Citrus Sinensis ID: 011998

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
ccccccEEEEEccccEEEcccccccccccccccEEEEEccEEEEEcccccccccccccccccEEEEEccccEEEEEEccccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEEccccccccccccEEEEccccccEEEEEEEccccccccccEEEEEccccccccEEEcccccccccccccccEEEccccEEEEEcccccccccccccccccccccccccccccHHHccccccccccccEEEEEEcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccc
ccccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEEccccccccccccEcccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEEccccccccccccccEEEEEEEcccEEEEEEcccccccccccEEEEcccccEEEEccccccccccEEEEEccEEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccEEEcccccEEccEEEcccccccc
mnplrdlhildtsshtwispsvrgegpeareghsAALVGKRLFifggcgkssntndevyyndlyILNTETFVWKRattsgnppsardshtcsswkNKIIViggedghdyylsdvhildtdtltwkelntsgmvlspraghstvafGKNLfvfggftdsqnlyddlymidvdsglwtkvittgegpsarfsvagdcldplkgGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKcqeqnftpvhdrALVRIdtisdvhqptpllsygeprrnnfplnegkktfqakvtesfplgytiettidgkplrgilfankptsasttnhnssrkRAVGEIggamlngdcnsnSKAFKALRqdgmdqeqvdgvqvkeftshegaaaaapdmknpahsdafqpvkdpvdsepsiaqlnlnddrttnapssttevpkeaicstdkdsatlllskdvkipvaecvtdpaepi
mnplrdlhildtsshtwispsvrGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTsgnppsardshtcssWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLkcqeqnftpvhdrALVRIDTIsdvhqptpllsygeprrnnfplnegKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANkptsasttnhnssrkRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAqlnlnddrttnapssttevpkeaicsTDKDsatlllskdvkipvaecvtdpaepi
MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGaaaaaPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
**********************************AALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA*************TCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSY***************TFQAKVTESFPLGYTIETTIDGKPLRGILFA********************************************************************************************************************************LLLSKDVKIPVAEC********
MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEK**************NFTPVHDRALVRIDTISDVHQPTPL***********************************TTID****************************************************************************************************************************************************************
MNPLRDLHILDTSSHTWISP*************SAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRAT**************SSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKP************KRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTT*************ICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPL********NNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILF*******************************************************************************************************************************ATLLLSKDVKIPVAECVTD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNSNSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPSIAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
P87061 1147 Tip elongation aberrant p yes no 0.433 0.178 0.339 2e-25
Q6AYI2382 Kelch domain-containing p yes no 0.486 0.602 0.284 3e-24
Q8VEM9382 Kelch domain-containing p yes no 0.486 0.602 0.284 3e-24
Q7M3S9 943 RING finger protein B OS= no no 0.471 0.236 0.275 1e-23
Q58CV6382 Kelch domain-containing p yes no 0.486 0.602 0.28 1e-23
Q9BQ90382 Kelch domain-containing p no no 0.486 0.602 0.276 2e-23
Q6AXB2366 Rab9 effector protein wit N/A no 0.397 0.513 0.328 9e-23
Q5EA50372 Rab9 effector protein wit no no 0.399 0.508 0.311 1e-22
Q8W4K1 995 tRNA wybutosine-synthesiz no no 0.427 0.203 0.342 1e-22
Q7Z6M1372 Rab9 effector protein wit no no 0.443 0.564 0.334 2e-22
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 112/230 (48%), Gaps = 25/230 (10%)

Query: 3   PLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEV---Y 59
           P  DL +L+ ++  + S    GE P  R GH++ L+G    +FGG      TN +V    
Sbjct: 107 PKNDLWVLNLATSQFTSLRSLGETPSPRLGHASILIGNAFIVFGGL-----TNHDVADRQ 161

Query: 60  YNDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDT 119
            N LY+LNT + VW++A  SG  PS R  HT S   +KI + GG    DYY +D+   D 
Sbjct: 162 DNSLYLLNTSSLVWQKANASGARPSGRYGHTISCLGSKICLFGGR-LLDYYFNDLVCFDL 220

Query: 120 DTLT-----WKELNTSGMVLSP---RAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVD 171
           + L      W+    + +V  P   RAGH    F   L++FGG TD  N ++DL+     
Sbjct: 221 NNLNTSDSRWE---LASVVNDPPPARAGHVAFTFSDKLYIFGG-TDGANFFNDLWCYHPK 276

Query: 172 SGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMY 221
              W+KV T G  P+ R   A   ++    G+L   GG       L+D+Y
Sbjct: 277 QSAWSKVETFGVAPNPRAGHAASVVE----GILYVFGGRASDGTFLNDLY 322
Cell polarity protein. Acts as an end marker, directing the growth machinery to the cell poles. Involved in the regulation of microtubular organization, affecting the maintenance of a single central axis. Prevents the curling of microtubule tips around the cell ends and is required for the retention of polarity factors such as pom1, tip1 and tea2 at the cell ends, necessary for the cell to grow in a straight line. Links tip1 and tea4 in a common complex.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 Back     alignment and function description
>sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 Back     alignment and function description
>sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 Back     alignment and function description
>sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 Back     alignment and function description
>sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
255547157556 kelch repeat protein, putative [Ricinus 0.966 0.821 0.683 1e-178
297734075 605 unnamed protein product [Vitis vinifera] 0.816 0.638 0.700 1e-162
359491361 589 PREDICTED: kelch domain-containing prote 0.782 0.628 0.692 1e-159
449440856 597 PREDICTED: uncharacterized protein LOC10 0.972 0.770 0.585 1e-158
449477505535 PREDICTED: uncharacterized protein LOC10 0.849 0.751 0.657 1e-157
356562638 609 PREDICTED: kelch domain-containing prote 0.900 0.699 0.603 1e-143
334182672556 galactose oxidase/kelch repeat domain-co 0.892 0.758 0.572 1e-141
297844816450 predicted protein [Arabidopsis lyrata su 0.697 0.733 0.679 1e-136
356507056 997 PREDICTED: uncharacterized protein LOC10 0.881 0.418 0.575 1e-134
356519144 583 PREDICTED: uncharacterized protein LOC10 0.875 0.710 0.572 1e-133
>gi|255547157|ref|XP_002514636.1| kelch repeat protein, putative [Ricinus communis] gi|223546240|gb|EEF47742.1| kelch repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  630 bits (1625), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 368/477 (77%), Gaps = 20/477 (4%)

Query: 1   MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYY 60
           MNPL+DLHILDT SHTWI+P+VRGEGPEAREGHSAALVGKRLFIFGGCGKSSN NDEVY+
Sbjct: 96  MNPLKDLHILDTLSHTWIAPAVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNNNDEVYF 155

Query: 61  NDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTD 120
           NDLYILNTETFVWK+A TSG PPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILD +
Sbjct: 156 NDLYILNTETFVWKKAVTSGTPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDAE 215

Query: 121 TLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLWTKVIT 180
           TL WKELN +G  L PRAGHSTV+FGKNLFVFGGFTD+QNLYDDLYM+DVD+G+WTK++T
Sbjct: 216 TLVWKELNATGQKLPPRAGHSTVSFGKNLFVFGGFTDAQNLYDDLYMLDVDTGVWTKIMT 275

Query: 181 TGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLV---NERKLEKLS 237
            G GPSARFSVAGDCLDP  GGVLVFIGGCNKSLEALDDMYYLYTGL    +E +LEKLS
Sbjct: 276 AGIGPSARFSVAGDCLDPQIGGVLVFIGGCNKSLEALDDMYYLYTGLARIRDELRLEKLS 335

Query: 238 LRKQLKLKCQEQNF-TPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQA 296
           LRKQLKLKCQEQN  +PVHD+AL+RIDT           S    R N   L++GKKTFQA
Sbjct: 336 LRKQLKLKCQEQNLNSPVHDKALLRIDT-----------SRENLRLNQVQLHQGKKTFQA 384

Query: 297 KVTESFPLGYTIETTIDGKPLRGILFANKPTSASTTNHNSSRKRAVGEIGGAMLNGDCNS 356
           KVTE FP GYTIET IDGKPL GILFANKP S+   + ++SRKR   EI G +LN D N+
Sbjct: 385 KVTECFPHGYTIETIIDGKPLHGILFANKPISSPMASQSNSRKRVSAEI-GPLLNSDHNN 443

Query: 357 NSKAFKALRQDGMDQEQVDGVQVKEFTSHEGAAAAAPDMKNPAHSDAFQPVKDPVDSEPS 416
            SK  KAL+QDG+D  Q D V  KE   HE    A  D KN   SD  Q  + P + EPS
Sbjct: 444 KSKTSKALKQDGVDHLQPDNVHGKETLMHESKPEA--DAKN-LPSDVSQLYEVPSNLEPS 500

Query: 417 IAQLNLNDDRTTNAPSSTTEVPKEAICSTDKDSATLLLSKDVKIPVAECVTDPAEPI 473
           +A LNLNDD  ++AP+S T   KE      K+S TL + +D +I  A    +PA+ +
Sbjct: 501 VAPLNLNDDMISDAPNSDTGFAKEFFTPA-KESITLSIKQDNRILTAGVGNEPAKSL 556

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734075|emb|CBI15322.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491361|ref|XP_002265482.2| PREDICTED: kelch domain-containing protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440856|ref|XP_004138200.1| PREDICTED: uncharacterized protein LOC101209027 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449477505|ref|XP_004155043.1| PREDICTED: uncharacterized protein LOC101224155 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356562638|ref|XP_003549576.1| PREDICTED: kelch domain-containing protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|334182672|ref|NP_173296.3| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana] gi|9795595|gb|AAF98413.1|AC026238_5 Hypothetical protein [Arabidopsis thaliana] gi|332191613|gb|AEE29734.1| galactose oxidase/kelch repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297844816|ref|XP_002890289.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297336131|gb|EFH66548.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356507056|ref|XP_003522287.1| PREDICTED: uncharacterized protein LOC100785267 [Glycine max] Back     alignment and taxonomy information
>gi|356519144|ref|XP_003528234.1| PREDICTED: uncharacterized protein LOC100808826 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
DICTYBASE|DDB_G0270750485 DDB_G0270750 "Kelch repeat-con 0.344 0.336 0.395 2.2e-26
UNIPROTKB|F1SKQ3370 RABEPK "Uncharacterized protei 0.435 0.556 0.344 1.6e-25
MGI|MGI:2651568382 Klhdc3 "kelch domain containin 0.484 0.599 0.294 2.4e-25
RGD|1307105382 Klhdc3 "kelch domain containin 0.484 0.599 0.294 2.4e-25
UNIPROTKB|Q58CV6382 KLHDC3 "Kelch domain-containin 0.484 0.599 0.290 8.7e-25
UNIPROTKB|Q5EA50372 RABEPK "Rab9 effector protein 0.399 0.508 0.311 1.5e-24
UNIPROTKB|Q9BQ90382 KLHDC3 "Kelch domain-containin 0.484 0.599 0.286 1.9e-24
UNIPROTKB|A5GFR1410 KLHDC3 "Uncharacterized protei 0.484 0.558 0.294 3.5e-24
UNIPROTKB|Q7Z6M1372 RABEPK "Rab9 effector protein 0.443 0.564 0.339 4.2e-24
POMBASE|SPCC1223.06 1147 tea1 "cell end marker Tea1" [S 0.439 0.181 0.348 3.2e-23
DICTYBASE|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 315 (115.9 bits), Expect = 2.2e-26, P = 2.2e-26
 Identities = 68/172 (39%), Positives = 94/172 (54%)

Query:     4 LRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDL 63
             L DLH+LD  + TW  P   GE P AR  HS   VGK + +FGG G         Y N+L
Sbjct:   193 LNDLHVLDLETFTWSEPICIGEAPSARSSHSVCCVGKMMILFGGSGAR-------YSNEL 245

Query:    64 YILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLT 123
             + L+T T  W +    G PPS R  HT  S+  K++  GG +      + V+ILDTDT+ 
Sbjct:   246 FSLDTVTMRWTKHDVLGTPPSERWCHTMCSFGKKVVTFGGSNDKRKD-NKVYILDTDTME 304

Query:   124 WKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLYDDLYMIDVDSGLW 175
             W +  TSG    PR  H+ VA G+++ VFGG+   Q L +DLY+++  +  W
Sbjct:   305 WSQPPTSGNCPIPRQLHTAVAIGESMIVFGGWGKHQEL-NDLYILNTRTMKW 355
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2651568 Klhdc3 "kelch domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307105 Klhdc3 "kelch domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CV6 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ90 KLHDC3 "Kelch domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFR1 KLHDC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z6M1 RABEPK "Rab9 effector protein with kelch motifs" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPCC1223.06 tea1 "cell end marker Tea1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-13
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 7e-11
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 9e-10
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 2e-08
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 3e-08
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-07
pfam1385442 pfam13854, Kelch_5, Kelch motif 3e-07
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 4e-07
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 7e-07
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 8e-07
COG3055381 COG3055, COG3055, Uncharacterized protein conserve 9e-07
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-06
pfam0764648 pfam07646, Kelch_2, Kelch motif 2e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 3e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 7e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 9e-06
pfam1385442 pfam13854, Kelch_5, Kelch motif 2e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-05
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 7e-05
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 8e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 2e-04
PLN02772398 PLN02772, PLN02772, guanylate kinase 3e-04
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 6e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 7e-04
pfam1385442 pfam13854, Kelch_5, Kelch motif 0.001
pfam0134446 pfam01344, Kelch_1, Kelch motif 0.001
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.002
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information 
 Score = 71.5 bits (175), Expect = 2e-13
 Identities = 66/210 (31%), Positives = 95/210 (45%), Gaps = 19/210 (9%)

Query: 17  WISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRA 76
           WI    +GEGP  R  H  A VG +++ FGG      T ++     LY+ + ET  W  +
Sbjct: 153 WIKVEQKGEGPGLRCSHGIAQVGNKIYSFGG----EFTPNQPIDKHLYVFDLETRTWSIS 208

Query: 77  TTSGNPPSARDSHTCS-SWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLS 135
             +G+ P          S  + + V GG D    Y +  +  DT T  WK L       +
Sbjct: 209 PATGDVPHLSCLGVRMVSIGSTLYVFGGRDASRQY-NGFYSFDTTTNEWKLLTPVEEGPT 267

Query: 136 PRAGHSTVAFGKNLFVFGGFTDSQNLYD-DLYMIDVDSGLWTKVITTGEGPSARFSVAGD 194
           PR+ HS  A  +N++VFGG + +  L   D Y I VD   W    T G+  S R    G 
Sbjct: 268 PRSFHSMAADEENVYVFGGVSATARLKTLDSYNI-VDKK-WFHCSTPGDSFSIR---GGA 322

Query: 195 CLDPLKGGVLVFIG--GCNKSLEALDDMYY 222
            L+ ++G V V  G  GC      +DD++Y
Sbjct: 323 GLEVVQGKVWVVYGFNGCE-----VDDVHY 347

Length = 470
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.98
KOG1230521 consensus Protein containing repeated kelch motifs 99.98
PHA02713557 hypothetical protein; Provisional 99.98
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.97
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.97
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.97
PHA02713557 hypothetical protein; Provisional 99.97
PHA03098534 kelch-like protein; Provisional 99.97
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.96
KOG1230521 consensus Protein containing repeated kelch motifs 99.96
PHA03098534 kelch-like protein; Provisional 99.96
PHA02790480 Kelch-like protein; Provisional 99.96
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.96
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.95
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.95
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.95
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.94
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.93
PHA02790480 Kelch-like protein; Provisional 99.92
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.61
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.47
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.44
PF1396450 Kelch_6: Kelch motif 99.14
PF1396450 Kelch_6: Kelch motif 99.02
PLN02772398 guanylate kinase 98.93
PLN02772398 guanylate kinase 98.89
PF1341549 Kelch_3: Galactose oxidase, central domain 98.89
PF1341549 Kelch_3: Galactose oxidase, central domain 98.88
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.85
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.84
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.83
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.79
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.74
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.72
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.7
PF1385442 Kelch_5: Kelch motif 98.62
PF1385442 Kelch_5: Kelch motif 98.52
smart0061247 Kelch Kelch domain. 98.45
smart0061247 Kelch Kelch domain. 98.28
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.21
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.12
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.95
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.66
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.48
PF12768281 Rax2: Cortical protein marker for cell polarity 96.14
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.97
PF12768281 Rax2: Cortical protein marker for cell polarity 95.6
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.4
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.82
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.34
PRK05137435 tolB translocation protein TolB; Provisional 92.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 91.97
PRK00178430 tolB translocation protein TolB; Provisional 91.76
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.6
PRK04792448 tolB translocation protein TolB; Provisional 91.12
PRK04792448 tolB translocation protein TolB; Provisional 90.8
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 90.04
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.42
KOG2055514 consensus WD40 repeat protein [General function pr 88.32
PRK03629429 tolB translocation protein TolB; Provisional 88.04
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 87.92
PRK04043419 tolB translocation protein TolB; Provisional 87.37
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 87.18
PRK04922433 tolB translocation protein TolB; Provisional 86.92
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 86.84
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 86.16
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 86.12
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 85.85
KOG2055514 consensus WD40 repeat protein [General function pr 84.71
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 84.21
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 81.79
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 81.26
PF09910339 DUF2139: Uncharacterized protein conserved in arch 80.48
>PLN02193 nitrile-specifier protein Back     alignment and domain information 
Probab=100.00  E-value=1.3e-33  Score=299.38  Aligned_cols=267  Identities=24%  Similarity=0.330  Sum_probs=210.5

Q ss_pred             cCcEEEEECCCCeEEecccCCCCCC-cccceEEEEECCEEEEEecCCCCCCCCCceeeCeEEEEECCCCeEEEeecCCCC
Q 011998            4 LRDLHILDTSSHTWISPSVRGEGPE-AREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNP   82 (473)
Q Consensus         4 l~dv~~yD~~t~~W~~l~~~~~~P~-~R~~hsa~~~~~~Iyv~GG~~~~~~~~~~~~~~dv~~yd~~t~~W~~l~~~g~~   82 (473)
                      .+++|+||+.+++|+.+...++.|. +|.+|++++++++||||||...      ...++++|+||+.+++|+++.+++..
T Consensus       192 ~~~v~~yD~~~~~W~~~~~~g~~P~~~~~~~~~v~~~~~lYvfGG~~~------~~~~ndv~~yD~~t~~W~~l~~~~~~  265 (470)
T PLN02193        192 DKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSIGSTLYVFGGRDA------SRQYNGFYSFDTTTNEWKLLTPVEEG  265 (470)
T ss_pred             eCcEEEEECCCCEEEeCCCCCCCCCCcccceEEEEECCEEEEECCCCC------CCCCccEEEEECCCCEEEEcCcCCCC
Confidence            3689999999999998765555565 4678999999999999999742      23578999999999999999887777


Q ss_pred             CCCceeeEEEEECCEEEEEeCCCCCCCccceEEEEECCCCCEEEeeCCCCCCCCcceeEEEEECCEEEEEecccCCCCcc
Q 011998           83 PSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNLY  162 (473)
Q Consensus        83 P~~R~~hs~~~~~~~IyV~GG~~~~~~~~ndv~~yD~~t~~W~~l~~~g~~p~~R~~hs~~~~~~~LyV~GG~~~~~~~~  162 (473)
                      |.+|..|++++++++||||||.+... .++++++||+.+++|+.+++.+.+|.+|.+|++++++++|||+||...  ..+
T Consensus       266 P~~R~~h~~~~~~~~iYv~GG~~~~~-~~~~~~~yd~~t~~W~~~~~~~~~~~~R~~~~~~~~~gkiyviGG~~g--~~~  342 (470)
T PLN02193        266 PTPRSFHSMAADEENVYVFGGVSATA-RLKTLDSYNIVDKKWFHCSTPGDSFSIRGGAGLEVVQGKVWVVYGFNG--CEV  342 (470)
T ss_pred             CCCccceEEEEECCEEEEECCCCCCC-CcceEEEEECCCCEEEeCCCCCCCCCCCCCcEEEEECCcEEEEECCCC--Ccc
Confidence            89999999999999999999997654 689999999999999999876678899999999999999999999743  347


Q ss_pred             ccEEEEeCCCCcEEEEeeCCCCCCCcceeeEEEeccccCCEEEEEcccCC--------CCCccCcEEEEEccccceeeee
Q 011998          163 DDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNK--------SLEALDDMYYLYTGLVNERKLE  234 (473)
Q Consensus       163 ndv~~yd~~t~~W~~v~~~g~~P~~R~~~~a~~~~~~~~~~l~v~GG~~~--------~~~~~~dv~~ld~~~~~w~~~~  234 (473)
                      +++++||+.+++|+++...+..|.+|..|+++.+    +++||||||...        .....+|+|.||+.+.+|+.+.
T Consensus       343 ~dv~~yD~~t~~W~~~~~~g~~P~~R~~~~~~~~----~~~iyv~GG~~~~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~  418 (470)
T PLN02193        343 DDVHYYDPVQDKWTQVETFGVRPSERSVFASAAV----GKHIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLD  418 (470)
T ss_pred             CceEEEECCCCEEEEeccCCCCCCCcceeEEEEE----CCEEEEECCccCCccccccCccceeccEEEEEcCcCEEEEcc
Confidence            9999999999999999987778999999988876    789999999753        1246789999999999998765


Q ss_pred             ccchhhhccccccccccccCCCcceEEEcceecccCCccEEEECCcccccccCCCCccceEeec
Q 011998          235 KLSLRKQLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRRNNFPLNEGKKTFQAKV  298 (473)
Q Consensus       235 ~l~~~~~l~~~~~~~~~~p~~~~~l~~~G~~~~~~~~~~ili~GG~~~~~~~~~~~~k~f~~~v  298 (473)
                      .+...        ...+.++..+...    .........++++||.+..+-.   -+|+|.+.+
T Consensus       419 ~~~~~--------~~~P~~R~~~~~~----~~~~~~~~~~~~fGG~~~~~~~---~~D~~~~~~  467 (470)
T PLN02193        419 KFGEE--------EETPSSRGWTAST----TGTIDGKKGLVMHGGKAPTNDR---FDDLFFYGI  467 (470)
T ss_pred             cCCCC--------CCCCCCCccccce----eeEEcCCceEEEEcCCCCcccc---ccceEEEec
Confidence            43211        1122333222110    1112223459999998765433   267776644

>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-41
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-38
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 8e-36
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 3e-08
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-04
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-25
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 9e-22
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 9e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-09
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-21
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-18
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-10
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-20
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-20
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-20
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-17
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-20
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-16
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-16
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-15
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-20
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  156 bits (396), Expect = 1e-41
 Identities = 44/229 (19%), Positives = 75/229 (32%), Gaps = 21/229 (9%)

Query: 1   MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYY 60
               R +  ++ +           E P  R+     + G  +F  GG             
Sbjct: 360 FLFDRSISEINLTVDEDYQLL-ECECPINRKFGDVDVAGNDVFYMGGSNPYR-------V 411

Query: 61  NDLYILNTETFVW---KRATTSGNPPSARDSHTCS--SWKNKIIVIGGEDGHDYYLSDVH 115
           N++  L+             +S   P AR  HT +  S  N++++IGG       LSD  
Sbjct: 412 NEILQLSIHYDKIDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNW 471

Query: 116 ILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKN-LFVFGGFTDSQNLYDDLYMIDVDSGL 174
           I D  T  W  + +   +   R  HS  +     + + GG T+       + + +V   +
Sbjct: 472 IFDMKTREWSMIKS---LSHTRFRHSACSLPDGNVLILGGVTEG----PAMLLYNVTEEI 524

Query: 175 WTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYL 223
           +  V    E        AG   DP+    ++  GG        D     
Sbjct: 525 FKDVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIF 573
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.93
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.91
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.64
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.1
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.1
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.05
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.76
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.26
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.43
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.82
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.79
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.51
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.2
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.99
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.67
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.49
3jrp_A379 Fusion protein of protein transport protein SEC13 93.26
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.72
3v9f_A781 Two-component system sensor histidine kinase/RESP 92.69
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.05
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.0
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.98
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.75
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 91.44
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 91.41
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.69
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 90.55
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 90.54
3jrp_A379 Fusion protein of protein transport protein SEC13 90.5
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 90.45
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.29
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.28
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.21
4a2l_A 795 BT_4663, two-component system sensor histidine kin 89.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.92
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 89.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 89.45
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 88.47
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 88.22
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 87.31
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 87.03
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.86
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 86.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 86.05
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 85.69
3jro_A 753 Fusion protein of protein transport protein SEC13 85.56
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 85.51
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 85.4
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 85.05
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 84.58
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 84.55
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 84.39
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 84.2
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 84.16
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 84.04
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 84.03
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 83.67
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 83.29
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 83.27
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 83.01
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 82.93
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 82.92
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 82.74
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 82.53
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 82.38
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 82.21
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 81.7
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 80.99
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 80.72
3ow8_A321 WD repeat-containing protein 61; structural genomi 80.4
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 80.32
3ott_A758 Two-component system sensor histidine kinase; beta 80.07
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=8.2e-35  Score=288.12  Aligned_cols=233  Identities=17%  Similarity=0.216  Sum_probs=199.2

Q ss_pred             cCcEEEEECCCCeEEecccCCCCCCcccceEEEEECCEEEEEecCCCCCCCCCceeeCeEEEEECCCCeEEEeecCCCCC
Q 011998            4 LRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGNPP   83 (473)
Q Consensus         4 l~dv~~yD~~t~~W~~l~~~~~~P~~R~~hsa~~~~~~Iyv~GG~~~~~~~~~~~~~~dv~~yd~~t~~W~~l~~~g~~P   83 (473)
                      ++++++||+.+++|..+   +++|.+|.+|++++++++|||+||..       ...++++++||+.+++|++++.+   |
T Consensus        23 ~~~~~~~d~~~~~W~~~---~~~p~~r~~~~~~~~~~~lyv~GG~~-------~~~~~~~~~~d~~~~~W~~~~~~---p   89 (306)
T 3ii7_A           23 PQSCRYFNPKDYSWTDI---RCPFEKRRDAACVFWDNVVYILGGSQ-------LFPIKRMDCYNVVKDSWYSKLGP---P   89 (306)
T ss_dssp             TTSEEEEETTTTEEEEC---CCCSCCCBSCEEEEETTEEEEECCBS-------SSBCCEEEEEETTTTEEEEEECC---S
T ss_pred             CceEEEecCCCCCEecC---CCCCcccceeEEEEECCEEEEEeCCC-------CCCcceEEEEeCCCCeEEECCCC---C
Confidence            68999999999999998   57899999999999999999999974       34678999999999999999765   8


Q ss_pred             CCceeeEEEEECCEEEEEeCCCCCCCccceEEEEECCCCCEEEeeCCCCCCCCcceeEEEEECCEEEEEecccCCCC---
Q 011998           84 SARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQN---  160 (473)
Q Consensus        84 ~~R~~hs~~~~~~~IyV~GG~~~~~~~~ndv~~yD~~t~~W~~l~~~g~~p~~R~~hs~~~~~~~LyV~GG~~~~~~---  160 (473)
                      .+|..|++++++++|||+||.+.....++++++||+.+++|+.++.   +|.+|..|+++.++++|||+||......   
T Consensus        90 ~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~d~~~~~W~~~~~---~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~  166 (306)
T 3ii7_A           90 TPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPS---MLTQRCSHGMVEANGLIYVCGGSLGNNVSGR  166 (306)
T ss_dssp             SCCBSCEEEEETTEEEEECCBBTTBSCCCCEEEEETTTTEEEEECC---CSSCCBSCEEEEETTEEEEECCEESCTTTCE
T ss_pred             ccccceeEEEECCEEEEECCCCCCCcEeeeEEEEeCCCCceEeCCC---CcCCcceeEEEEECCEEEEECCCCCCCCccc
Confidence            9999999999999999999997555678999999999999999976   8999999999999999999999865433   


Q ss_pred             ccccEEEEeCCCCcEEEEeeCCCCCCCcceeeEEEeccccCCEEEEEcccCCCCCccCcEEEEEccccceeeeeccchhh
Q 011998          161 LYDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRK  240 (473)
Q Consensus       161 ~~ndv~~yd~~t~~W~~v~~~g~~P~~R~~~~a~~~~~~~~~~l~v~GG~~~~~~~~~dv~~ld~~~~~w~~~~~l~~~~  240 (473)
                      .++++++||+.+++|+.+..   .|.+|..|+++.+    +++|||+||.+.. ..+++++.||+.+.+|..+..++   
T Consensus       167 ~~~~~~~yd~~~~~W~~~~~---~p~~r~~~~~~~~----~~~i~v~GG~~~~-~~~~~~~~yd~~~~~W~~~~~~p---  235 (306)
T 3ii7_A          167 VLNSCEVYDPATETWTELCP---MIEARKNHGLVFV----KDKIFAVGGQNGL-GGLDNVEYYDIKLNEWKMVSPMP---  235 (306)
T ss_dssp             ECCCEEEEETTTTEEEEECC---CSSCCBSCEEEEE----TTEEEEECCEETT-EEBCCEEEEETTTTEEEECCCCS---
T ss_pred             ccceEEEeCCCCCeEEECCC---ccchhhcceEEEE----CCEEEEEeCCCCC-CCCceEEEeeCCCCcEEECCCCC---
Confidence            38999999999999999975   5788999998876    7899999998774 57899999999999998764322   


Q ss_pred             hccccccccccccCCCcceEEEcceecccCCccEEEECCccc
Q 011998          241 QLKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRR  282 (473)
Q Consensus       241 ~l~~~~~~~~~~p~~~~~l~~~G~~~~~~~~~~ili~GG~~~  282 (473)
                                 .++..+..+.+        ++.|+++||...
T Consensus       236 -----------~~r~~~~~~~~--------~~~i~v~GG~~~  258 (306)
T 3ii7_A          236 -----------WKGVTVKCAAV--------GSIVYVLAGFQG  258 (306)
T ss_dssp             -----------CCBSCCEEEEE--------TTEEEEEECBCS
T ss_pred             -----------CCccceeEEEE--------CCEEEEEeCcCC
Confidence                       22333334443        335999999754
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-08
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 7e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 59.2 bits (141), Expect = 2e-10
 Identities = 27/143 (18%), Positives = 46/143 (32%), Gaps = 13/143 (9%)

Query: 1   MNPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYY 60
            +    L+  +          +       R G    ++   ++  GG       N    Y
Sbjct: 157 FDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERY 216

Query: 61  NDLYILNTETFVWKRATTSGNPPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTD 120
           +            +  T        R +   +  + +I V+GG DGH  +L  V   D D
Sbjct: 217 D---------VETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-FLDSVECYDPD 266

Query: 121 TLTWKELNTSGMVLSPRAGHSTV 143
           T TW E+     + S R+G    
Sbjct: 267 TDTWSEVTR---MTSGRSGVGVA 286
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.98
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.91
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.44
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.52
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 88.82
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 87.33
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 86.3
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 86.15
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 85.4
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.81
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 84.39
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 83.51
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 82.61
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.98  E-value=2.1e-30  Score=250.22  Aligned_cols=238  Identities=16%  Similarity=0.238  Sum_probs=196.7

Q ss_pred             CCcCcEEEEECCCCeEEecccCCCCCCcccceEEEEECCEEEEEecCCCCCCCCCceeeCeEEEEECCCCeEEEeecCCC
Q 011998            2 NPLRDLHILDTSSHTWISPSVRGEGPEAREGHSAALVGKRLFIFGGCGKSSNTNDEVYYNDLYILNTETFVWKRATTSGN   81 (473)
Q Consensus         2 ~~l~dv~~yD~~t~~W~~l~~~~~~P~~R~~hsa~~~~~~Iyv~GG~~~~~~~~~~~~~~dv~~yd~~t~~W~~l~~~g~   81 (473)
                      .+++++++||+.+++|+++   +++|.+|.+|++++++++|||+||....  ......++++|+||+.+++|+.++++  
T Consensus        16 ~~~~~~~~yd~~t~~W~~~---~~~p~~R~~~~~~~~~~~iyv~GG~~~~--~~~~~~~~~~~~yd~~~~~w~~~~~~--   88 (288)
T d1zgka1          16 QSLSYLEAYNPSNGTWLRL---ADLQVPRSGLAGCVVGGLLYAVGGRNNS--PDGNTDSSALDCYNPMTNQWSPCAPM--   88 (288)
T ss_dssp             SBCCCEEEEETTTTEEEEC---CCCSSCCBSCEEEEETTEEEEECCEEEE--TTEEEECCCEEEEETTTTEEEECCCC--
T ss_pred             CCCceEEEEECCCCeEEEC---CCCCCccceeEEEEECCEEEEEeCcccC--CCCccccchhhhcccccccccccccc--
Confidence            3689999999999999998   5889999999999999999999997432  22345678999999999999998655  


Q ss_pred             CCCCceeeEEEEECCEEEEEeCCCCCCCccceEEEEECCCCCEEEeeCCCCCCCCcceeEEEEECCEEEEEecccCCCCc
Q 011998           82 PPSARDSHTCSSWKNKIIVIGGEDGHDYYLSDVHILDTDTLTWKELNTSGMVLSPRAGHSTVAFGKNLFVFGGFTDSQNL  161 (473)
Q Consensus        82 ~P~~R~~hs~~~~~~~IyV~GG~~~~~~~~ndv~~yD~~t~~W~~l~~~g~~p~~R~~hs~~~~~~~LyV~GG~~~~~~~  161 (473)
                       |.+|.+|++++++++||++||..+.. .+++++.||+.++.|...+.   ++.+|..|+++.+.+++|++||.. ....
T Consensus        89 -p~~r~~~~~~~~~~~i~~~gg~~~~~-~~~~~~~~~~~~~~~~~~~~---~~~~r~~~~~~~~~~~~~~~GG~~-~~~~  162 (288)
T d1zgka1          89 -SVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVAP---MLTRRIGVGVAVLNRLLYAVGGFD-GTNR  162 (288)
T ss_dssp             -SSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBC-SSCB
T ss_pred             -cceecceeccccceeeEEecceeccc-ccceeeeeccccCccccccc---cccccccceeeeeeecceEecCcc-cccc
Confidence             89999999999999999999987664 78999999999999998876   888999999999999999999984 4556


Q ss_pred             cccEEEEeCCCCcEEEEeeCCCCCCCcceeeEEEeccccCCEEEEEcccCCCCCccCcEEEEEccccceeeeeccchhhh
Q 011998          162 YDDLYMIDVDSGLWTKVITTGEGPSARFSVAGDCLDPLKGGVLVFIGGCNKSLEALDDMYYLYTGLVNERKLEKLSLRKQ  241 (473)
Q Consensus       162 ~ndv~~yd~~t~~W~~v~~~g~~P~~R~~~~a~~~~~~~~~~l~v~GG~~~~~~~~~dv~~ld~~~~~w~~~~~l~~~~~  241 (473)
                      .++++.||+.+++|.....   .+..+..++++.+    +++|+++||... ...+++.+.|+.....|..+..+     
T Consensus       163 ~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~----~~~i~i~GG~~~-~~~~~~~~~~~~~~~~~~~~~~~-----  229 (288)
T d1zgka1         163 LNSAECYYPERNEWRMITA---MNTIRSGAGVCVL----HNCIYAAGGYDG-QDQLNSVERYDVETETWTFVAPM-----  229 (288)
T ss_dssp             CCCEEEEETTTTEEEECCC---CSSCCBSCEEEEE----TTEEEEECCBCS-SSBCCCEEEEETTTTEEEECCCC-----
T ss_pred             cceEEEeeccccccccccc---cccccccccccce----eeeEEEecCccc-cccccceeeeeecceeeecccCc-----
Confidence            7889999999999998765   4566777777665    789999999876 56789999999999888754321     


Q ss_pred             ccccccccccccCCCcceEEEcceecccCCccEEEECCccc
Q 011998          242 LKLKCQEQNFTPVHDRALVRIDTISDVHQPTPLLSYGEPRR  282 (473)
Q Consensus       242 l~~~~~~~~~~p~~~~~l~~~G~~~~~~~~~~ili~GG~~~  282 (473)
                               +.++..+.++.++        ++|||+||.+.
T Consensus       230 ---------p~~r~~~~~~~~~--------~~l~v~GG~~~  253 (288)
T d1zgka1         230 ---------KHRRSALGITVHQ--------GRIYVLGGYDG  253 (288)
T ss_dssp             ---------SSCCBSCEEEEET--------TEEEEECCBCS
T ss_pred             ---------cCcccceEEEEEC--------CEEEEEecCCC
Confidence                     2333333344333        35999999644
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure