Citrus Sinensis ID: 012054

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLKAERGDDCQVDNDCSQTESPVPCQKSDAVVCSSKETSKDGLSAGSFTRETRTHWSPVSQIPAAVAAEEMETKTQGLLSSEQEKVSSSEKITAIVCGGQVGSLKKRRGKRKRKDCSRDVKEGSVGESDFLGVPDAKPVYRRKENSTPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKDNEYGNKPTTSFLSPSSPLHKPPVKPRTARPGRSKLSLKAANAGNPADKPLSRAKKPSNVDSPSSMESLTLTKKSLSRKVGRTNASQRAESATRGRKRSRAS

ccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHccccccccccccHHHcccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRartvcpytvtpemCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLkaergddcqvdndcsqtespvpcqksdavvcssketskdglsagsftretrthwspvsqipAAVAAEEMETKTQGLlsseqekvssseKITAIVCggqvgslkkrrgkrkrkdcsrdvkegsvgesdflgvpdakpvyrrkenstpvsgqfarssgaddqsgslrkdsIDDIKGVFESVAQNESAFVFRHrldsqkrgrYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFkdneygnkpttsflspssplhkppvkprtarpgrsklslkaanagnpadkplsrakkpsnvdspssmesLTLTKKSLsrkvgrtnaSQRAESatrgrkrsras

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRAlelsensigsLESKLETLKAERGDDCQVDNDCsqtespvpcqksdavvcssketskdglsagsftretrthwspvsQIPAAVAAEEMETKTQGLLsseqekvsssekitaivcggqvgslkkrrgkrkrkdcsrdvkegsvgesdflgvpdakpvyrrkenstpvsgqfarssgaddqsgslrKDSIDDIKGVFESvaqnesafvfrhrldsqkrgrykkmilrhmdvdtirskisshSIMSIKELFRDLLLLANNAVVFyskntrehksaFLLRTIVLKTMRQYFKDNEYGNkpttsflspssplhkppvkprtarpgrsklslkaanagnpadkplsrakkpsnvdspssmesltltkkslsrkvgrtnasqraesatrgrkrsras

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLKAERGDDCQVDNDCSQTESPVPCQKSDAVVCSSKETSKDGLSAGSFTRETRTHWSPVSQIPAAVAAEEMETKTQGLLsseqekvsssekITAIVCGGQVGSLkkrrgkrkrkDCSRDVKEGSVGESDFLGVPDAKPVYRRKENSTPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTirskisshsimsiKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKDNEYGNKpttsflspssplHKPPVKPRTARPGRSKLSLKAANAGNPADKPLSRAKKPSNVDSPSSMESLTLTKKSLSRKVGRTNASQRAESATRGRKRSRAS

****VIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRK*********************************************************************************************************************TAIVCGG***************************************************************************KGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKDN****************************************************************************************************

*****IE*WGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFE**********************************************************************************************************************************************************************************************************IKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLK*************************************************************************************************************

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLKAERG**************************************************PVSQIPAAVA***********************KITAIVCGGQV************************GESDFLGVPDAKPVYRR************************RKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKDNEYGNKPTTSF********************RSKLSLKA**************************************************************

*GAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLKAER*************************************************************************************************************************************************************GSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFK******************************************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGAEVIEVWGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAWFEELRKQRxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGDDCQVDNDCSQTESPVPCQKSDAVVCSSKETSKDGLSAGSFTRETRTHWSPVSQIPAAVAAEEMETKTQGLLSSEQEKVSSSEKITAIVCGGQVGSLKKRRGKRKRKDCSRDVKEGSVGESDFLGVPDAKPVYRRKENSTPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKDNEYGNKPTTSFLSPSSPLHKPPVKPRTARPGRSKLSLKAANAGNPADKPLSRAKKPSNVDSPSSMESLTLTKKSLSRKVGRTNASQRAESATRGRKRSRAS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		472	2.2.26 [Sep-21-2011]
Q9H0E9		1235	Bromodomain-containing pr	no	no	0.262	0.100	0.28	7e-06
Q8R3B7		951	Bromodomain-containing pr	yes	no	0.262	0.130	0.28	7e-06
Q9ULD4		1205	Bromodomain and PHD finge	no	no	0.245	0.096	0.239	0.0004

>sp\|Q9H0E9\|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2	Back alignment and function desciption

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 245 STPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKM 304
           S+P S QF+  S  D ++   +K     I  V+ + A +  A VF   +       Y  +
Sbjct: 689 SSPASSQFSVCS-EDQEAIQAQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSI 747

Query: 305 ILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRTIVLKT 364
           + R MD+ TI+  I +  I S  E  RD++L+  NAV++ S +   +  A  ++  VL+ 
Sbjct: 748 VQRPMDLSTIKKNIENGLIRSTAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQ 807

Query: 365 MRQYF 369
           ++Q+ 
Sbjct: 808 IQQFL 812

May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Homo sapiens (taxid: 9606)

>sp\|Q8R3B7\|BRD8_MOUSE Bromodomain-containing protein 8 OS=Mus musculus GN=Brd8 PE=1 SV=2	Back alignment and function description

>sp\|Q9ULD4\|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		472
255560800		473	conserved hypothetical protein [Ricinus	0.993	0.991	0.609	1e-141
356557662		475	PREDICTED: uncharacterized protein LOC10	0.985	0.978	0.587	1e-136
356546666		475	PREDICTED: uncharacterized protein LOC10	0.987	0.981	0.570	1e-130
224078898		513	bromodomain protein [Populus trichocarpa	0.889	0.818	0.572	1e-119
147787325		489	hypothetical protein VITISV_037732 [Viti	0.942	0.910	0.539	1e-118
356546272		508	PREDICTED: uncharacterized protein LOC10	0.974	0.905	0.448	2e-94
356519542		502	PREDICTED: uncharacterized protein LOC10	0.959	0.902	0.456	1e-91
449457801		470	PREDICTED: uncharacterized protein LOC10	0.957	0.961	0.430	3e-89
42571945		475	bromodomain 4 [Arabidopsis thaliana] gi\|	0.921	0.915	0.466	2e-85
297840437		476	hypothetical protein ARALYDRAFT_893397 [	0.927	0.920	0.466	7e-85

>gi\|255560800\|ref\|XP_002521413.1\| conserved hypothetical protein [Ricinus communis] gi\|223539312\|gb\|EEF40903.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 289/474 (60%), Positives = 346/474 (72%), Gaps = 5/474 (1%)

Query: 1   MGAEVIEV-WGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQ 59
           M   V+ V WGTWEELLLGGAVLRHGTRDW+LV+AELRARTVCP+  TP++CKA YEDLQ
Sbjct: 1   MSTGVVAVRWGTWEELLLGGAVLRHGTRDWDLVSAELRARTVCPFIFTPQVCKAKYEDLQ 60

Query: 60  QRFYGCKAWFEELRKQRMAELKRALELSENSIGSLESKLETLKAERGDDCQVDNDCSQTE 119
           Q + GC A FEELRKQRMAELKRALE SE+SIGSLE+KLETLKA R  D  V  D SQTE
Sbjct: 61  QHYSGCTALFEELRKQRMAELKRALEKSEDSIGSLETKLETLKAARRIDSNVGCDSSQTE 120

Query: 120 SPVPCQKSDAVVCSSKETSKDGLSAGSFTRETRTHWSPVSQIPAAVAAEEMETKTQGLLS 179
           S +  QKSD V  SSKETSK GLSAGSFT+ETRT WSP  Q+PA+V+ E++ETK +   S
Sbjct: 121 SVMRFQKSDGVESSSKETSKGGLSAGSFTQETRTSWSPKCQVPASVSMEDIETKPEVSAS 180

Query: 180 SEQEKVSSSEKITAIVCGGQVGSLKKRRGKRKRKDCSRDVKEGSVGESDFLGVPDAKPVY 239
            +QEKV     +    C GQ GS+++RRGKRKRKDCS+D+KEGSVG+SDF G  D     
Sbjct: 181 PKQEKVLGIGNLAETFCMGQGGSIRRRRGKRKRKDCSKDMKEGSVGDSDFWGSTDVLSAT 240

Query: 240 RRKENSTPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQKRG 299
           R KENST  SGQ  R    +D+S S  KD   DI G+F+S+A+N+ A VFR RLDSQKRG
Sbjct: 241 RCKENSTSTSGQTVRCFVIEDKSRSSSKDEHADIIGIFDSIAENKCATVFRRRLDSQKRG 300

Query: 300 RYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSKNTREHKSAFLLRT 359
           RYKKMIL+HMD+DT+RS+ISSHSI ++KE+FRDLLLLANNA+VFYSK TRE+KSA  LR 
Sbjct: 301 RYKKMILQHMDIDTLRSRISSHSITTLKEVFRDLLLLANNALVFYSKTTREYKSALQLRE 360

Query: 360 IVLKTMRQYFKDNEYGNKPTTSFLSPSSPLHKPPVKPRTARPGRSKLSLKAANAGNPADK 419
           IV K+++Q+ KD  Y +K T + LS +  +  PPVKPR+ARP           AGN   K
Sbjct: 361 IVTKSLQQHLKD--YISKTTITLLSTTPQMLHPPVKPRSARPANRTSLGNVLKAGNTPAK 418

Query: 420 PLSRAKKPSNVDSPSSMESLTLTKKSLS--RKVGRTNASQRAESATRGRKRSRA 471
             + AK  SNV SP S ESLT+ KK     RK GR +A+Q+ E+  +GRKR R 
Sbjct: 419 TANAAKTRSNVQSPHSAESLTMIKKGYGRPRKAGRRSANQQPENLPKGRKRCRG 472

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356557662\|ref\|XP_003547134.1\| PREDICTED: uncharacterized protein LOC100804245 [Glycine max]	Back alignment and taxonomy information

>gi\|356546666\|ref\|XP_003541744.1\| PREDICTED: uncharacterized protein LOC100793951 [Glycine max]	Back alignment and taxonomy information

>gi\|224078898\|ref\|XP_002305671.1\| bromodomain protein [Populus trichocarpa] gi\|222848635\|gb\|EEE86182.1\| bromodomain protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147787325\|emb\|CAN77990.1\| hypothetical protein VITISV_037732 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356546272\|ref\|XP_003541553.1\| PREDICTED: uncharacterized protein LOC100804023 [Glycine max]	Back alignment and taxonomy information

>gi\|356519542\|ref\|XP_003528431.1\| PREDICTED: uncharacterized protein LOC100793085 [Glycine max]	Back alignment and taxonomy information

>gi\|449457801\|ref\|XP_004146636.1\| PREDICTED: uncharacterized protein LOC101217843 [Cucumis sativus] gi\|449488502\|ref\|XP_004158059.1\| PREDICTED: uncharacterized LOC101217843 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|42571945\|ref\|NP_974063.1\| bromodomain 4 [Arabidopsis thaliana] gi\|50897166\|gb\|AAT85722.1\| At1g61215 [Arabidopsis thaliana] gi\|53850535\|gb\|AAU95444.1\| At1g61215 [Arabidopsis thaliana] gi\|332195684\|gb\|AEE33805.1\| bromodomain 4 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297840437\|ref\|XP_002888100.1\| hypothetical protein ARALYDRAFT_893397 [Arabidopsis lyrata subsp. lyrata] gi\|297333941\|gb\|EFH64359.1\| hypothetical protein ARALYDRAFT_893397 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		472
TAIR\|locus:1006230673		475	BRD4 "AT1G61215" [Arabidopsis	0.925	0.92	0.445	4.1e-81
TAIR\|locus:2101477		641	AT3G60110 [Arabidopsis thalian	0.125	0.092	0.457	6.7e-21
TAIR\|locus:2060040		631	AT2G42150 [Arabidopsis thalian	0.209	0.156	0.405	1e-19
TAIR\|locus:2050574		646	AT2G44430 [Arabidopsis thalian	0.735	0.537	0.243	4.6e-16
TAIR\|locus:2095878		632	AT3G57980 [Arabidopsis thalian	0.224	0.167	0.275	6.7e-16
FB\|FBgn0039654		874	Brd8 "Brd8" [Drosophila melano	0.296	0.160	0.255	1.2e-05

TAIR\|locus:1006230673 BRD4 "AT1G61215" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 814 (291.6 bits), Expect = 4.1e-81, P = 4.1e-81
 Identities = 216/485 (44%), Positives = 279/485 (57%)

Query:     9 WGTWEELLLGGAVLRHGTRDWNLVAAELRARTVCPYTVTPEMCKAHYEDLQQRFYGCKAW 68
             WGTWEELLLGGAVLRHGT DW +VA ELR+ ++ P   TPE+CKA Y+DL++R+ GCKAW
Sbjct:    14 WGTWEELLLGGAVLRHGTGDWTVVADELRSHSL-PEIFTPEICKAKYKDLRKRYVGCKAW 72

Query:    69 FEELRKQRMAELKRALELSENSIGSLESKLETLKAERGDDCQVDN-DCSQTESPVPCQKS 127
             FEEL+K+R+AELK AL  SE+SIGSLESKL++LK+E  D+C  +N D S+T S  P  KS
Sbjct:    73 FEELKKKRVAELKAALLKSEDSIGSLESKLQSLKSESNDECHQNNYDSSRTLSLEPSPKS 132

Query:   128 DAV-VCSSKETSKDGLSAGSFTRE--TRTHWSPVSQIPAAVAAEEMETKTQGLLXXXXXX 184
             +    C+SK+TSKD  S GSFT++  T T+WSP ++  A V  E+   KT+ LL      
Sbjct:   133 EGGGECTSKDTSKDLSSVGSFTQQELTTTNWSPEAKSEAPVVIEQ--EKTKDLLHNDIFE 190

Query:   185 XXXXXXITAIVCGGQV-GSLXXXXXXXXXXDCS----RDVKEGS-VGESDFLGVP-DAKP 237
                         GGQV  S+          DCS    ++V E S V ESD      D   
Sbjct:   191 SVYGG-------GGQVLPSMRKKRGKRKRKDCSVSVGKEVMEVSAVEESDLFDTSADIAS 243

Query:   238 VYRRKENSTPVSGQFARSSGADDQSGSLRKDSIDDIKGVFESVAQNESAFVFRHRLDSQK 297
             +YR KE ++  S Q   S G    S +L K+    +  ++ ++AQNE A VFR RLDSQK
Sbjct:   244 IYRSKEAASTSSSQ---SRG---HSLALPKE----LMKIYNTIAQNECALVFRRRLDSQK 293

Query:   298 RGRYKKMILRHMDVDTXXXXXXXXXXXXXKELFRDLLLLANNAVVFYSKNTREHKSAFLL 357
             RGRYKK++ RHMD+DT             KELFRD LL+ANNA +FYSKNTRE+KSA  L
Sbjct:   294 RGRYKKLVRRHMDLDTVQSRINGCSISSAKELFRDFLLVANNAAIFYSKNTREYKSAVGL 353

Query:   358 RTIVLKTMRQYF-KDNEYGNKXXXXXXXXXXXXHKPPVKPRTARPGRSKLSLKAANAG-N 415
             R IV K++R Y  +D+                 H+    P      R+ L+ K    G +
Sbjct:   354 RDIVTKSLRHYLTEDHPPHRSSITAGSTKVVVLHQKSTSPSV----RTSLAAKKPRTGAH 409

Query:   416 PAD-------KPLSRAKKPSNVDSP-SSMESLTLTKKSLS-RKVGRTNASQRAES-ATRG 465
             P         K  SR  K S  D P S+++S    KK  + RK GR  A++  ES A  G
Sbjct:   410 PLKTVVQDMAKTSSRGNKRSVTDLPVSAVKSSAAGKKGTAVRKDGR-QANRGLESPALMG 468

Query:   466 RKRSR 470
             RKR+R
Sbjct:   469 RKRNR 473

GO:0003677 "DNA binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2101477 AT3G60110 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2060040 AT2G42150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2050574 AT2G44430 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2095878 AT3G57980 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

FB\|FBgn0039654 Brd8 "Brd8" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		472
smart00297		107	smart00297, BROMO, bromo domain	5e-15
cd04369		99	cd04369, Bromodomain, Bromodomain	2e-13
pfam00439		84	pfam00439, Bromodomain, Bromodomain	4e-12
cd05507		104	cd05507, Bromo_brd8_like, Bromodomain, brd8_like s	3e-11
cd05511		112	cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf	7e-06
cd05513		98	cd05513, Bromo_brd7_like, Bromodomain, brd7_like s	3e-05
cd05515		105	cd05515, Bromo_polybromo_V, Bromodomain, polybromo	3e-05
cd05512		98	cd05512, Bromo_brd1_like, Bromodomain; brd1_like s	4e-05
cd05492		109	cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like	1e-04
pfam00249		47	pfam00249, Myb_DNA-binding, Myb-like DNA-binding d	2e-04
cd05516		107	cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su	6e-04

>gnl\|CDD\|197636 smart00297, BROMO, bromo domain	Back alignment and domain information

 Score = 70.4 bits (173), Expect = 5e-15
 Identities = 20/93 (21%), Positives = 44/93 (47%)

Query: 276 VFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLL 335
           V + +  +  ++ F   +  ++   Y  +I + MD+ TI+ K+ +    S++E   D  L
Sbjct: 15  VLDKLDSHPLSWPFLKPVSRKEAPDYYDIIKKPMDLKTIKKKLENGKYSSVEEFVADFNL 74

Query: 336 LANNAVVFYSKNTREHKSAFLLRTIVLKTMRQY 368
           + +NA  +   ++  +K A  L     K +R+ 
Sbjct: 75  MFSNARTYNGPDSEVYKDAKKLEKFFEKKLREL 107

Length = 107

>gnl\|CDD\|99922 cd04369, Bromodomain, Bromodomain	Back alignment and domain information

>gnl\|CDD\|215921 pfam00439, Bromodomain, Bromodomain	Back alignment and domain information

>gnl\|CDD\|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup	Back alignment and domain information

>gnl\|CDD\|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily	Back alignment and domain information

>gnl\|CDD\|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup	Back alignment and domain information

>gnl\|CDD\|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V	Back alignment and domain information

>gnl\|CDD\|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily	Back alignment and domain information

>gnl\|CDD\|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family	Back alignment and domain information

>gnl\|CDD\|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain	Back alignment and domain information

>gnl\|CDD\|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		472
cd05507		104	Bromo_brd8_like Bromodomain, brd8_like subgroup. I	99.95
cd05496		119	Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub	99.94
cd05505		97	Bromo_WSTF_like Bromodomain; Williams syndrome tra	99.94
cd05497		107	Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily	99.94
cd05495		108	Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb	99.94
KOG1474		640	consensus Transcription initiation factor TFIID, s	99.93
cd05504		115	Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li	99.93
cd05502		109	Bromo_tif1_like Bromodomain; tif1_like subfamily.	99.93
cd05503		97	Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s	99.93
cd05508		99	Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC	99.92
cd05509		101	Bromo_gcn5_like Bromodomain; Gcn5_like subfamily.	99.92
cd05528		112	Bromo_AAA Bromodomain; sub-family co-occurring wit	99.92
cd05510		112	Bromo_SPT7_like Bromodomain; SPT7_like subfamily.	99.92
cd05513		98	Bromo_brd7_like Bromodomain, brd7_like subgroup. T	99.92
cd05506		99	Bromo_plant1 Bromodomain, uncharacterized subfamil	99.92
cd05512		98	Bromo_brd1_like Bromodomain; brd1_like subfamily.	99.91
cd05498		102	Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil	99.91
cd05499		102	Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam	99.91
cd05516		107	Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s	99.91
cd05500		103	Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami	99.91
cd05511		112	Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum	99.91
cd05501		102	Bromo_SP100C_like Bromodomain, SP100C_like subfami	99.9
cd05524		113	Bromo_polybromo_I Bromodomain, polybromo repeat I.	99.9
cd05520		103	Bromo_polybromo_III Bromodomain, polybromo repeat	99.89
cd05515		105	Bromo_polybromo_V Bromodomain, polybromo repeat V.	99.89
smart00297		107	BROMO bromo domain.	99.89
cd05519		103	Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci	99.89
cd05529		128	Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like	99.89
cd05525		106	Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1	99.88
cd05518		103	Bromo_polybromo_IV Bromodomain, polybromo repeat I	99.88
cd05517		103	Bromo_polybromo_II Bromodomain, polybromo repeat I	99.87
PF00439		84	Bromodomain: Bromodomain; InterPro: IPR001487 Brom	99.86
cd04369		99	Bromodomain Bromodomain. Bromodomains are found in	99.86
cd05492		109	Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family	99.86
cd05522		104	Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l	99.85
cd05521		106	Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik	99.84
cd05526		110	Bromo_polybromo_VI Bromodomain, polybromo repeat V	99.71
KOG1245		1404	consensus Chromatin remodeling complex WSTF-ISWI,	99.7
COG5076		371	Transcription factor involved in chromatin remodel	99.69
KOG1472		720	consensus Histone acetyltransferase SAGA/ADA, cata	99.51
cd05494		114	Bromodomain_1 Bromodomain; uncharacterized subfami	99.19
KOG0955		1051	consensus PHD finger protein BR140/LIN-49 [General	99.17
KOG0008		1563	consensus Transcription initiation factor TFIID, s	99.04
cd05491		119	Bromo_TBP7_like Bromodomain; TBP7_like subfamily,	98.98
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	98.75
KOG0008		1563	consensus Transcription initiation factor TFIID, s	98.71
KOG1827		629	consensus Chromatin remodeling complex RSC, subuni	98.7
KOG1474		640	consensus Transcription initiation factor TFIID, s	98.67
KOG1472		720	consensus Histone acetyltransferase SAGA/ADA, cata	98.63
KOG1828		418	consensus IRF-2-binding protein CELTIX-1, contains	98.54
KOG1828		418	consensus IRF-2-binding protein CELTIX-1, contains	98.29
PF00249		48	Myb_DNA-binding: Myb-like DNA-binding domain; Inte	98.07
smart00717		49	SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi	97.72
COG5076		371	Transcription factor involved in chromatin remodel	97.57
cd00167		45	SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do	97.39
cd05493		131	Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL-	96.94
PF13921		60	Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB:	96.85
TIGR02894		161	DNA_bind_RsfA transcription factor, RsfA family. I	95.38
PLN03212		249	Transcription repressor MYB5; Provisional	94.54
PF13837		90	Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain;	94.17
PLN03091		459	hypothetical protein; Provisional	94.15
KOG0049		939	consensus Transcription factor, Myb superfamily [T	94.11
PLN03212		249	Transcription repressor MYB5; Provisional	92.47
PLN03091		459	hypothetical protein; Provisional	90.99
KOG0457		438	consensus Histone acetyltransferase complex SAGA/A	90.86
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	89.81
COG5259		531	RSC8 RSC chromatin remodeling complex subunit RSC8	89.71
KOG0048		238	consensus Transcription factor, Myb superfamily [T	88.89
KOG0644		1113	consensus Uncharacterized conserved protein, conta	88.49
PRK13923		170	putative spore coat protein regulator protein YlbO	87.05
COG5114		432	Histone acetyltransferase complex SAGA/ADA, subuni	82.98
KOG1279		506	consensus Chromatin remodeling factor subunit and	82.0

>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup	Back alignment and domain information

Probab=99.95  E-value=4.7e-28  Score=208.90  Aligned_cols=102  Identities=25%  Similarity=0.359  Sum_probs=99.2

Q ss_pred             cchHHHHHHHHHHHhcCcccccccccCCccccchhHHhhcCCCCHHHHHHhhhcCCCCCHHHHHHHHHHHHHhhhccCCC
Q 012054          267 KDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSK  346 (472)
Q Consensus       267 ~~~~k~L~~IL~~I~s~k~A~~F~~PVd~qe~PdY~~IIK~PMDLsTIKrKLesg~Y~S~~EF~rDL~LMf~NA~~YN~p  346 (472)
                      ++|.+.|+.||+.|..|+.+++|..||+.+.+|+|+++|++||||+||++||++|.|.++.||.+||.|||+||++||++
T Consensus         2 ~~~~~~~~~il~~l~~~~~a~~F~~pV~~~~~p~Y~~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~D~~li~~Na~~yN~~   81 (104)
T cd05507           2 RAWKKAILLVYRTLASHRYASVFLKPVTEDIAPGYHSVVYRPMDLSTIKKNIENGTIRSTAEFQRDVLLMFQNAIMYNSS   81 (104)
T ss_pred             hHHHHHHHHHHHHHHcCCCCHhhcCCCCccccCCHHHHhCCCcCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHCCC
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHH
Q 012054          347 NTREHKSAFLLRTIVLKTMRQY  368 (472)
Q Consensus       347 ~S~i~k~A~~L~~lf~k~m~k~  368 (472)
                      ++.+|.+|..|++.|.++|.+.
T Consensus        82 ~s~v~~~A~~l~~~~~~~~~~~  103 (104)
T cd05507          82 DHDVYLMAVEMQREVMSQIQQL  103 (104)
T ss_pred             CCHHHHHHHHHHHHHHHHhhcc
Confidence            9999999999999999998764

In mammals, brd8 (bromodomain containing 8) interacts with the thyroid hormone receptor in a ligand-dependent fashion and enhances thyroid hormone-dependent activation from thyroid response elements. Brd8 is thought to be a nuclear receptor coactivator. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.

>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily	Back alignment and domain information

>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like)	Back alignment and domain information

>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I	Back alignment and domain information

>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily	Back alignment and domain information

>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription]	Back alignment and domain information

>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily	Back alignment and domain information

>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily	Back alignment and domain information

>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily	Back alignment and domain information

>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily	Back alignment and domain information

>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily	Back alignment and domain information

>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains	Back alignment and domain information

>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily	Back alignment and domain information

>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup	Back alignment and domain information

>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants	Back alignment and domain information

>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily	Back alignment and domain information

>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II	Back alignment and domain information

>cd05499 Bromo_BDF1_2_II Bromodomain	Back alignment and domain information

>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals	Back alignment and domain information

>cd05500 Bromo_BDF1_2_I Bromodomain	Back alignment and domain information

>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily	Back alignment and domain information

>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily	Back alignment and domain information

>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I	Back alignment and domain information

>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III	Back alignment and domain information

>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V	Back alignment and domain information

>smart00297 BROMO bromo domain	Back alignment and domain information

>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi	Back alignment and domain information

>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily	Back alignment and domain information

>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family	Back alignment and domain information

>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV	Back alignment and domain information

>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II	Back alignment and domain information

>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins []	Back alignment and domain information

>cd04369 Bromodomain Bromodomain	Back alignment and domain information

>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family	Back alignment and domain information

>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi	Back alignment and domain information

>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi	Back alignment and domain information

>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI	Back alignment and domain information

>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics]	Back alignment and domain information

>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription]	Back alignment and domain information

>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily	Back alignment and domain information

>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only]	Back alignment and domain information

>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription]	Back alignment and domain information

>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription]	Back alignment and domain information

>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription]	Back alignment and domain information

>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription]	Back alignment and domain information

>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription]	Back alignment and domain information

>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins	Back alignment and domain information

>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains	Back alignment and domain information

>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription]	Back alignment and domain information

>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains	Back alignment and domain information

>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins	Back alignment and domain information

>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A	Back alignment and domain information

>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family	Back alignment and domain information

>PLN03212 Transcription repressor MYB5; Provisional	Back alignment and domain information

>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A	Back alignment and domain information

>PLN03091 hypothetical protein; Provisional	Back alignment and domain information

>KOG0049 consensus Transcription factor, Myb superfamily [Transcription]	Back alignment and domain information

>PLN03212 Transcription repressor MYB5; Provisional	Back alignment and domain information

>PLN03091 hypothetical protein; Provisional	Back alignment and domain information

>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription]	Back alignment and domain information

>KOG0048 consensus Transcription factor, Myb superfamily [Transcription]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>PRK13923 putative spore coat protein regulator protein YlbO; Provisional	Back alignment and domain information

>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		472
3rcw_A		135	Bromodomain-containing protein 1; transcription, s	6e-10
2d9e_A		121	Peregrin; four-helix bundle, transcription activat	2e-09
2i7k_A		117	Bromodomain-containing protein 7; helix, LEFT-hand	3e-09
3iu5_A		116	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	4e-09
3nxb_A		116	CAT eye syndrome critical region protein 2; struct	4e-09
3d7c_A		112	General control of amino acid synthesis protein 5;	2e-08
3mqm_A		126	Probable histone-lysine N-methyltransferase ASH1L;	3e-08
2grc_A		129	Probable global transcription activator SNF2L4; br	3e-08
3k2j_A		130	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	6e-08
3g0l_A		117	Hwalp4, bromodomain adjacent to zinc finger domain	6e-08
3ljw_A		120	Protein polybromo-1; alpha helix, alternative spli	7e-08
1e6i_A		121	Transcriptional activator GCN5; gene regulation, b	2e-07
2ri7_A		174	Nucleosome-remodeling factor subunit BPTF; zinc fi	2e-07
3mb4_A		124	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	2e-07
3hme_A		123	Bromodomain-containing protein 9; BRD9, bromodomai	2e-07
3uv4_A		158	Second bromodomain of human transcription initiat	2e-07
3iu6_A		147	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	3e-07
3fkm_X		166	Signaling protein; bromodomain, malaria, structura	4e-07
2dat_A		123	Possible global transcription activator SNF2L2; br	4e-07
3tlp_A		150	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	4e-07
3uv5_A		265	Transcription initiation factor TFIID subunit 1; t	4e-07
3uv5_A		265	Transcription initiation factor TFIID subunit 1; t	8e-06
3aad_A		292	Transcription initiation factor TFIID subunit 1; p	1e-06
3aad_A		292	Transcription initiation factor TFIID subunit 1; p	2e-06
2oss_A		127	HUNK1 protein, bromodomain-containing protein 4; B	5e-06
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	7e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-04
2r0y_A		311	Chromatin structure-remodeling complex protein RSC	1e-05
2r10_A		361	Chromatin structure-remodeling complex protein RSC	2e-05
3dai_A		130	ATPase family AAA domain-containing protein 2; anc	2e-05
3lqh_A		183	Histone-lysine N-methyltransferase MLL; PHD finger	4e-05
4alg_A		154	Bromodomain-containing protein 2; signaling protei	4e-05
2yyn_A		135	Transcription intermediary factor 1-alpha; bromo d	2e-04
3q2e_A		123	Bromodomain and WD repeat-containing protein 1; st	2e-04
1x41_A		60	Transcriptional adaptor 2-like, isoform B; transcr	4e-04
2dkw_A		131	Hypothetical protein KIAA1240; bromodomain-like, f	4e-04
3p1f_A		119	CREB-binding protein; structural genomics consorti	6e-04
2elk_A		58	SPCC24B10.08C protein; hypothetical protein, struc	7e-04

>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135	Back alignment and structure

 Score = 56.3 bits (136), Expect = 6e-10
 Identities = 22/117 (18%), Positives = 53/117 (45%), Gaps = 1/117 (0%)

Query: 273 IKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRD 332
           ++ V + +   + A +F   +  ++   Y   I   MD  T+R ++ +    ++ E   D
Sbjct: 18  LRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEED 77

Query: 333 LLLLANNAVVFYSKNTREHKSAFLLRTIVLKTMRQYFKD-NEYGNKPTTSFLSPSSP 388
             L+ +N + + +++T  +++A  LR      +RQ  ++ +  G +  +    P  P
Sbjct: 78  FDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERP 134

PyMOL of 3rcw

>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121	Back alignment and structure

>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117	Back alignment and structure

>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116	Back alignment and structure

>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116	Back alignment and structure

>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112	Back alignment and structure

>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126	Back alignment and structure

>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129	Back alignment and structure

>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130	Back alignment and structure

>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117	Back alignment and structure

>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120	Back alignment and structure

>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121	Back alignment and structure

>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174	Back alignment and structure

>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124	Back alignment and structure

>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123	Back alignment and structure

>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158	Back alignment and structure

>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147	Back alignment and structure

>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166	Back alignment and structure

>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123	Back alignment and structure

>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150	Back alignment and structure

>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265	Back alignment and structure

>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265	Back alignment and structure

>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292	Back alignment and structure

>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292	Back alignment and structure

>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311	Back alignment and structure

>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361	Back alignment and structure

>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130	Back alignment and structure

>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183	Back alignment and structure

>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154	Back alignment and structure

>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135	Back alignment and structure

>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123	Back alignment and structure

>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60	Back alignment and structure

>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131	Back alignment and structure

>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119	Back alignment and structure

>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		472
3g0l_A		117	Hwalp4, bromodomain adjacent to zinc finger domain	99.95
3d7c_A		112	General control of amino acid synthesis protein 5;	99.94
3mb3_A		135	PH-interacting protein; PHIP, pleckstrin homology	99.94
3q2e_A		123	Bromodomain and WD repeat-containing protein 1; st	99.94
1e6i_A		121	Transcriptional activator GCN5; gene regulation, b	99.94
2dat_A		123	Possible global transcription activator SNF2L2; br	99.94
3nxb_A		116	CAT eye syndrome critical region protein 2; struct	99.94
2yyn_A		135	Transcription intermediary factor 1-alpha; bromo d	99.94
2d9e_A		121	Peregrin; four-helix bundle, transcription activat	99.94
2i7k_A		117	Bromodomain-containing protein 7; helix, LEFT-hand	99.94
3iu5_A		116	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	99.93
3mb4_A		124	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	99.93
2oss_A		127	HUNK1 protein, bromodomain-containing protein 4; B	99.93
3p1f_A		119	CREB-binding protein; structural genomics consorti	99.93
2ouo_A		130	HUNK1 protein, bromodomain-containing protein 4; B	99.93
2grc_A		129	Probable global transcription activator SNF2L4; br	99.93
3jvl_A		120	Bromodomain-containing protein 4; alpha helical, N	99.93
3hme_A		123	Bromodomain-containing protein 9; BRD9, bromodomai	99.93
3ljw_A		120	Protein polybromo-1; alpha helix, alternative spli	99.93
3mqm_A		126	Probable histone-lysine N-methyltransferase ASH1L;	99.93
3rcw_A		135	Bromodomain-containing protein 1; transcription, s	99.93
3fkm_X		166	Signaling protein; bromodomain, malaria, structura	99.93
4alg_A		154	Bromodomain-containing protein 2; signaling protei	99.93
3k2j_A		130	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	99.92
2ri7_A		174	Nucleosome-remodeling factor subunit BPTF; zinc fi	99.92
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	99.91
3tlp_A		150	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	99.91
3uv4_A		158	Second bromodomain of human transcription initiat	99.91
3dai_A		130	ATPase family AAA domain-containing protein 2; anc	99.91
3u5n_A		207	E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b	99.9
2dkw_A		131	Hypothetical protein KIAA1240; bromodomain-like, f	99.89
2ro1_A		189	Transcription intermediary factor 1-beta; KAP, TIF	99.89
3uv5_A		265	Transcription initiation factor TFIID subunit 1; t	99.88
3uv5_A		265	Transcription initiation factor TFIID subunit 1; t	99.87
3aad_A		292	Transcription initiation factor TFIID subunit 1; p	99.86
3aad_A		292	Transcription initiation factor TFIID subunit 1; p	99.86
2r0y_A		311	Chromatin structure-remodeling complex protein RSC	99.85
2r10_A		361	Chromatin structure-remodeling complex protein RSC	99.85
2r10_A		361	Chromatin structure-remodeling complex protein RSC	99.79
2r0y_A		311	Chromatin structure-remodeling complex protein RSC	99.79
3iu6_A		147	Protein polybromo-1; PB1, polybromo 1 isoform 1, B	99.7
3lqh_A		183	Histone-lysine N-methyltransferase MLL; PHD finger	99.56
2elk_A		58	SPCC24B10.08C protein; hypothetical protein, struc	98.04
1x41_A		60	Transcriptional adaptor 2-like, isoform B; transcr	97.87
1w0t_A		53	Telomeric repeat binding factor 1; telomere, DNA-b	97.85
3sjm_A		64	Telomeric repeat-binding factor 2; human telomeric	97.76
1guu_A		52	C-MYB, MYB proto-oncogene protein; transcription,	97.73
2d9a_A		60	B-MYB, MYB-related protein B; DNA binding, structu	97.58
2yus_A		79	SWI/SNF-related matrix-associated actin- dependent	97.54
1gvd_A		52	MYB proto-oncogene protein; transcription, transcr	97.54
1ity_A		69	TRF1; helix-turn-helix, telomeres, DNA binding, MY	97.51
2dim_A		70	Cell division cycle 5-like protein; MYB_DNA-bindin	97.42
2cu7_A		72	KIAA1915 protein; nuclear protein, SANT domain, DN	97.34
2din_A		66	Cell division cycle 5-like protein; MYB_DNA-bindin	97.11
2yum_A		75	ZZZ3 protein, zinc finger ZZ-type-containing prote	97.06
2llk_A		73	Cyclin-D-binding MYB-like transcription factor 1;	97.05
2ckx_A		83	NGTRF1, telomere binding protein TBP1; nuclear pro	97.0
2k9n_A		107	MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind	97.0
2k9n_A		107	MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind	96.97
2ltp_A		89	Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s	95.9
3zqc_A		131	MYB3; transcription-DNA complex, DNA-binding prote	96.8
2cqr_A		73	RSGI RUH-043, DNAJ homolog subfamily C member 1; m	96.77
1gv2_A		105	C-MYB, MYB proto-oncogene protein; transcription,	96.76
1h89_C		159	C-MYB, MYB proto-oncogene protein; transcription/D	96.76
3osg_A		126	MYB21; transcription-DNA complex, MYB2, R2R3 domai	96.63
3osg_A		126	MYB21; transcription-DNA complex, MYB2, R2R3 domai	96.54
1gv2_A		105	C-MYB, MYB proto-oncogene protein; transcription,	96.53
2roh_A		122	RTBP1, telomere binding protein-1; plant, nucleus,	96.41
2cjj_A		93	Radialis; plant development, DNA-binding protein,	96.41
1h8a_C		128	AMV V-MYB, MYB transforming protein; transcription	96.38
2juh_A		121	Telomere binding protein TBP1; helix, nucleus, nuc	96.2
2aje_A		105	Telomere repeat-binding protein; DNA-binding, Trp,	96.18
2iw5_B		235	Protein corest, REST corepressor 1; oxidoreductase	95.98
1h8a_C		128	AMV V-MYB, MYB transforming protein; transcription	95.84
2eqr_A		61	N-COR1, N-COR, nuclear receptor corepressor 1; SAN	95.81
1h89_C		159	C-MYB, MYB proto-oncogene protein; transcription/D	95.61
1wgx_A		73	KIAA1903 protein; MYB DNA-binding domain, human cD	95.52
2cqq_A		72	RSGI RUH-037, DNAJ homolog subfamily C member 1; m	95.41
3zqc_A		131	MYB3; transcription-DNA complex, DNA-binding prote	95.39
2ebi_A		86	DNA binding protein GT-1; DNA-binding domain, phos	94.34
2xag_B		482	REST corepressor 1; amine oxidase, chromatin regul	89.56
1ign_A		246	Protein (RAP1); RAP1,yeast,telomeres,homoeodomain,	87.49
2yqk_A		63	Arginine-glutamic acid dipeptide repeats protein;	83.49
4b4c_A		211	Chromodomain-helicase-DNA-binding protein 1; chrom	81.53

>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A	Back alignment and structure

Probab=99.95  E-value=3.6e-27  Score=204.69  Aligned_cols=105  Identities=22%  Similarity=0.289  Sum_probs=100.7

Q ss_pred             cchHHHHHHHHHHHhcCcccccccccCCccccchhHHhhcCCCCHHHHHHhhhcCCCCCHHHHHHHHHHHHHhhhccCCC
Q 012054          267 KDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSK  346 (472)
Q Consensus       267 ~~~~k~L~~IL~~I~s~k~A~~F~~PVd~qe~PdY~~IIK~PMDLsTIKrKLesg~Y~S~~EF~rDL~LMf~NA~~YN~p  346 (472)
                      ....+.|..||+.|..++.+++|..||+...+|+||++|++||||+||++||++|.|.++++|.+||.|||+||+.||++
T Consensus        12 ~~~~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~~   91 (117)
T 3g0l_A           12 SKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNED   91 (117)
T ss_dssp             TTHHHHHHHHHHHHHTSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCS
T ss_pred             HHHHHHHHHHHHHHHhCCCchhhcCcCChhhcCChHHHcCCCCCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCCC
Confidence            34678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcc
Q 012054          347 NTREHKSAFLLRTIVLKTMRQYFKD  371 (472)
Q Consensus       347 ~S~i~k~A~~L~~lf~k~m~k~l~~  371 (472)
                      +|.+|.+|..|+++|.+.|.+++..
T Consensus        92 ~s~~~~~A~~L~~~f~~~~~~~~~~  116 (117)
T 3g0l_A           92 DSDIGRAGHNMRKYFEKKWTDTFKV  116 (117)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHHHHC-
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHcc
Confidence            9999999999999999999998754

PyMOL of 3g0l

>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A	Back alignment and structure

>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens}	Back alignment and structure

>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens}	Back alignment and structure

>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1	Back alignment and structure

>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0	Back alignment and structure

>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens}	Back alignment and structure

>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens}	Back alignment and structure

>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens}	Back alignment and structure

>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A	Back alignment and structure

>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ...	Back alignment and structure

>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A	Back alignment and structure

>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A*	Back alignment and structure

>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A	Back alignment and structure

>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A*	Back alignment and structure

>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens}	Back alignment and structure

>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A	Back alignment and structure

>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens}	Back alignment and structure

>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens}	Back alignment and structure

>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7}	Back alignment and structure

>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A	Back alignment and structure

>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens}	Back alignment and structure

>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A*	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A	Back alignment and structure

>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens}	Back alignment and structure

>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A	Back alignment and structure

>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A	Back alignment and structure

>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A*	Back alignment and structure

>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens}	Back alignment and structure

>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A	Back alignment and structure

>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A	Back alignment and structure

>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens}	Back alignment and structure

>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens}	Back alignment and structure

>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A	Back alignment and structure

>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A*	Back alignment and structure

>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A*	Back alignment and structure

>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A	Back alignment and structure

>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens}	Back alignment and structure

>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A	Back alignment and structure

>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1	Back alignment and structure

>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A	Back alignment and structure

>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A	Back alignment and structure

>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A	Back alignment and structure

>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens}	Back alignment and structure

>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A	Back alignment and structure

>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A	Back alignment and structure

>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3	Back alignment and structure

>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens}	Back alignment and structure

>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A	Back alignment and structure

>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A	Back alignment and structure

>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A	Back alignment and structure

>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens}	Back alignment and structure

>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis}	Back alignment and structure

>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3	Back alignment and structure

>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A	Back alignment and structure

>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C	Back alignment and structure

>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A	Back alignment and structure

>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A	Back alignment and structure

>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A	Back alignment and structure

>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa}	Back alignment and structure

>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3	Back alignment and structure

>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3	Back alignment and structure

>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa}	Back alignment and structure

>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3	Back alignment and structure

>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B*	Back alignment and structure

>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3	Back alignment and structure

>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C	Back alignment and structure

>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3	Back alignment and structure

>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3	Back alignment and structure

>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis}	Back alignment and structure

>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A*	Back alignment and structure

>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B*	Back alignment and structure

>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A	Back alignment and structure

>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		472
d3dwya1		114	a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {	4e-11

>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure


class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: CREB-binding protein, CBP
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.0 bits (140), Expect = 4e-11
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 282 QNESAFVFRHRLDSQKRG--RYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANN 339
           Q+  +  FR  +D Q  G   Y  ++   MD+ TI+ K+ +       +   D+ L+ NN
Sbjct: 21  QDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNN 80

Query: 340 AVVFYSKNTREHKSAFLLRTIVLKTMRQ 367
           A ++  K +R +K    L  +  + +  
Sbjct: 81  AWLYNRKTSRVYKFCSKLAEVFEQEIDP 108

PyMOL of d3dwya1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		472
d1e6ia_		111	GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta	99.94
d3d7ca1		102	GCN5 {Human (Homo sapiens) [TaxId: 9606]}	99.94
d1eqfa1		139	TAFII250 double bromodomain module {Human (Homo sa	99.93
d1wuma1		118	P300/CAF histone acetyltransferase bromodomain {Hu	99.93
d3dwya1		114	CREB-binding protein, CBP {Human (Homo sapiens) [T	99.92
d1eqfa2		128	TAFII250 double bromodomain module {Human (Homo sa	99.92
d1x41a1		47	Transcriptional adaptor 2-like, TADA2L, isoform b	98.27
d1w0ua_		55	Telomeric repeat binding factor 2, TRF2 {Human (Ho	97.82
d1gvda_		52	c-Myb, DNA-binding domain {Mouse (Mus musculus) [T	97.8
d1w0ta_		52	DNA-binding domain of human telomeric protein, hTR	97.8
d1guua_		50	c-Myb, DNA-binding domain {Mouse (Mus musculus) [T	97.68
d2cjja1		63	Radialis {Garden snapdragon (Antirrhinum majus) [T	97.61
d2cu7a1		65	MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960	97.49
d2iw5b1		65	REST corepressor 1, CoREST {Human (Homo sapiens) [	97.48
d2cqra1		60	DnaJ homolog subfamily C member 1 {Human (Homo sap	97.31
d1gv2a2		47	c-Myb, DNA-binding domain {Mouse (Mus musculus) [T	97.15
d2ckxa1		83	Telomere binding protein TBP1 {Tobacco (Nicotiana	97.12
d1xc5a1		68	Nuclear receptor corepressor 2 {Human (Homo sapien	96.84
d1ug2a_		95	2610100b20rik gene product {Mouse (Mus musculus) [	95.83
d1igna1		86	DNA-binding domain of rap1 {Baker's yeast (Sacchar	95.06
d2crga1		57	Metastasis associated protein MTA3 {Mouse (Mus mus	93.3
d2cqqa1		59	DnaJ homolog subfamily C member 1 {Human (Homo sap	91.96

>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.94  E-value=2.8e-27  Score=202.22  Aligned_cols=105  Identities=18%  Similarity=0.287  Sum_probs=99.8

Q ss_pred             cchHHHHHHHHHHHhcCcccccccccCCccccchhHHhhcCCCCHHHHHHhhhcCCCCCHHHHHHHHHHHHHhhhccCCC
Q 012054          267 KDSIDDIKGVFESVAQNESAFVFRHRLDSQKRGRYKKMILRHMDVDTIRSKISSHSIMSIKELFRDLLLLANNAVVFYSK  346 (472)
Q Consensus       267 ~~~~k~L~~IL~~I~s~k~A~~F~~PVd~qe~PdY~~IIK~PMDLsTIKrKLesg~Y~S~~EF~rDL~LMf~NA~~YN~p  346 (472)
                      .++.+.|..||+.|.+|+++++|..||+.+.+|+|+++|++||||+||++||++|.|.|+.+|..||.|||.||+.||++
T Consensus         2 ~p~~~~l~~il~~l~~~~~a~pF~~pvd~~~~pdY~~vI~~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~   81 (111)
T d1e6ia_           2 GPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGE   81 (111)
T ss_dssp             CTTHHHHHHHHHHHHHSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHSCT
T ss_pred             ChHHHHHHHHHHHHHhCCCChhhcCCCCchhCcCHHHHcCCchhHHHHHHHHHccccchHHHHHHHHHHHHHHHHHHCCC
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhccC
Q 012054          347 NTREHKSAFLLRTIVLKTMRQYFKDN  372 (472)
Q Consensus       347 ~S~i~k~A~~L~~lf~k~m~k~l~~~  372 (472)
                      +|.++.+|..|+++|.++|.+ ++++
T Consensus        82 ~s~i~~~A~~l~~~f~~~~~~-ipe~  106 (111)
T d1e6ia_          82 NTSYYKYANRLEKFFNNKVKE-IPEY  106 (111)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHT-SGGG
T ss_pred             CCHHHHHHHHHHHHHHHHHHH-hhcc
Confidence            999999999999999999976 4543

PyMOL of d1e6ia_

>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}	Back information, alignment and structure

>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure