Citrus Sinensis ID: 011858


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQSRNKKPPPDFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRRGC
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHcccccc
ccccEEEEccccccccccccccccccccccccccccccccHHcHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccc
mpglvsvktppdapppritvpeprpeppttpvprpkppspspssrskatpsptqsrnkkpppdftdasldnpdlgpFLLKLARDtiasgegpskALDYAIRASKSFERcaaaeaepslDYAMSLHVLAAIYCSLGKFEEAVPAlekaisvpdvtrgaDHALAKFSgymqlgdtcsmlgqvdrsigcYEEGLKIQIEAlgetdprvGETCRYLAEAHVQAMQFDKAEELCKKTLEIHrahsepasleeSADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFksskgdnhpsvASVFVRLADLYHrtgklreskSYCENALRiyarpvpgttaeEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLedkpgqqstiAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRscvepdgiglcpvvqdrrgc
mpglvsvktppdapppritvpeprpeppttpvprpkppspspssrskatpsptqsrnkkpppdftdasldNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIealgetdprVGETCRYLAEAHVQAMQFDKAEELCKKTLEIhrahsepasleesaDRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVfksskgdnhpsVASVFVRLADLYHRtgklresksyceNALRIyarpvpgtTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLledkpgqqstiagIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAffrscvepdgiglcpvvqdrrgc
MPGLVSVKTPPDapppritvpeprpeppttpvprpkppspspssrskatpsptQSRNKKPPPDFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRRGC
***************************************************************************PFLLKLARDT**********LDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEI****************RLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESV******LKLLQ**************TIAGIEARMGVMFYMVGRYEEAR**F**AIA*********SAFFRSCVEPDGIGLCPVV******
*PGL***KTPPDAPPPRI***********************PSSRSKATPSPTQSRNKKPPPDFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRR**
*************PPPRITVPEP***************************************DFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRA*********SADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRRGC
*PGLVSVKTPPDAPPPRITVP*************PKPPSPSPSSRSKATPSPTQSRNKKPPPDFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRRGC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQSRNKKPPPDFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESxxxxxxxxxxxxxxxxxxxxxPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDRRGC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query476 2.2.26 [Sep-21-2011]
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.665 0.238 0.232 2e-10
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.588 0.211 0.231 2e-10
P0CI651303 Nephrocystin-3 OS=Danio r no no 0.331 0.121 0.325 4e-09
Q9H0B6622 Kinesin light chain 2 OS= no no 0.460 0.352 0.263 5e-09
P46824508 Kinesin light chain OS=Dr yes no 0.390 0.366 0.264 9e-09
Q9NSK0 619 Kinesin light chain 4 OS= no no 0.403 0.310 0.252 1e-08
Q5PQM2 619 Kinesin light chain 4 OS= no no 0.403 0.310 0.252 1e-08
Q9DBS5 619 Kinesin light chain 4 OS= no no 0.399 0.306 0.255 1e-08
Q07866573 Kinesin light chain 1 OS= no no 0.403 0.335 0.241 2e-08
Q5R581560 Kinesin light chain 1 OS= no no 0.403 0.342 0.241 2e-08
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 152/353 (43%), Gaps = 36/353 (10%)

Query: 123  SLHVLAAIYCSLGKF-------EEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCS 175
            ++  LA +Y +LG+F        +A+  L++++ + +     DH     S + QL     
Sbjct: 938  NMSCLADLYETLGRFLKDLGLLSQAIVPLQRSLEIRETALDPDHPRVAQSLH-QLASVYV 996

Query: 176  MLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEI 235
               +   +   Y++ L+I   A G   P        LA  + +  ++++AE   KK+ +I
Sbjct: 997  QWKKFGNAEQLYKQALEISENAYGADHPYTARELEALATLYQKQNKYEQAEHFRKKSFKI 1056

Query: 236  H-RAHSEPASLEESADRRLMALICE----AKGDYEAALEHLVLASMAMIANGQDNEVAAI 290
            H +A  +  +L   A  R  AL  E     K   + A     L  +  + N  +     +
Sbjct: 1057 HQKAIKKKGNLYGFALLRRRALQLEELTLGKDTPDNARTLNELGVLYYLQNNLETADQFL 1116

Query: 291  DVSIG-----------------NIYLSLC----RFDEAVFSYQKALTVFKSSKGDNHPSV 329
              S+                  N   +LC    ++D+A   Y++AL + + +   +HPS+
Sbjct: 1117 KRSLEMRERVLGPDHPDCAQSLNNLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSL 1176

Query: 330  ASVFVRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEP 389
            A     LA LY + GKL ++    E A+ I  +   G     +A  L  ++ +Y  + + 
Sbjct: 1177 AYTVKHLAILYKKMGKLDKAVPLYELAVEIRQKSF-GPKHPSVATALVNLAVLYSQMKKH 1235

Query: 390  EEALKLLQRAMKLLEDKPGQQSTIAGIEAR-MGVMFYMVGRYEEARSSFESAI 441
             EAL L +RA+K+ ED  G+     G   + + V+ Y  G +E+A   ++ A+
Sbjct: 1236 VEALPLYERALKIYEDSLGRMHPRVGETLKNLAVLSYEGGDFEKAAELYKRAM 1288




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling which regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Homo sapiens (taxid: 9606)
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 Back     alignment and function description
>sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 Back     alignment and function description
>sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
255555655 605 kinesin light chain, putative [Ricinus c 0.962 0.757 0.810 0.0
449462511 593 PREDICTED: nephrocystin-3-like [Cucumis 0.947 0.760 0.795 0.0
356523649 578 PREDICTED: nephrocystin-3-like [Glycine 0.949 0.782 0.806 0.0
15236944 609 tetratricopeptide repeat domain-containi 0.962 0.752 0.764 0.0
21554384 606 putative kinesin light chain [Arabidopsi 0.962 0.755 0.764 0.0
356513265563 PREDICTED: nephrocystin-3-like [Glycine 0.918 0.776 0.788 0.0
42572867531 tetratricopeptide repeat domain-containi 0.962 0.862 0.764 0.0
297809309 608 hypothetical protein ARALYDRAFT_489926 [ 0.962 0.753 0.755 0.0
225426234 591 PREDICTED: nephrocystin-3 [Vitis vinifer 0.972 0.783 0.796 0.0
225470942 596 PREDICTED: nephrocystin-3 [Vitis vinifer 0.966 0.771 0.742 0.0
>gi|255555655|ref|XP_002518863.1| kinesin light chain, putative [Ricinus communis] gi|223541850|gb|EEF43396.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/485 (81%), Positives = 421/485 (86%), Gaps = 27/485 (5%)

Query: 1   MPGLVSVKTPPDAPPPRITVPEPRPEPPTTPVPRPKPPSPSPSSRSKATPSPTQSRN--- 57
           MPGLVSVKTPPDAPP RI+VPE +P+          PP   P S    TP+P +      
Sbjct: 1   MPGLVSVKTPPDAPPLRISVPEIQPQTQAQ-----TPPQARPESSVLRTPTPNKKPPSPS 55

Query: 58  ------------KKPPPD------FTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYA 99
                       KKPPPD        DASLDNPDLGPFLLKLARDTIASGEGPSKALDYA
Sbjct: 56  PSRSKPSPTRSAKKPPPDSLNPLLLADASLDNPDLGPFLLKLARDTIASGEGPSKALDYA 115

Query: 100 IRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADH 159
           IRASKSFERCA  + EPSLD  MSLHVLAAIYCSLG+F+EAVPALE+AI+VPD++RG DH
Sbjct: 116 IRASKSFERCAV-DGEPSLDLVMSLHVLAAIYCSLGRFDEAVPALERAITVPDLSRGMDH 174

Query: 160 ALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQA 219
           ALA FSGYMQLGDT SMLGQVD+SIGCYE+GLKIQI+ALG+TDPRVGETCRYLAEAHVQA
Sbjct: 175 ALAAFSGYMQLGDTYSMLGQVDKSIGCYEDGLKIQIDALGDTDPRVGETCRYLAEAHVQA 234

Query: 220 MQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMI 279
           M FDKA+ELCKKTLEIHRAHSEPAS+EE+ADRRLMALICEAKGDYE+ALEHLVLASMAMI
Sbjct: 235 MNFDKAQELCKKTLEIHRAHSEPASIEEAADRRLMALICEAKGDYESALEHLVLASMAMI 294

Query: 280 ANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADL 339
           ANGQDNEVAAIDVSIGNIY+SLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADL
Sbjct: 295 ANGQDNEVAAIDVSIGNIYMSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADL 354

Query: 340 YHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRA 399
           Y+RTGKLRESKSYCENALRIYA+PVPGTTAEEIAGGLTEISAIYES DEPEEALKLLQ+A
Sbjct: 355 YNRTGKLRESKSYCENALRIYAKPVPGTTAEEIAGGLTEISAIYESADEPEEALKLLQKA 414

Query: 400 MKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCV 459
           MKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEAR+SFESA+ KLRASGERKSAFF   +
Sbjct: 415 MKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARNSFESAVTKLRASGERKSAFFGVVL 474

Query: 460 EPDGI 464
              G+
Sbjct: 475 NQMGL 479




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449462511|ref|XP_004148984.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] gi|449518869|ref|XP_004166458.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356523649|ref|XP_003530449.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|15236944|ref|NP_192822.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|3513727|gb|AAC33943.1| contains similarity to TPR domains (Pfam: TPR.hmm: score: 11.15) and kinesin motor domains (Pfam: kinesin2.hmm, score: 17.49, 20.52 and 10.94) [Arabidopsis thaliana] gi|4539358|emb|CAB40052.1| putative protein [Arabidopsis thaliana] gi|7267782|emb|CAB81185.1| putative protein [Arabidopsis thaliana] gi|18176148|gb|AAL59992.1| unknown protein [Arabidopsis thaliana] gi|19699309|gb|AAL91265.1| AT4g10840/F25I24_50 [Arabidopsis thaliana] gi|24030472|gb|AAN41387.1| unknown protein [Arabidopsis thaliana] gi|332657533|gb|AEE82933.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21554384|gb|AAM63491.1| putative kinesin light chain [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356513265|ref|XP_003525334.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|42572867|ref|NP_974530.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|332657534|gb|AEE82934.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297809309|ref|XP_002872538.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. lyrata] gi|297318375|gb|EFH48797.1| hypothetical protein ARALYDRAFT_489926 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225426234|ref|XP_002263593.1| PREDICTED: nephrocystin-3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470942|ref|XP_002264247.1| PREDICTED: nephrocystin-3 [Vitis vinifera] gi|297745492|emb|CBI40572.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
TAIR|locus:2123411 609 KLCR1 "kinesin light chain-rel 0.823 0.643 0.833 1e-178
TAIR|locus:2086834 663 KLCR2 "kinesin light chain-rel 0.857 0.615 0.572 5.7e-123
TAIR|locus:2015959 650 KLCR3 "AT1G27500" [Arabidopsis 0.836 0.612 0.566 6.7e-120
TAIR|locus:2042506617 AT2G31240 "AT2G31240" [Arabido 0.785 0.606 0.268 2.5e-27
UNIPROTKB|Q6AZT71300 nphp3 "Nephrocystin-3" [Xenopu 0.334 0.122 0.283 2e-14
ASPGD|ASPL00000183131288 AN3547 [Emericella nidulans (t 0.731 0.270 0.224 4e-13
UNIPROTKB|Q7Z4941330 NPHP3 "Nephrocystin-3" [Homo s 0.348 0.124 0.327 6.4e-10
UNIPROTKB|E1BP931331 NPHP3 "Uncharacterized protein 0.348 0.124 0.327 3.9e-10
UNIPROTKB|F1SNS5293 F1SNS5 "Uncharacterized protei 0.348 0.566 0.327 4e-11
WB|WBGene00002215540 klc-2 [Caenorhabditis elegans 0.720 0.635 0.246 4.9e-11
TAIR|locus:2123411 KLCR1 "kinesin light chain-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1701 (603.8 bits), Expect = 1.0e-178, Sum P(2) = 1.0e-178
 Identities = 335/402 (83%), Positives = 368/402 (91%)

Query:    63 DFTDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPS----- 117
             D  D SLDNPDLGPFLLKLARD IASGEGP+KALDYAIRA+KSFERC AA A P      
Sbjct:    73 DVDDPSLDNPDLGPFLLKLARDAIASGEGPNKALDYAIRATKSFERCCAAVAPPIPGGSD 132

Query:   118 ----LDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDT 173
                 LD AMSLHVLAAIYCSLG+F+EAVP LE+AI VPD TRG DH+LA FSG+MQLGDT
Sbjct:   133 GGPVLDLAMSLHVLAAIYCSLGRFDEAVPPLERAIQVPDPTRGPDHSLAAFSGHMQLGDT 192

Query:   174 CSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTL 233
              SMLGQ+DRSI CYEEGLKIQI+ LG+TDPRVGETCRYLAEA+VQAMQF+KAEELCKKTL
Sbjct:   193 LSMLGQIDRSIACYEEGLKIQIQTLGDTDPRVGETCRYLAEAYVQAMQFNKAEELCKKTL 252

Query:   234 EIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVS 293
             EIHRAHSEPASLEE+ADRRLMA+ICEAKGDYE ALEHLVLASMAMIA+GQ++EVA+IDVS
Sbjct:   253 EIHRAHSEPASLEEAADRRLMAIICEAKGDYENALEHLVLASMAMIASGQESEVASIDVS 312

Query:   294 IGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYC 353
             IGNIY+SLCRFDEAVFSYQKALTVFK+SKG+ HP+VASVFVRLA+LYHRTGKLRESKSYC
Sbjct:   313 IGNIYMSLCRFDEAVFSYQKALTVFKASKGETHPTVASVFVRLAELYHRTGKLRESKSYC 372

Query:   354 ENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTI 413
             ENALRIY +PVPGTT EEIAGGLTEISAIYESVDEPEEALKLLQ++MKLLEDKPGQQS I
Sbjct:   373 ENALRIYNKPVPGTTVEEIAGGLTEISAIYESVDEPEEALKLLQKSMKLLEDKPGQQSAI 432

Query:   414 AGIEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFF 455
             AG+EARMGVM+Y VGRYE+AR++FESA+ KLRA+GE KSAFF
Sbjct:   433 AGLEARMGVMYYTVGRYEDARNAFESAVTKLRAAGE-KSAFF 473


GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2086834 KLCR2 "kinesin light chain-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015959 KLCR3 "AT1G27500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042506 AT2G31240 "AT2G31240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZT7 nphp3 "Nephrocystin-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z494 NPHP3 "Nephrocystin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP93 NPHP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNS5 F1SNS5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00002215 klc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-12
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-11
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 9e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 8e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 3e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 5e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 8e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.001
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.001
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.001
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.001
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.003
COG2976207 COG2976, COG2976, Uncharacterized protein conserve 0.003
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.004
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
 Score = 68.3 bits (165), Expect = 1e-12
 Identities = 71/313 (22%), Positives = 125/313 (39%), Gaps = 45/313 (14%)

Query: 94  KALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDV 153
           K L  A+           AEA   L+         A+   LG+  EA+  LE+A+     
Sbjct: 2   KDLLLALAILLEALAKLLAEALALLEAG------LALLELLGELAEALELLEEALE---- 51

Query: 154 TRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLA 213
                         + L      LG+++ ++   E+ L++++       P + E    L 
Sbjct: 52  ---LLPNSDLAGLLLLLALALLKLGRLEEALELLEKALELEL------LPNLAEALLNLG 102

Query: 214 EAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVL 273
                  ++++A EL +K L +           + A+  L        GDYE ALE    
Sbjct: 103 LLLEALGKYEEALELLEKALAL-------DPDPDLAEALLALGALYELGDYEEALELY-- 153

Query: 274 ASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVF 333
              A+  + + NE+A   +++G +  +L R++EA+   +KAL         N    A   
Sbjct: 154 -EKALELDPELNELAEALLALGALLEALGRYEEALELLEKALK-------LNPDDDAEAL 205

Query: 334 VRLADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEAL 393
           + L  LY + GK  E+  Y E AL +           + A  L  ++ +   +   EEAL
Sbjct: 206 LNLGLLYLKLGKYEEALEYYEKALEL---------DPDNAEALYNLALLLLELGRYEEAL 256

Query: 394 KLLQRAMKLLEDK 406
           + L++A++L  D 
Sbjct: 257 EALEKALELDPDL 269


Length = 291

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|225523 COG2976, COG2976, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 476
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.89
KOG1129478 consensus TPR repeat-containing protein [General f 99.89
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
KOG2003 840 consensus TPR repeat-containing protein [General f 99.86
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.86
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.86
KOG2076 895 consensus RNA polymerase III transcription factor 99.86
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.86
PRK04841 903 transcriptional regulator MalT; Provisional 99.85
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.85
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.83
KOG2003840 consensus TPR repeat-containing protein [General f 99.83
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.83
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.82
PRK04841 903 transcriptional regulator MalT; Provisional 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.81
PLN03218 1060 maturation of RBCL 1; Provisional 99.81
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
PRK12370553 invasion protein regulator; Provisional 99.8
KOG2076 895 consensus RNA polymerase III transcription factor 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.8
PLN03218 1060 maturation of RBCL 1; Provisional 99.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.79
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.79
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.78
PRK11189296 lipoprotein NlpI; Provisional 99.78
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.77
PRK11189296 lipoprotein NlpI; Provisional 99.76
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.75
KOG1125579 consensus TPR repeat-containing protein [General f 99.75
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.75
KOG1125579 consensus TPR repeat-containing protein [General f 99.74
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.73
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
PLN03077 857 Protein ECB2; Provisional 99.67
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.65
PLN03077 857 Protein ECB2; Provisional 99.64
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.63
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.61
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.6
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.56
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.55
PLN02789320 farnesyltranstransferase 99.55
PLN02789320 farnesyltranstransferase 99.53
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.51
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.51
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.48
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.48
KOG2300 629 consensus Uncharacterized conserved protein [Funct 99.47
PRK15359144 type III secretion system chaperone protein SscB; 99.42
KOG2376652 consensus Signal recognition particle, subunit Srp 99.42
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.41
PRK15359144 type III secretion system chaperone protein SscB; 99.39
PRK10370198 formate-dependent nitrite reductase complex subuni 99.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.38
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.38
KOG1915677 consensus Cell cycle control protein (crooked neck 99.35
PRK10370198 formate-dependent nitrite reductase complex subuni 99.34
KOG1128777 consensus Uncharacterized conserved protein, conta 99.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.33
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.31
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.3
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.29
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.28
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.26
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.26
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.25
KOG1586288 consensus Protein required for fusion of vesicles 99.25
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.24
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.23
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.23
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.22
KOG1585308 consensus Protein required for fusion of vesicles 99.21
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.2
KOG0553304 consensus TPR repeat-containing protein [General f 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.17
KOG1586288 consensus Protein required for fusion of vesicles 99.16
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.14
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.14
KOG1585308 consensus Protein required for fusion of vesicles 99.14
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.13
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.12
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.11
KOG0553304 consensus TPR repeat-containing protein [General f 99.1
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.1
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.08
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.08
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.04
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.03
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.97
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.96
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.93
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.93
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.92
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.91
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.91
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.91
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.9
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.88
PF12688120 TPR_5: Tetratrico peptide repeat 98.87
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.86
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.85
PF12688120 TPR_5: Tetratrico peptide repeat 98.84
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.83
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.8
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.8
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.79
KOG4555175 consensus TPR repeat-containing protein [Function 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.75
KOG2471696 consensus TPR repeat-containing protein [General f 98.74
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.73
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.72
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.71
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.71
COG4700251 Uncharacterized protein conserved in bacteria cont 98.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.68
PRK10803263 tol-pal system protein YbgF; Provisional 98.67
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.67
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.66
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.63
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.63
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.61
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.61
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.6
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.59
PRK15331165 chaperone protein SicA; Provisional 98.58
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.57
KOG4555175 consensus TPR repeat-containing protein [Function 98.56
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.56
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.56
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.53
PRK15331165 chaperone protein SicA; Provisional 98.53
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.52
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.51
KOG2471 696 consensus TPR repeat-containing protein [General f 98.51
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.5
COG3898531 Uncharacterized membrane-bound protein [Function u 98.5
COG4700251 Uncharacterized protein conserved in bacteria cont 98.5
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.49
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.49
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.46
KOG4234271 consensus TPR repeat-containing protein [General f 98.46
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.46
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.46
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.43
PRK11906458 transcriptional regulator; Provisional 98.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.41
KOG4234271 consensus TPR repeat-containing protein [General f 98.4
PF13512142 TPR_18: Tetratricopeptide repeat 98.39
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.39
COG5159 421 RPN6 26S proteasome regulatory complex component [ 98.37
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.37
PRK11906458 transcriptional regulator; Provisional 98.36
PF13512142 TPR_18: Tetratricopeptide repeat 98.33
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.3
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.28
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.26
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.24
PF1337173 TPR_9: Tetratricopeptide repeat 98.23
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.2
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.2
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.17
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.16
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.13
PF1337173 TPR_9: Tetratricopeptide repeat 98.13
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.07
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.06
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.05
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 98.01
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.01
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 98.0
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.95
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.94
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.93
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.92
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.91
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.87
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.86
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.84
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.83
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.82
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.8
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.78
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.77
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.77
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.77
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.72
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.72
KOG1550552 consensus Extracellular protein SEL-1 and related 97.7
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.67
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.67
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.65
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.64
PF1342844 TPR_14: Tetratricopeptide repeat 97.6
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.6
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.59
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.56
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.55
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.54
PF1343134 TPR_17: Tetratricopeptide repeat 97.52
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.52
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.52
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.51
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.51
KOG1550552 consensus Extracellular protein SEL-1 and related 97.5
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.5
PF1342844 TPR_14: Tetratricopeptide repeat 97.48
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.46
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.45
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.44
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 97.44
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.41
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.37
PF1343134 TPR_17: Tetratricopeptide repeat 97.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.25
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 97.24
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.23
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.18
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.13
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.1
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.97
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.97
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.97
KOG2581493 consensus 26S proteasome regulatory complex, subun 96.93
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.86
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.84
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 96.84
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.75
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 96.7
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 96.65
COG5187412 RPN7 26S proteasome regulatory complex component, 96.62
COG5187 412 RPN7 26S proteasome regulatory complex component, 96.61
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.6
KOG0687393 consensus 26S proteasome regulatory complex, subun 96.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.55
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.54
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 96.54
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.53
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.42
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.41
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 96.41
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.4
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.31
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 96.26
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 96.18
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.16
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.15
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.93
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.89
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.89
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.86
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.83
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.83
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.59
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.59
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.58
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.57
KOG0687393 consensus 26S proteasome regulatory complex, subun 95.44
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.4
PRK14707 2710 hypothetical protein; Provisional 95.36
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 95.31
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.12
KOG4507886 consensus Uncharacterized conserved protein, conta 95.11
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.04
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.83
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.8
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.79
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 94.75
KOG2581493 consensus 26S proteasome regulatory complex, subun 94.66
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 94.65
KOG1258577 consensus mRNA processing protein [RNA processing 94.57
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.57
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.47
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.46
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.41
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 94.32
PRK14707 2710 hypothetical protein; Provisional 94.26
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.25
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 94.22
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.18
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 94.03
KOG4014248 consensus Uncharacterized conserved protein (conta 94.02
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 93.94
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 93.86
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.81
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.74
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.67
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 93.66
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 93.55
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 93.47
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.38
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 93.12
PRK10941269 hypothetical protein; Provisional 92.81
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 92.79
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.76
KOG4014248 consensus Uncharacterized conserved protein (conta 92.69
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.61
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 92.33
PF05053 618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 92.23
COG3629280 DnrI DNA-binding transcriptional activator of the 92.14
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 92.06
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.84
PRK10941269 hypothetical protein; Provisional 91.72
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 91.62
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.39
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 91.25
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 91.18
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.94
COG3629280 DnrI DNA-binding transcriptional activator of the 90.92
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.87
KOG2422665 consensus Uncharacterized conserved protein [Funct 90.71
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 90.57
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 90.35
KOG1923830 consensus Rac1 GTPase effector FRL [Signal transdu 90.33
KOG1258577 consensus mRNA processing protein [RNA processing 90.31
KOG3364149 consensus Membrane protein involved in organellar 90.14
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 90.02
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 89.7
KOG2908 380 consensus 26S proteasome regulatory complex, subun 89.19
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 89.13
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 89.13
COG4976 287 Predicted methyltransferase (contains TPR repeat) 89.0
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 88.9
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 88.51
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 88.16
KOG3364149 consensus Membrane protein involved in organellar 88.13
PF1285434 PPR_1: PPR repeat 88.03
KOG4563400 consensus Cell cycle-regulated histone H1-binding 87.96
PHA02537230 M terminase endonuclease subunit; Provisional 87.62
KOG4563 400 consensus Cell cycle-regulated histone H1-binding 87.48
COG4976287 Predicted methyltransferase (contains TPR repeat) 87.06
KOG2422 665 consensus Uncharacterized conserved protein [Funct 86.98
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 86.77
COG3947361 Response regulator containing CheY-like receiver a 86.57
PF1285434 PPR_1: PPR repeat 86.45
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 86.38
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 86.26
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 86.25
COG3947361 Response regulator containing CheY-like receiver a 86.17
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 85.8
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 85.29
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.06
KOG2908380 consensus 26S proteasome regulatory complex, subun 83.8
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 83.63
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 83.31
PHA02537230 M terminase endonuclease subunit; Provisional 83.07
KOG0917338 consensus Uncharacterized conserved protein [Funct 82.56
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 82.15
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 81.51
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 81.47
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 81.27
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.17
PF1304150 PPR_2: PPR repeat family 81.05
COG5178 2365 PRP8 U5 snRNP spliceosome subunit [RNA processing 80.73
KOG1310758 consensus WD40 repeat protein [General function pr 80.71
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1e-38  Score=276.10  Aligned_cols=343  Identities=20%  Similarity=0.209  Sum_probs=265.7

Q ss_pred             CCCCCCCCCchHHHHHHHHHHHHcCCCcchHHHHHHHHHHHHHHHhhhccCCChhHHHHHHHHHHHHHhcCChhHHHHHH
Q 011858           65 TDASLDNPDLGPFLLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPAL  144 (476)
Q Consensus        65 ~~~~~~~~~~~~~~~~~a~~~~~~g~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  144 (476)
                      .......|..++.+.++|..+..+|+ +++|+.+|+.++++           +|+.+++|.++|.++...|+.+.|...|
T Consensus       106 ~~a~r~~~q~ae~ysn~aN~~kerg~-~~~al~~y~~aiel-----------~p~fida~inla~al~~~~~~~~a~~~~  173 (966)
T KOG4626|consen  106 LLAIRKNPQGAEAYSNLANILKERGQ-LQDALALYRAAIEL-----------KPKFIDAYINLAAALVTQGDLELAVQCF  173 (966)
T ss_pred             hhhhhccchHHHHHHHHHHHHHHhch-HHHHHHHHHHHHhc-----------CchhhHHHhhHHHHHHhcCCCcccHHHH
Confidence            34456788899999999999999995 99999999999986           6777888999999999999999999999


Q ss_pred             HHhhhhccccCCCch-------------hH------------HHHHhHhhHHHHHHHcCChhhHHHHHHHHHHHHHHHhc
Q 011858          145 EKAISVPDVTRGADH-------------AL------------AKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALG  199 (476)
Q Consensus       145 ~~al~~~~~~~~~~~-------------~~------------~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~  199 (476)
                      .+++++.+.......             ..            ..+-+|.+||.++..+|+...|+.+|++++.+      
T Consensus       174 ~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkl------  247 (966)
T KOG4626|consen  174 FEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKL------  247 (966)
T ss_pred             HHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcC------
Confidence            988888752210000             00            00123666677777777777777777777666      


Q ss_pred             CCchhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHH
Q 011858          200 ETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMI  279 (476)
Q Consensus       200 ~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~  279 (476)
                        +|....+|.+||.+|...+.|++|+.+|.+++.+.+.        .+.++.++|.+|..+|..+-|+..|+++++   
T Consensus       248 --dP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn--------~A~a~gNla~iYyeqG~ldlAI~~Ykral~---  314 (966)
T KOG4626|consen  248 --DPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPN--------HAVAHGNLACIYYEQGLLDLAIDTYKRALE---  314 (966)
T ss_pred             --CCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCc--------chhhccceEEEEeccccHHHHHHHHHHHHh---
Confidence              6777777888888888888888888888877765433        345577778888888888888888887765   


Q ss_pred             HcCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcCCCCCchHHHHHHHHHHHHHHcCChhHHHHHHHHHHHH
Q 011858          280 ANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRI  359 (476)
Q Consensus       280 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~  359 (476)
                         ..|....+++++|..+...|+..+|..+|.+++.+        .+..+.+.++||.+|.++|.+++|..+|++++++
T Consensus       315 ---~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l--------~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v  383 (966)
T KOG4626|consen  315 ---LQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRL--------CPNHADAMNNLGNIYREQGKIEEATRLYLKALEV  383 (966)
T ss_pred             ---cCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHh--------CCccHHHHHHHHHHHHHhccchHHHHHHHHHHhh
Confidence               45666778888888888888888888888888888        6777888888888888888888888888888887


Q ss_pred             HcCCCCCCChHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhccCCCchHHHHHHHHHHHHHHhhcHHHHHHHHHH
Q 011858          360 YARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVMFYMVGRYEEARSSFES  439 (476)
Q Consensus       360 ~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  439 (476)
                      .+.         .+.++.+||.+|.++|++++|+.+|++++.+.+..       +.++.++|..|..+|+.+.|+.+|.+
T Consensus       384 ~p~---------~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~f-------Ada~~NmGnt~ke~g~v~~A~q~y~r  447 (966)
T KOG4626|consen  384 FPE---------FAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTF-------ADALSNMGNTYKEMGDVSAAIQCYTR  447 (966)
T ss_pred             Chh---------hhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchH-------HHHHHhcchHHHHhhhHHHHHHHHHH
Confidence            543         57788888888888888888888888888776665       48888888888888888888888888


Q ss_pred             HHHHHHHhcccCchhhhhhhcccccccccccccc
Q 011858          440 AIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDR  473 (476)
Q Consensus       440 a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  473 (476)
                      |+.+        .+.++.+..+||.+|...|+..
T Consensus       448 AI~~--------nPt~AeAhsNLasi~kDsGni~  473 (966)
T KOG4626|consen  448 AIQI--------NPTFAEAHSNLASIYKDSGNIP  473 (966)
T ss_pred             HHhc--------CcHHHHHHhhHHHHhhccCCcH
Confidence            8863        3556788888888888877654



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG0917 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 3e-10
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 6e-05
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 9e-05
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-04
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 60/248 (24%), Positives = 102/248 (41%), Gaps = 56/248 (22%) Query: 123 SLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDR 182 +LH L Y S G++E AVP ++A+ + T G DH + ++L V R Sbjct: 29 TLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHP--------DVATMLNILALVYR 80 Query: 183 SIGCYE-------EGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEI 235 Y+ + L I+ + LG+ P V T LA + + ++ +AE LCK+ LEI Sbjct: 81 DQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEI 140 Query: 236 HRAHSEPASLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIG 295 + + +AL+C+ +G YE Sbjct: 141 REKVLGKDHPDVAKQLNNLALLCQNQGKYE------------------------------ 170 Query: 296 NIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKS-YCE 354 E + YQ+AL ++++ G + P+VA LA Y + GK +++++ Y E Sbjct: 171 ----------EVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKE 220 Query: 355 NALRIYAR 362 R + R Sbjct: 221 ILTRAHER 228
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-40
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-34
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-11
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-39
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-31
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-20
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-19
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-21
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 4e-11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-29
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-19
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 5e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-28
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-27
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-21
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-24
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-23
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-21
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-14
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 2e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-11
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-22
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-20
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-21
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-13
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-20
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-19
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-20
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-12
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-20
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-18
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-16
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-19
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-19
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-19
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-18
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-18
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-15
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-17
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-16
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-16
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-14
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-14
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-13
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-10
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-10
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 7e-06
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 7e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 1e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 4e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 6e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 2e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 4e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 7e-04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 7e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-05
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 6e-04
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 9e-04
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
 Score =  153 bits (390), Expect = 2e-42
 Identities = 56/377 (14%), Positives = 120/377 (31%), Gaps = 59/377 (15%)

Query: 94  KALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDV 153
              +       + ++ + ++   S+   + L +     C+ G     V   + AI     
Sbjct: 26  GGTNSH---DGNSQQGSGSDGGSSM--CLELALEGERLCNAGDCRAGVAFFQAAIQA--- 77

Query: 154 TRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEALGETDPRVGETCRYLA 213
                  L+    Y QLG+    LG  ++++  ++  L +  +++ +      ++   L 
Sbjct: 78  GTEDLRTLSAI--YSQLGNAYFYLGDYNKAMQYHKHDLTLA-KSMND-RLGEAKSSGNLG 133

Query: 214 EAHVQAMQFDKAEELCKKTLEIHRA----HSEPASLEESADRRLMALICEAKGDYEAALE 269
                  +FD+A   C++ L + R      SE  +L        +  +  AKG +     
Sbjct: 134 NTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYN------LGNVYHAKGKHLGQRN 187

Query: 270 HLVLASMAMIAN-----------------GQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQ 312
                     A                  G          ++GN Y  L  F  A+  +Q
Sbjct: 188 PGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAIEHHQ 247

Query: 313 KALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIY----ARPVPGTT 368
           + L + +     +  +       L + +   G+  ++  + +  L +      R      
Sbjct: 248 ERLRIAREF--GDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALAVELGERE----- 300

Query: 369 AEEIAGGLTEISAIYESVDEPEEALKLLQRAMKL---LEDKPGQQSTIAGIEARMGVMFY 425
               A     +   Y  + E   A++   R + +   L D+ G     A     +G    
Sbjct: 301 --VEAQSCYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIG----EARACWSLGNAHS 354

Query: 426 MVGRYEEARSSFESAIA 442
            +G +E A    E  + 
Sbjct: 355 AIGGHERALKYAEQHLQ 371


>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Length = 310 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 100.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 100.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 100.0
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.98
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.96
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.95
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.95
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.95
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.93
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.86
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.85
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.84
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.83
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.83
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.82
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.8
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.79
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.77
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.74
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.72
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.72
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.72
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.7
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.67
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.65
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.61
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.61
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.61
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.61
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.6
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.6
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.58
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.58
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.57
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.56
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.55
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.54
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.53
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.52
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.52
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.51
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.51
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.5
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.5
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.5
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.49
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.47
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.47
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.46
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.45
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.44
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.41
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.41
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.4
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.4
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.39
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.39
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.38
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.37
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.37
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.36
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.35
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.34
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.34
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.33
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.32
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.29
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.28
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.24
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.23
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.22
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.19
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.18
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.16
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.15
3k9i_A117 BH0479 protein; putative protein binding protein, 99.15
3k9i_A117 BH0479 protein; putative protein binding protein, 99.15
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.11
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.99
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.97
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.93
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.91
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.87
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.82
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.82
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.72
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.7
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.69
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.66
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.66
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.58
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.52
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.52
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.45
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.43
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.42
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.37
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 98.29
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.29
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.28
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.23
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.09
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.95
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 97.86
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.58
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.5
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.28
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 97.15
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 97.11
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 97.08
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.82
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.55
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 96.53
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.38
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.28
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 96.23
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.09
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 96.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.87
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.73
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.54
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.33
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.29
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.2
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.06
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.65
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.44
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.1
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.89
3re2_A472 Predicted protein; menin, multiple endocrine neopl 93.46
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.16
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 92.49
3u84_A550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 92.45
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.39
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 92.02
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 91.88
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 91.78
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 91.54
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 91.47
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 91.12
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 90.7
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.5
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 89.94
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.6
2npm_A260 14-3-3 domain containing protein; cell regulator p 89.54
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.1
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 86.78
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 86.71
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.46
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 86.31
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 86.17
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 85.22
2o8p_A227 14-3-3 domain containing protein; signaling protei 84.99
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 84.73
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.93
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 83.66
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 83.26
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 82.67
2rpa_A78 Katanin P60 ATPase-containing subunit A1; AAA ATPa 81.42
2npm_A260 14-3-3 domain containing protein; cell regulator p 80.91
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 80.6
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 80.33
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=8.5e-34  Score=260.13  Aligned_cols=341  Identities=15%  Similarity=0.167  Sum_probs=301.2

Q ss_pred             CChhHHHHHHHHHHHHHhcCChhHHHHHHHHhhhhccccCCCchhHHHHHhHhhHHHHHHHcCChhhHHHHHHHHHHHHH
Q 011858          116 PSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQI  195 (476)
Q Consensus       116 ~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~  195 (476)
                      .....+..+..+|.++...|++++|+.+|++++...+     .++.....++..+|.++...|++++|+.++++++.+..
T Consensus         4 ~~~~~~~~l~~~g~~~~~~g~~~~A~~~~~~al~~~~-----~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~   78 (406)
T 3sf4_A            4 SMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGT-----EDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLAR   78 (406)
T ss_dssp             -CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCC-----SCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHhcCc-----ccHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHH
Confidence            3445566889999999999999999999999999853     23333346799999999999999999999999999987


Q ss_pred             HHhcCCchhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHHHHHHHHHhCC------------
Q 011858          196 EALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALICEAKGD------------  263 (476)
Q Consensus       196 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~------------  263 (476)
                      ..  .+.+....++..+|.++...|++++|+.++++++++.+...+.  ...+.++..+|.++...|+            
T Consensus        79 ~~--~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~  154 (406)
T 3sf4_A           79 TI--GDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDK--VGEARALYNLGNVYHAKGKSFGCPGPQDVGE  154 (406)
T ss_dssp             HT--TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCH--HHHHHHHHHHHHHHHHHHHTCC-------CC
T ss_pred             hc--cccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcccc--cchHHHHHHHHHHHHHcCCcccccccchhhh
Confidence            75  4567788999999999999999999999999999999887654  4667789999999999999            


Q ss_pred             --------HHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcCCCCCchHHHHHHH
Q 011858          264 --------YEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVR  335 (476)
Q Consensus       264 --------~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~  335 (476)
                              +++|+.++++++.+....++.+....++.++|.++...|++++|+.++++++++....  .+......++.+
T Consensus       155 ~~~~a~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~--~~~~~~~~~~~~  232 (406)
T 3sf4_A          155 FPEEVRDALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEF--GDKAAERRAYSN  232 (406)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTBHHHHHHHHHHHHHHHHHT--TCHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHhccCcHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhc--CCcHHHHHHHHH
Confidence                    9999999999999999998888999999999999999999999999999999998876  445666789999


Q ss_pred             HHHHHHHcCChhHHHHHHHHHHHHHcCCCCCCChHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhccCCCchHHH
Q 011858          336 LADLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAG  415 (476)
Q Consensus       336 la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~  415 (476)
                      +|.++...|++++|+.++++++.+.+..   .+......++..+|.++...|++++|+.++++++.+.+.. +.......
T Consensus       233 la~~~~~~g~~~~A~~~~~~al~~~~~~---~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~-~~~~~~~~  308 (406)
T 3sf4_A          233 LGNAYIFLGEFETASEYYKKTLLLARQL---KDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEL-NDRIGEGR  308 (406)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHHHHT---TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHT-TCHHHHHH
T ss_pred             HHHHHHHcCChHHHHHHHHHHHHHHHhC---cCchHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhc-CCcHHHHH
Confidence            9999999999999999999999998774   3566678899999999999999999999999999999887 66677788


Q ss_pred             HHHHHHHHHHHhhcHHHHHHHHHHHHHHHHHhcccCchhhhhhhcccccccccccccc
Q 011858          416 IEARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQDR  473 (476)
Q Consensus       416 ~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~  473 (476)
                      ++..+|.+|...|++++|+.++++++++.+..+..  .....++..+|.++..+|+..
T Consensus       309 ~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~  364 (406)
T 3sf4_A          309 ACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDK--SGELTARLNLSDLQMVLGLSY  364 (406)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHTTCH--HHHHHHHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCC--cchhHHHHHHHHHHHHhhHhH
Confidence            99999999999999999999999999999988764  344577888888888887653



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>2rpa_A Katanin P60 ATPase-containing subunit A1; AAA ATPase, ATP-binding, cell cycle, cell division, cytoplas hydrolase, microtubule; NMR {Mus musculus} Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 476
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-08
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-20
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-19
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-17
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 3e-12
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 6e-12
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-09
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-08
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-10
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-09
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 4e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 6e-04
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.002
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.004
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.004
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]
 Score = 91.5 bits (225), Expect = 8e-21
 Identities = 36/329 (10%), Positives = 98/329 (29%), Gaps = 14/329 (4%)

Query: 124 LHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGADHALAKFSGYMQLGDTCSMLGQVDRS 183
             + A +  + G  +EA    + A+            +A       LG+     G++ RS
Sbjct: 15  NALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVA----TSVLGEVLHCKGELTRS 70

Query: 184 IGCYEEGLKIQIEALGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPA 243
           +   ++  ++  +   +       +    +E          A E  +K  ++        
Sbjct: 71  LALMQQTEQMARQ--HDVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQ 128

Query: 244 SLEESADRRLMALICEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCR 303
                   R+ A +  A    + A      + + ++++ Q  +       +    L+   
Sbjct: 129 LPMHEFLVRIRAQLLWAWARLDEAEASA-RSGIEVLSSYQPQQQLQCLAMLIQCSLARGD 187

Query: 304 FDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLADLYHRTGKLRESKSYCENALRIYARP 363
            D A     +   +  +    +   +++        +  TG    + ++  +  +     
Sbjct: 188 LDNARSQLNRLENLLGNG-KYHSDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPEFAN 246

Query: 364 VPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIEARMGVM 423
                 +        I+     + E E A  +L+   +         S +      +  +
Sbjct: 247 NHFLQGQWRN-----IARAQILLGEFEPAEIVLEELNE-NARSLRLMSDLNRNLLLLNQL 300

Query: 424 FYMVGRYEEARSSFESAIAKLRASGERKS 452
           ++  GR  +A+     A+     +G    
Sbjct: 301 YWQAGRKSDAQRVLLDALKLANRTGFISH 329


>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.95
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.86
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.85
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.8
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.74
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.47
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.46
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.41
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.4
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.4
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.39
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.38
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.18
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.05
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.76
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.64
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.63
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.14
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.05
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.74
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.56
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.34
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 94.45
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.81
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 93.34
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 91.74
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 91.13
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 91.09
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 90.18
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 87.94
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.85
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.29
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 84.86
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-32  Score=248.91  Aligned_cols=327  Identities=17%  Similarity=0.228  Sum_probs=275.7

Q ss_pred             HHHHHHHHHHcCCCcchHHHHHHHHHHHHHHHhhhccCCChhHHHHHHHHHHHHHhcCChhHHHHHHHHhhhhccccCCC
Q 011858           78 LLKLARDTIASGEGPSKALDYAIRASKSFERCAAAEAEPSLDYAMSLHVLAAIYCSLGKFEEAVPALEKAISVPDVTRGA  157 (476)
Q Consensus        78 ~~~~a~~~~~~g~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~  157 (476)
                      ++.+|..++..| ++++|+..|+++++.           .|....++..+|.++...|++++|+.+|++++++.+..   
T Consensus         2 ll~la~~~~~~G-~~~~A~~~~~~~l~~-----------~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~---   66 (388)
T d1w3ba_           2 PMELAHREYQAG-DFEAAERHCMQLWRQ-----------EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL---   66 (388)
T ss_dssp             CCTHHHHHHHHT-CHHHHHHHHHHHHHH-----------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC---
T ss_pred             hHHHHHHHHHcC-CHHHHHHHHHHHHHh-----------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC---
Confidence            467899999999 599999999999885           46667799999999999999999999999999986532   


Q ss_pred             chhHHHHHhHhhHHHHHHHcCChhhHHHHHHHHHHHHHHH----------------------------------------
Q 011858          158 DHALAKFSGYMQLGDTCSMLGQVDRSIGCYEEGLKIQIEA----------------------------------------  197 (476)
Q Consensus       158 ~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~----------------------------------------  197 (476)
                            ..++..+|.++..+|++++|+..+..++......                                        
T Consensus        67 ------~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  140 (388)
T d1w3ba_          67 ------AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSD  140 (388)
T ss_dssp             ------HHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHH
T ss_pred             ------HHHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                  2568999999999999999999998887642100                                        


Q ss_pred             --------------------hcCCchhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHHHHHH
Q 011858          198 --------------------LGETDPRVGETCRYLAEAHVQAMQFDKAEELCKKTLEIHRAHSEPASLEESADRRLMALI  257 (476)
Q Consensus       198 --------------------~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~  257 (476)
                                          .....+....++..+|.++...|++++|...+++++++.+.        ...++..+|.+
T Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~--------~~~~~~~l~~~  212 (388)
T d1w3ba_         141 LGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN--------FLDAYINLGNV  212 (388)
T ss_dssp             HHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT--------CHHHHHHHHHH
T ss_pred             ccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcc--------cHHHHHHHhhh
Confidence                                00012233567888999999999999999999999986432        34568899999


Q ss_pred             HHHhCCHHHHHHHHHHHHHHHHHcCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcCCCCCchHHHHHHHHH
Q 011858          258 CEAKGDYEAALEHLVLASMAMIANGQDNEVAAIDVSIGNIYLSLCRFDEAVFSYQKALTVFKSSKGDNHPSVASVFVRLA  337 (476)
Q Consensus       258 ~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la  337 (476)
                      +...|++++|+..++++...      .+.....+..+|.++...|++++|+.+|++++++        .|....++..+|
T Consensus       213 ~~~~~~~~~A~~~~~~~~~~------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~~l~  278 (388)
T d1w3ba_         213 LKEARIFDRAVAAYLRALSL------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--------QPHFPDAYCNLA  278 (388)
T ss_dssp             HHTTTCTTHHHHHHHHHHHH------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--------CSSCHHHHHHHH
T ss_pred             hhccccHHHHHHHHHHhHHH------hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--------CCCCHHHHHHHH
Confidence            99999999999999987653      2334667888999999999999999999999988        677889999999


Q ss_pred             HHHHHcCChhHHHHHHHHHHHHHcCCCCCCChHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhccCCCchHHHHH
Q 011858          338 DLYHRTGKLRESKSYCENALRIYARPVPGTTAEEIAGGLTEISAIYESVDEPEEALKLLQRAMKLLEDKPGQQSTIAGIE  417 (476)
Q Consensus       338 ~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~  417 (476)
                      .++...|++++|+..+++++...+.         ....+..++.++...|++++|+.+|++++++.++.       ..++
T Consensus       279 ~~~~~~~~~~~A~~~~~~~~~~~~~---------~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~-------~~~~  342 (388)
T d1w3ba_         279 NALKEKGSVAEAEDCYNTALRLCPT---------HADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF-------AAAH  342 (388)
T ss_dssp             HHHHHHSCHHHHHHHHHHHHHHCTT---------CHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTC-------HHHH
T ss_pred             HHHHHcCCHHHHHHHHHhhhccCCc---------cchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCC-------HHHH
Confidence            9999999999999999999987543         36788999999999999999999999999876655       3789


Q ss_pred             HHHHHHHHHhhcHHHHHHHHHHHHHHHHHhcccCchhhhhhhcccccccccccc
Q 011858          418 ARMGVMFYMVGRYEEARSSFESAIAKLRASGERKSAFFRSCVEPDGIGLCPVVQ  471 (476)
Q Consensus       418 ~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  471 (476)
                      ..+|.+|...|++++|+.+|++++++.        +....++.+||.+|..+||
T Consensus       343 ~~la~~~~~~g~~~~A~~~~~~al~l~--------P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         343 SNLASVLQQQGKLQEALMHYKEAIRIS--------PTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHTTTCCHHHHHHHHHHHTTC--------TTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhC--------CCCHHHHHHHHHHHHHcCC
Confidence            999999999999999999999999652        2234678899999999887



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure