
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-51
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-42
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-32
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-37
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-36
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-35
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-35
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-32
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-35
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-35
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-23
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-16
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-34
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-29
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-27
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-19
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-33
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-33
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-29
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-28
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-28
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-22
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-32
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-30
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-30
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-26
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-25
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-24
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-22
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-31
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-24
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-23
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-29
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-27
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-24
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-20
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-20
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-29
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-25
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-17
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-27
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-26
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-24
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-22
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-21
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-19
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-26
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-24
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-17
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-24
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-20
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-17
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-17
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-13
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-24
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-23
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-24
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-21
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-17
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-17
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-24
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-20
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-20
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-15
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-23
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-18
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-16
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-23
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-23
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-22
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-22
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-20
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-18
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-21
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-20
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-20
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-18
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-14
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-20
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-18
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-17
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-17
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-20
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-19
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-19
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-19
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-13
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-19
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-19
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-14
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-17
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-17
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-19
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-16
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-10
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-19
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-16
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-19
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-19
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-18
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-15
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-18
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-17
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-16
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-16
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-16
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-15
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-14
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-15
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-13
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-14
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-14
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-14
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-14
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-13
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-14
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-14
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-13
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-12
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-14
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-10
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-13
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	7e-13
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-08
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-11
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-07
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-10
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	4e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	9e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	7e-10
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	9e-10
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	9e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-09
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-08
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-07
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	8e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-09
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	3e-09
3m19_A		251	Variable lymphocyte receptor A diversity region; a	3e-08
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-09
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	5e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	5e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	6e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	6e-09
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-08
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	3e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-08
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-06
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-07
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-07
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	3e-06
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	1e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	9e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	2e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	2e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	1e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	7e-04
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	8e-04

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

 Score =  205 bits (525), Expect = 7e-63
 Identities = 66/230 (28%), Positives = 103/230 (44%), Gaps = 5/230 (2%)

Query: 145 SLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELPTNLGRLSNLKKLVVSGNW 204
            L  L       L GPIP ++  L +L  L +    +SG +P  L ++  L  L  S N 
Sbjct: 77  YLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNA 136

Query: 205 LNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKF-DLSNNQLEGKIPKEIGY 263
           L+G +P S   L  L+ +    N +SG +P S G  + L     +S N+L GKIP     
Sbjct: 137 LSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN 196

Query: 264 LKNITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSN 323
           L N+  +DL  N   G+ +       + +++  + N +  DL  +     +NL  LDL N
Sbjct: 197 L-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVG--LSKNLNGLDLRN 253

Query: 324 TGLAGEVPEFMAELKRLRFLGLSNNKLTGTISPKLATMPCVSALYLNGNN 373
             + G +P+ + +LK L  L +S N L G I P+   +          N 
Sbjct: 254 NRIYGTLPQGLTQLKFLHSLNVSFNNLCGEI-PQGGNLQRFDVSAYANNK 302

PyMOL of 1ogq

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		477
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	100.0
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.98
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.98
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.98
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.97
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.97
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.97
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.97
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.97
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.96
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.96
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.96
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.96
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.96
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.96
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.96
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.95
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.94
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.94
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.94
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.94
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.94
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.93
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.93
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.93
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.92
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.92
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.92
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.92
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.92
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.92
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.91
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.91
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.91
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.91
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.91
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.9
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.9
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.9
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.89
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.89
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.89
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.89
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.89
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.89
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.87
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.86
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.86
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.86
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.86
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.83
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.83
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.82
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.81
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.81
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.81
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.81
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.81
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.8
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.8
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.8
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.79
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.79
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.78
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.78
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.77
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.77
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.77
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.75
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.74
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.74
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.74
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.73
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.73
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.7
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.69
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.68
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.68
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.67
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.66
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.66
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.64
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.64
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.62
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.61
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.58
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.57
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.56
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.54
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.54
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.52
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.44
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.44
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.41
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.4
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.39
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.35
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.34
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.29
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.21
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.03
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.93
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.87
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.83
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.69
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.62
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.57
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.43
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.42
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.41
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.17
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.84
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.79
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.46
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.3
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.04
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.8

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

Probab=100.00  E-value=4.9e-43  Score=345.74  Aligned_cols=296  Identities=27%  Similarity=0.441  Sum_probs=214.5

Q ss_pred             CCCHHHHHHHHHHHhcCCC----CCCCCCCCCCCCCC--CCCCCCcEeCCCCCceEEEEEecCCCCCCCCccccccccch
Q 011820           34 PMEKAEQEALYTAIKGFVG----NWWNGSNLYPDPCG--WTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFRE  107 (477)
Q Consensus        34 ~~~~~~~~aL~~~~~~~~~----~~W~~~~~~~d~C~--w~~~~Gv~C~~~~~~~~v~~L~l~~~~~~~l~~~~~g~i~~  107 (477)
                      .|.++|++||++||+++.+    ++|..+   .|||.  |.   ||+|+..+..                          
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~~---~~~C~~~w~---gv~C~~~~~~--------------------------   49 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWL---GVLCDTDTQT--------------------------   49 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT---SCTTTTCST---TEEECCSSSC--------------------------
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCCC---CCCCcCCCc---ceEeCCCCCC--------------------------
Confidence            4788999999999999864    468654   58998  95   9999853211                          


Q ss_pred             hccCCCCCCEEEcccCCCCCCCCCCccChhhhhhcCCCccEEEccCCCCCCC--CchhhhcCCCCCcEEEccc-CCCCCc
Q 011820          108 QLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTG--PIPTSLGHLMKLRSLVLLE-NGLSGE  184 (477)
Q Consensus       108 ~l~~l~~L~~L~Ls~n~~~~~~~~~~ip~~~~~~~~~~L~~L~Ls~n~~l~g--~ip~~l~~l~~L~~L~Ls~-n~l~~~  184 (477)
                                                          .++++|++++| .+++  .+|..+.++++|++|++++ |.+++.
T Consensus        50 ------------------------------------~~l~~L~L~~~-~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~   92 (313)
T 1ogq_A           50 ------------------------------------YRVNNLDLSGL-NLPKPYPIPSSLANLPYLNFLYIGGINNLVGP   92 (313)
T ss_dssp             ------------------------------------CCEEEEEEECC-CCSSCEECCGGGGGCTTCSEEEEEEETTEESC
T ss_pred             ------------------------------------ceEEEEECCCC-CccCCcccChhHhCCCCCCeeeCCCCCccccc
Confidence                                                12333334444 3444  4555666666666666663 666666


Q ss_pred             cchhcCCCCCCcEEEeecccCCCCCcccccCCccccEeeeecccCCCCccccccCCcCCcEEecccCcCCCCCchhhcCC
Q 011820          185 LPTNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYL  264 (477)
Q Consensus       185 ip~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l  264 (477)
                      +|..++++++|++|++++|.+++.+|..+.++++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..+..+
T Consensus        93 ~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l  172 (313)
T 1ogq_A           93 IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSF  172 (313)
T ss_dssp             CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCC
T ss_pred             CChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhh
Confidence            66666666666666666666666666666666666666666666666666666667777777777777766677777777


Q ss_pred             C-CCCEeeccCCcCCccchHHhhcCCCCCEEEcccCCCCCcCChhhhcCCCCccEEEccCCCCCCCchhhhcCCCCCCEE
Q 011820          265 K-NITLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFL  343 (477)
Q Consensus       265 ~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i~~~~~~~l~~L~~L~Ls~n~l~~~ip~~l~~l~~L~~L  343 (477)
                      + +|++|++++|++++.+|..+..++ |++|++++|.+++..+. .+..+++|++|++++|++++.+|. +..+++|++|
T Consensus       173 ~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~-~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L  249 (313)
T 1ogq_A          173 SKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASV-LFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGL  249 (313)
T ss_dssp             CTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGG-GCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEE
T ss_pred             hhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCH-HHhcCCCCCEEECCCCceeeecCc-ccccCCCCEE
Confidence            6 777777777777777777777776 77788877777755553 677788888888888888866665 7788999999


Q ss_pred             ecccccCCCCChhhcCCCCCCCEEEeeCCcCeeecCCChhhhccccCcccccCCCCCCCC
Q 011820          344 GLSNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYP  403 (477)
Q Consensus       344 ~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~N~~lc~~  403 (477)
                      +|++|++++.+|..+..+++|++|+|++|+++|.+|... ....+ +.+++.+||.+||.
T Consensus       250 ~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~-~l~~L-~~l~l~~N~~lc~~  307 (313)
T 1ogq_A          250 DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG-NLQRF-DVSAYANNKCLCGS  307 (313)
T ss_dssp             ECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCST-TGGGS-CGGGTCSSSEEEST
T ss_pred             ECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCCc-ccccc-ChHHhcCCCCccCC
Confidence            999999999999999999999999999999999999763 22233 56778899999986

PyMOL of 1ogq

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		477
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-15
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	7e-12
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-14
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-13
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-04
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	7e-13
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	4e-07
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	5e-07
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-10
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	6e-10
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	2e-07
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	9e-07
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	7e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	7e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	7e-06
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	0.004
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	9e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.003
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.002
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.004
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	4e-05
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.001
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.002
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	1e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	5e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.004
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	2e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	4e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	3e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.001
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.004
d2ifga3		156	c.10.2.7 (A:36-191) High affinity nerve growth fac	7e-04
d1w8aa_		192	c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga	0.002
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.002
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.004

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 73.5 bits (179), Expect = 4e-15
 Identities = 54/278 (19%), Positives = 105/278 (37%), Gaps = 39/278 (14%)

Query: 127 SQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLENGLSGELP 186
           S      +P    ++L      L+ ++N  +T        +L  L +L+L+ N +S   P
Sbjct: 18  SDLGLEKVP----KDLPPDTALLDLQNNK-ITEIKDGDFKNLKNLHTLILINNKISKISP 72

Query: 187 TNLGRLSNLKKLVVSGN---------------------WLNGRIPDSFGYLSELLILDL- 224
                L  L++L +S N                      +       F  L+++++++L 
Sbjct: 73  GAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELG 132

Query: 225 -SRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKNITLLDLRNNKFSGELTK 283
            +    SG    +  G+  L    +++  +   IP+  G   ++T L L  NK +     
Sbjct: 133 TNPLKSSGIENGAFQGMKKLSYIRIADTNIT-TIPQ--GLPPSLTELHLDGNKITKVDAA 189

Query: 284 SLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFL 343
           SL+ + +L ++  S N I             +L  L L+N  L  +VP  +A+ K ++ +
Sbjct: 190 SLKGLNNLAKLGLSFNSISAVDNGSLANT-PHLRELHLNNNKL-VKVPGGLADHKYIQVV 247

Query: 344 GLSNNKLTG------TISPKLATMPCVSALYLNGNNLS 375
            L NN ++                   S + L  N + 
Sbjct: 248 YLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQ 285

PyMOL of d1xkua_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		477
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	100.0
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.96
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.94
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.93
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.92
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.92
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.91
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.9
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.88
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.88
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.79
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.77
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.76
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.76
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.74
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.74
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.74
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.73
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.72
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.71
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.64
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.6
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.6
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.59
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.59
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.58
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.56
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.5
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.5
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.48
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.47
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.36
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.29
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.29
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.19
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.45
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.38
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.87
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.83
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.28
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.28

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=5.3e-42  Score=335.73  Aligned_cols=298  Identities=27%  Similarity=0.427  Sum_probs=194.2

Q ss_pred             CCCHHHHHHHHHHHhcCCC----CCCCCCCCCCCCCC--CCCCCCcEeCCCCCceEEEEEecCCCCCCCCccccccccch
Q 011820           34 PMEKAEQEALYTAIKGFVG----NWWNGSNLYPDPCG--WTPIEGVSCDIYDDLWYITALSFGSLHDNSLGCVTNVEFRE  107 (477)
Q Consensus        34 ~~~~~~~~aL~~~~~~~~~----~~W~~~~~~~d~C~--w~~~~Gv~C~~~~~~~~v~~L~l~~~~~~~l~~~~~g~i~~  107 (477)
                      -|.++|++||++||+++.+    ++|..+   +|||.  |.   ||+|+..++..||++|++.+                
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~---~d~C~~~w~---gv~C~~~~~~~~v~~L~L~~----------------   59 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWL---GVLCDTDTQTYRVNNLDLSG----------------   59 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT---SCTTTTCST---TEEECCSSSCCCEEEEEEEC----------------
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCC---CCCCCCcCC---CeEEeCCCCcEEEEEEECCC----------------
Confidence            3788999999999998864    468654   59994  95   99999765555677766642                


Q ss_pred             hccCCCCCCEEEcccCCCCCCCCCCccChhhhhhcCCCccEEEccCCCCCCCCchhhhcCCCCCcEEEccc-CCCCCccc
Q 011820          108 QLFELKHLKSLSFFNCFTSSQQHPTTIPISGWENLAGSLESLEFRSNPGLTGPIPTSLGHLMKLRSLVLLE-NGLSGELP  186 (477)
Q Consensus       108 ~l~~l~~L~~L~Ls~n~~~~~~~~~~ip~~~~~~~~~~L~~L~Ls~n~~l~g~ip~~l~~l~~L~~L~Ls~-n~l~~~ip  186 (477)
                                     +.+.+     .                         +.+|+.++++++|++|+|++ |+++|.+|
T Consensus        60 ---------------~~l~g-----~-------------------------~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP   94 (313)
T d1ogqa_          60 ---------------LNLPK-----P-------------------------YPIPSSLANLPYLNFLYIGGINNLVGPIP   94 (313)
T ss_dssp             ---------------CCCSS-----C-------------------------EECCGGGGGCTTCSEEEEEEETTEESCCC
T ss_pred             ---------------CCCCC-----C-------------------------CCCChHHhcCccccccccccccccccccc
Confidence                           11111     0                         02344444444444444443 44444455


Q ss_pred             hhcCCCCCCcEEEeecccCCCCCcccccCCccccEeeeecccCCCCccccccCCcCCcEEecccCcCCCCCchhhcCCCC
Q 011820          187 TNLGRLSNLKKLVVSGNWLNGRIPDSFGYLSELLILDLSRNSLSGPLPLSLGGLTSLLKFDLSNNQLEGKIPKEIGYLKN  266 (477)
Q Consensus       187 ~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~  266 (477)
                      ..++++++|++|+|++|++.+..+..+..+.+|+.+++++|.+.+.+|..+.+++.|+++++++|.+++.+|..+..+..
T Consensus        95 ~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~  174 (313)
T d1ogqa_          95 PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK  174 (313)
T ss_dssp             GGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCT
T ss_pred             cccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccc
Confidence            55555555555555555555444444555555555555555555555555555555666666666665566665555555


Q ss_pred             C-CEeeccCCcCCccchHHhhcCCCCCEEEcccCCCCCcCChhhhcCCCCccEEEccCCCCCCCchhhhcCCCCCCEEec
Q 011820          267 I-TLLDLRNNKFSGELTKSLQEMYSLEEMVFSNNPIGGDLKSLEWKNLQNLVILDLSNTGLAGEVPEFMAELKRLRFLGL  345 (477)
Q Consensus       267 L-~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i~~~~~~~l~~L~~L~Ls~n~l~~~ip~~l~~l~~L~~L~L  345 (477)
                      + +.+++++|++++..|..+..+..+ .++++.+...+.++. .+..+++++.+++++|.+++.+| .+..+++|+.|+|
T Consensus       175 l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~-~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~L  251 (313)
T d1ogqa_         175 LFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASV-LFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDL  251 (313)
T ss_dssp             TCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGG-GCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEEC
T ss_pred             cccccccccccccccccccccccccc-ccccccccccccccc-ccccccccccccccccccccccc-ccccccccccccC
Confidence            4 566666666666666666655443 577777776666654 55667778888888888876655 4777888889999


Q ss_pred             ccccCCCCChhhcCCCCCCCEEEeeCCcCeeecCCChhhhccccCcccccCCCCCCCC
Q 011820          346 SNNKLTGTISPKLATMPCVSALYLNGNNLSGELQFSEWFYGKMGRRFGAWNNPNLCYP  403 (477)
Q Consensus       346 s~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~N~~lc~~  403 (477)
                      ++|+++|.+|.+++++++|++|||++|+|+|.||....+ ..+ +.+++.+|+.+||.
T Consensus       252 s~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L-~~L-~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         252 RNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNL-QRF-DVSAYANNKCLCGS  307 (313)
T ss_dssp             CSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTG-GGS-CGGGTCSSSEEEST
T ss_pred             ccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccC-CCC-CHHHhCCCccccCC
Confidence            999998889988888999999999999999988854222 222 46677899989986

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure