Citrus Sinensis ID: 012082

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MTVLLSKEKHSPSSAFVETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
ccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEEcccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHcccccccccccccc
ccEEEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccHccHHHHHHHHccccccccccHHHHccHHHHHHHccccccccccccccHHHHEEcccccccccccHHccccHHHHHccccccccccccHHHcccccccccccHHHHHHHHHHHHHcccccccccccHHHHccccccEEEccccccccccHHHHHcccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHHccccEEEccccccccccHHHHccccccEEEccccccccccccHHHHcHccccEEEccccccccccHHHHHHccccEEEccccc
mtvllskekhspssafVETVEEITRLYrslpprpsiEQVEAAMSVLQTVDTEEQTKLDeitkqekprdvSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRasglvsgdnQMEKVAAFADsggkiekecvitdetlvktredgeikkDGLKDLVKSASKKgsffigeenTEKLSLMKMAAVIENSAKTGAVVLDLRGKltdqiewlpvsigklkdvtelnlsenrimalpssiagiKTLKKLdihsnqlinlpdsfgdliNLIDLDLHANRLKTLPATFGNLINlmnldlgsnefthlpdtigcltslktlnvetneledlpytigncSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRikglpttignltklkeLDVSFNELESITENLCFAVSLKklnvgnnfadlralprsignlemleqldisddqirILPDSFRLLSKLRVFRAMRLL
mtvllskekhspssafVETVEEITRLYRSLPPRPSIEQVEAAMSVLqtvdteeqtkldeitkqekprdvsEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRAsglvsgdnqMEKVAAfadsggkiekecvitdetlvktredgeikkdglkdlvksaskkgsffigeenteKLSLMKMAAVIENSAKTGAVVLDLRGKLTdqiewlpvsigklkdvtelNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
MTVLLSKEKHSPSSAFVETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
************************************************************************LFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVK************************FFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRA****
******************TVEEITRLYRSLPPRPSIEQVEAAMSVLQT*******************DVSEDLFSVLQQF***************ASHLVEVDKLYGIFDELVRRASGLVSGDNQ***********GKIEK*CVITD********DGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
****************VETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
*TVLLSK*KHSPSSAFVETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAM***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVLLSKEKHSPSSAFVETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIGEENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMRLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query471 2.2.26 [Sep-21-2011]
Q9BTT6 524 Leucine-rich repeat-conta yes no 0.537 0.482 0.380 1e-32
O61967 699 Protein lap1 OS=Caenorhab yes no 0.403 0.271 0.408 3e-32
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.522 0.132 0.370 9e-32
Q80VQ1 524 Leucine-rich repeat-conta yes no 0.537 0.482 0.384 1e-31
Q80TE7 1490 Leucine-rich repeat-conta no no 0.518 0.163 0.325 2e-31
P70587 1490 Leucine-rich repeat-conta yes no 0.518 0.163 0.325 2e-31
Q9V780 849 Protein lap1 OS=Drosophil no no 0.511 0.283 0.326 2e-31
Q96NW7 1537 Leucine-rich repeat-conta no no 0.518 0.158 0.325 4e-31
F1MCA7 1536 Leucine-rich repeat-conta no no 0.518 0.158 0.323 2e-30
Q14160 1630 Protein scribble homolog no no 0.547 0.158 0.324 7e-30
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 142/255 (55%), Gaps = 2/255 (0%)

Query: 215 DQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLI 274
           ++I+ LP  I     + EL++S N I  +P SI+  K L+  D   N L  LP+SF +L 
Sbjct: 69  NEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQ 128

Query: 275 NLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELED 334
           NL  L ++   L++LP   GNL NL +L+L  N  T+LPD++  L  L+ L++  NE+ +
Sbjct: 129 NLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYN 188

Query: 335 LPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKEL 394
           LP +IG    L +L LD NQL  LP+ IG L+ L  L +  NR++ LP  I  LT L +L
Sbjct: 189 LPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDL 248

Query: 395 DVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPD 454
            +S N LE+I + +     L  L V  N   L  LP ++G  E L +L ++++Q+  LP 
Sbjct: 249 VISQNLLETIPDGIGKLKKLSILKVDQN--RLTQLPEAVGECESLTELVLTENQLLTLPK 306

Query: 455 SFRLLSKLRVFRAMR 469
           S   L KL    A R
Sbjct: 307 SIGKLKKLSNLNADR 321

Homo sapiens (taxid: 9606)
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
224138080526 predicted protein [Populus trichocarpa] 0.989 0.885 0.717 0.0
225427252533 PREDICTED: leucine-rich repeat protein s 0.970 0.857 0.701 0.0
255557615528 leucine-rich repeat-containing protein, 0.978 0.873 0.697 1e-178
297742120513 unnamed protein product [Vitis vinifera] 0.936 0.859 0.702 1e-174
449461559533 PREDICTED: protein lap1-like [Cucumis sa 0.966 0.853 0.642 1e-168
449533090521 PREDICTED: protein lap1-like, partial [C 0.944 0.854 0.651 1e-166
356563459518 PREDICTED: leucine-rich repeat protein l 0.946 0.861 0.656 1e-166
224126505492 predicted protein [Populus trichocarpa] 0.921 0.882 0.644 1e-163
357476677493 Leucine-rich repeat-containing protein [ 0.889 0.849 0.603 1e-150
357147505535 PREDICTED: leucine-rich repeat protein S 0.955 0.841 0.579 1e-137
>gi|224138080|ref|XP_002326513.1| predicted protein [Populus trichocarpa] gi|222833835|gb|EEE72312.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/467 (71%), Positives = 400/467 (85%), Gaps = 1/467 (0%)

Query: 1   MTVLLSKEKHSPSSAFVETVEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEI 60
           M V  SK K  PS AF+ETV+EI RLY+SLP RPSIE+VEAA+SV++TV+ EEQ +LD+I
Sbjct: 1   MAVKTSK-KQDPSPAFLETVDEIMRLYKSLPSRPSIEEVEAAISVIKTVNNEEQARLDDI 59

Query: 61  TKQEKPRDVSEDLFSVLQQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLV 120
            + + P+DV ++LFSVLQQ +KT+VLFQS EQRKEA +LVEVDK++  FD L++R S LV
Sbjct: 60  AELDCPQDVPQELFSVLQQARKTVVLFQSHEQRKEALYLVEVDKMFENFDGLIQRVSLLV 119

Query: 121 SGDNQMEKVAAFADSGGKIEKECVITDETLVKTREDGEIKKDGLKDLVKSASKKGSFFIG 180
           SGD   EK+ + ++S  K EKE V++DE+L+K REDGE  KDG KDLVKS+S K +FF G
Sbjct: 120 SGDTHKEKLISVSESVEKTEKESVVSDESLIKKREDGESDKDGFKDLVKSSSTKAAFFSG 179

Query: 181 EENTEKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRI 240
           E N+EKLSLMK+AAVIE SA TGAVVLDLRGKL DQIEWLP+SIGKL  +TEL+LSENRI
Sbjct: 180 EVNSEKLSLMKVAAVIEKSANTGAVVLDLRGKLMDQIEWLPLSIGKLLFITELDLSENRI 239

Query: 241 MALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLM 300
           MALPS+I G+K L KLD+HSNQLINLP SFG+LINL DLDL ANRL++LPA+F  L  L 
Sbjct: 240 MALPSTINGLKALTKLDVHSNQLINLPGSFGELINLTDLDLRANRLRSLPASFVKLTKLE 299

Query: 301 NLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPE 360
           NLDL SN+FT LP+T+G LTSLK LNV+TNELE++PYTIG+C+SL ELRLDFN+LRALPE
Sbjct: 300 NLDLSSNQFTQLPETVGSLTSLKILNVDTNELEEVPYTIGSCTSLVELRLDFNELRALPE 359

Query: 361 AIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVG 420
           AIGKL+CLEIL LHYNRI+GLPTT+G+L+ L+ELDVSFNELESI ENLCFA +LKKLNV 
Sbjct: 360 AIGKLDCLEILALHYNRIRGLPTTMGHLSNLRELDVSFNELESIPENLCFAENLKKLNVA 419

Query: 421 NNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRA 467
           NNFADLR+ PR+IGNLE+LE+LDISDDQIR+LPDSFRLLSKLRVFRA
Sbjct: 420 NNFADLRSSPRNIGNLELLEELDISDDQIRVLPDSFRLLSKLRVFRA 466

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427252|ref|XP_002278650.1| PREDICTED: leucine-rich repeat protein soc-2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255557615|ref|XP_002519837.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223540883|gb|EEF42441.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297742120|emb|CBI33907.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449461559|ref|XP_004148509.1| PREDICTED: protein lap1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449533090|ref|XP_004173510.1| PREDICTED: protein lap1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356563459|ref|XP_003549980.1| PREDICTED: leucine-rich repeat protein lrrA-like [Glycine max] Back     alignment and taxonomy information
>gi|224126505|ref|XP_002329571.1| predicted protein [Populus trichocarpa] gi|222870280|gb|EEF07411.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357476677|ref|XP_003608624.1| Leucine-rich repeat-containing protein [Medicago truncatula] gi|355509679|gb|AES90821.1| Leucine-rich repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357147505|ref|XP_003574369.1| PREDICTED: leucine-rich repeat protein SHOC-2-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query471
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.946 0.847 0.480 9.2e-107
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.694 0.595 0.544 1.7e-91
TAIR|locus:2074728499 PIRL9 "plant intracellular ras 0.456 0.430 0.412 1.4e-39
TAIR|locus:2166429506 PIRL1 "plant intracellular ras 0.660 0.614 0.324 1.8e-39
MGI|MGI:2442313 524 Lrrc1 "leucine rich repeat con 0.518 0.465 0.388 2.7e-36
UNIPROTKB|Q9BTT6 524 LRRC1 "Leucine-rich repeat-con 0.541 0.486 0.383 3.5e-36
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.445 0.452 0.398 1.5e-35
TAIR|locus:2120825 383 PIRL8 "AT4G26050" [Arabidopsis 0.452 0.556 0.409 4e-35
TAIR|locus:2123899373 PIRL7 "plant intracellular ras 0.456 0.576 0.423 1.3e-34
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.494 0.494 0.362 2.8e-34
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1056 (376.8 bits), Expect = 9.2e-107, P = 9.2e-107
 Identities = 222/462 (48%), Positives = 323/462 (69%)

Query:    20 VEEITRLYRSLPPRPSIEQVEAAMSVLQTVDTEEQTKLDEITKQEKPR--DVSEDLFSVL 77
             VEEI R++RSLP RP I+ VE A S++Q V+ E++ +L+ I K  K    +V  +LF+V 
Sbjct:     8 VEEIMRIHRSLPLRPEIDDVETATSLIQNVEKEDRNRLEAIDKLVKTSSSEVPLELFNVF 67

Query:    78 QQFKKTMVLFQSCEQRKEASHLVEVDKLYGIFDELVRRASGLVSGDNQMEK------VAA 131
             ++ KK++V FQS EQ +EA+ +++++ ++ +FDEL++RAS  ++  N          V A
Sbjct:    68 KEMKKSLVRFQSTEQTREATKILDLESVHVVFDELIQRASFCIASPNSTTALPRSVPVPA 127

Query:   132 FADSGGKI---EKECVITDETLVKTREDGEIKKDGL----KDLVKSASKKGSFFIGEENT 184
                S  +I    KE +  D+T VK +       DGL    K  V  ++   +  +   + 
Sbjct:   128 PVVSSDEIPFKSKEIISRDDTFVK-KAKSSFYSDGLLAPSKPQVLDSTLHQAKNVAGNDG 186

Query:   185 EKLSLMKMAAVIENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALP 244
             EKLSL+K+A++IE SAK     L+L+ +L DQ+EWLP S+GKL  +  L+LSEN IM LP
Sbjct:   187 EKLSLIKLASLIEVSAKKATQELNLQHRLMDQLEWLPDSLGKLSSLVRLDLSENCIMVLP 246

Query:   245 SSIAGIKTLKKLDIHSNQLINLPDSFGDLINLIDLDLHANRLKTLPATFGNLINLMNLDL 304
             ++I G+ +L +LD+HSN++  LP+S GDL+NL++L+L  N+L +LP++F  LI+L  LDL
Sbjct:   247 ATIGGLISLTRLDLHSNRIGQLPESIGDLLNLVNLNLSGNQLSSLPSSFNRLIHLEELDL 306

Query:   305 GSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGK 364
              SN  + LP++IG L SLK L+VETN +E++P++I  CSS+ ELR D+N+L+ALPEA+GK
Sbjct:   307 SSNSLSILPESIGSLVSLKKLDVETNNIEEIPHSISGCSSMEELRADYNRLKALPEAVGK 366

Query:   365 LECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFA 424
             L  LEILT+ YN I+ LPTT+ ++  LKELDVSFNELES+ E+LC+A +L KLN+GNNFA
Sbjct:   367 LSTLEILTVRYNNIRQLPTTMSSMANLKELDVSFNELESVPESLCYAKTLVKLNIGNNFA 426

Query:   425 DLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFR 466
             +LR+LP  IGNLE LE+LD+S++QIR LP SF+ LS LRV +
Sbjct:   427 NLRSLPGLIGNLEKLEELDMSNNQIRFLPYSFKTLSNLRVLQ 468
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074728 PIRL9 "plant intracellular ras group-related LRR 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166429 PIRL1 "plant intracellular ras group-related LRR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2442313 Lrrc1 "leucine rich repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTT6 LRRC1 "Leucine-rich repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123899 PIRL7 "plant intracellular ras group-related LRR 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-22
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-20
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-16
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-14
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 97.3 bits (242), Expect = 5e-22
 Identities = 71/246 (28%), Positives = 126/246 (51%), Gaps = 2/246 (0%)

Query: 227 LKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDL-INLIDLDLHANR 285
           L  +  L+L+ NR+ +  S +  +  L  LD+ +N + ++P   G L  NL +LDL  N+
Sbjct: 92  LLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNK 151

Query: 286 LKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSL 345
           +++LP+   NL NL NLDL  N+ + LP  +  L++L  L++  N++ DLP  I   S+L
Sbjct: 152 IESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSAL 211

Query: 346 TELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESIT 405
            EL L  N +  L  ++  L+ L  L L  N+++ LP +IGNL+ L+ LD+S N++ SI+
Sbjct: 212 EELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSIS 271

Query: 406 ENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVF 465
                  +L++L++  N         ++  L +   L++      +      +L    + 
Sbjct: 272 SLGSLT-NLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKALELKLNSILLNNNIL 330

Query: 466 RAMRLL 471
                 
Sbjct: 331 SNGETS 336

Length = 394
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 471
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.64
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.55
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.52
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.43
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.42
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.27
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.27
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.97
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.92
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.59
PLN03150623 hypothetical protein; Provisional 98.54
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.51
KOG4341483 consensus F-box protein containing LRR [General fu 98.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.46
PLN03150623 hypothetical protein; Provisional 98.46
KOG4341483 consensus F-box protein containing LRR [General fu 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.29
PRK15386 426 type III secretion protein GogB; Provisional 98.21
PRK15386 426 type III secretion protein GogB; Provisional 98.21
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.2
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.88
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.08
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.58
KOG4308478 consensus LRR-containing protein [Function unknown 96.17
KOG4308 478 consensus LRR-containing protein [Function unknown 95.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.77
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.81
smart0037026 LRR Leucine-rich repeats, outliers. 88.81
smart0037026 LRR Leucine-rich repeats, outliers. 88.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.89
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.16
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information 
Probab=99.93  E-value=1.6e-28  Score=243.71  Aligned_cols=269  Identities=28%  Similarity=0.428  Sum_probs=177.0

Q ss_pred             hhccCCCcEEEEecCCCCCcccccchhcCCCCCccEEEeeCCCCCCCchhhcCCCCccEEEeecCCCCCcchh-hcCCCC
Q 012082          197 ENSAKTGAVVLDLRGKLTDQIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDS-FGDLIN  275 (471)
Q Consensus       197 ~~~~~~~l~~L~l~~~~~~~~~~l~~~~~~l~~L~~L~L~~~~~~~l~~~i~~l~~L~~L~L~~~~i~~lp~~-i~~l~~  275 (471)
                      +.+....+|++++..+.... ..+|..+..+..|++|||++|.+...|..+.+.+++-+|+|++|+|..+|.+ +-++..
T Consensus        73 ELs~Lp~LRsv~~R~N~LKn-sGiP~diF~l~dLt~lDLShNqL~EvP~~LE~AKn~iVLNLS~N~IetIPn~lfinLtD  151 (1255)
T KOG0444|consen   73 ELSDLPRLRSVIVRDNNLKN-SGIPTDIFRLKDLTILDLSHNQLREVPTNLEYAKNSIVLNLSYNNIETIPNSLFINLTD  151 (1255)
T ss_pred             hhccchhhHHHhhhcccccc-CCCCchhcccccceeeecchhhhhhcchhhhhhcCcEEEEcccCccccCCchHHHhhHh
Confidence            34456667777776655443 3568888899999999999999999998888889999999999999999866 567888


Q ss_pred             CcEEEeeCCCCCCcchhhhCCCCCcEEecCCCCCC--------------------------cCccccCCCCCCCEEEeeC
Q 012082          276 LIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFT--------------------------HLPDTIGCLTSLKTLNVET  329 (471)
Q Consensus       276 L~~L~L~~~~l~~lp~~l~~l~~L~~L~l~~~~l~--------------------------~l~~~l~~l~~L~~L~l~~  329 (471)
                      |-+|||++|++..+|+.+..+.+|++|++++|.+.                          .+|.++..+.+|..++++.
T Consensus       152 LLfLDLS~NrLe~LPPQ~RRL~~LqtL~Ls~NPL~hfQLrQLPsmtsL~vLhms~TqRTl~N~Ptsld~l~NL~dvDlS~  231 (1255)
T KOG0444|consen  152 LLFLDLSNNRLEMLPPQIRRLSMLQTLKLSNNPLNHFQLRQLPSMTSLSVLHMSNTQRTLDNIPTSLDDLHNLRDVDLSE  231 (1255)
T ss_pred             HhhhccccchhhhcCHHHHHHhhhhhhhcCCChhhHHHHhcCccchhhhhhhcccccchhhcCCCchhhhhhhhhccccc
Confidence            88999999999999999999999999999988653                          2333444444455555555


Q ss_pred             CCCCCcccccCCCCCCcEEEccCCCCCcchhhhCCCCCCcEEEeecCCCCCCchhccCCCCCcEEEeeCCCCC--cchhh
Q 012082          330 NELEDLPYTIGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELE--SITEN  407 (471)
Q Consensus       330 ~~l~~l~~~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~L~~n~l~--~l~~~  407 (471)
                      |++..+|..+.++++|+.|++++|.++.+.-..+...+|++|+++.|+++.+|..+.++++|+.|.+.+|.+.  .+|+.
T Consensus       232 N~Lp~vPecly~l~~LrrLNLS~N~iteL~~~~~~W~~lEtLNlSrNQLt~LP~avcKL~kL~kLy~n~NkL~FeGiPSG  311 (1255)
T KOG0444|consen  232 NNLPIVPECLYKLRNLRRLNLSGNKITELNMTEGEWENLETLNLSRNQLTVLPDAVCKLTKLTKLYANNNKLTFEGIPSG  311 (1255)
T ss_pred             cCCCcchHHHhhhhhhheeccCcCceeeeeccHHHHhhhhhhccccchhccchHHHhhhHHHHHHHhccCcccccCCccc
Confidence            5555555555555555555555555554444444455555555555555555555555555555555555443  45555


Q ss_pred             hcCCCCCcEEEccCCcCCCCccchhccCCCCccEEEeecCCCCcCchhhhcCCCCcEEEcc
Q 012082          408 LCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAM  468 (471)
Q Consensus       408 l~~~~~L~~L~L~~n~~~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~L~~L~~L~l~  468 (471)
                      ++.+.+|+.+...+|  .+.-+|..++.|+.|+.|.|+.|.+..+|+.+.-|+.|++|++.
T Consensus       312 IGKL~~Levf~aanN--~LElVPEglcRC~kL~kL~L~~NrLiTLPeaIHlL~~l~vLDlr  370 (1255)
T KOG0444|consen  312 IGKLIQLEVFHAANN--KLELVPEGLCRCVKLQKLKLDHNRLITLPEAIHLLPDLKVLDLR  370 (1255)
T ss_pred             hhhhhhhHHHHhhcc--ccccCchhhhhhHHHHHhcccccceeechhhhhhcCCcceeecc
Confidence            555555555555555  44555555555666666666666666666666666666666554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 8e-14
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-12
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-12
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-12
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-11
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-11
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-11
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-10
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-10
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-10
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 9e-10
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-09
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-09
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 6e-07
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-09
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-06
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-08
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-08
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 5e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 7e-08
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 9e-08
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 8e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-06
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 8e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-05
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 3e-05
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 5e-05
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 1e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 1e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 2e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 6e-04
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 7e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 7e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 7e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 7e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 8e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 105/182 (57%), Gaps = 12/182 (6%)
Query: 233 LNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPD-SFGDLINLIDLDLHANRLKTLPA 291
           ++ S  ++ A+PS+I      KKLD+ SN+L +LP  +F  L  L  L L+ N+L+TLPA
Sbjct: 21  VDCSSKKLTAIPSNIPA--DTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPA 78
Query: 292 -TFGNLINLMNLDLGSNEFTHLPDTIGC---LTSLKTLNVETNELEDLPYTI-GNCSSLT 346
             F  L NL  L +  N+   LP  IG    L +L  L ++ N+L+ LP  +  + + LT
Sbjct: 79  GIFKELKNLETLWVTDNKLQALP--IGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLT 136
Query: 347 ELRLDFNQLRALPEAI-GKLECLEILTLHYNRIKGLP-TTIGNLTKLKELDVSFNELESI 404
            L L +N+L++LP+ +  KL  L+ L L+ N++K +P      LT+LK L +  N+L+ +
Sbjct: 137 YLSLGYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRV 196
Query: 405 TE 406
            E
Sbjct: 197 PE 198
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query471
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-68
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-62
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-53
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-61
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-56
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-52
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-44
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-52
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-46
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-48
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-47
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-46
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-42
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-45
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-41
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-41
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-37
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-45
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-42
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-38
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-39
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-40
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-40
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-37
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-42
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-32
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-41
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-39
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-40
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-38
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-38
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-35
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-38
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-37
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-33
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-34
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-18
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-36
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-27
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-33
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-35
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-33
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-30
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-33
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-32
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-30
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-29
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-30
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-30
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-30
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-28
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-27
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-23
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-25
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-22
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-25
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-20
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-25
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-24
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-24
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-22
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-21
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-15
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-16
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  221 bits (565), Expect = 1e-68
 Identities = 62/263 (23%), Positives = 102/263 (38%), Gaps = 15/263 (5%)

Query: 216 QIEWLPVSIGKLKDVTELNLSENRIMALPSSIAGIK--TLKKLDIHSNQLINLPDSFGDL 273
                        +      +   + A    +          L++ S  L   PD    L
Sbjct: 44  NRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRL 103

Query: 274 INLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNV-ETNEL 332
            +L  + + A  L  LP T      L  L L  N    LP +I  L  L+ L++    EL
Sbjct: 104 SHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPEL 163

Query: 333 EDLPYTIGNCS---------SLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPT 383
            +LP  + +           +L  LRL++  +R+LP +I  L+ L+ L +  + +  L  
Sbjct: 164 TELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGP 223

Query: 384 TIGNLTKLKELDVS-FNELESITENLCFAVSLKKLNVGNNFADLRALPRSIGNLEMLEQL 442
            I +L KL+ELD+     L +          LK+L +  + ++L  LP  I  L  LE+L
Sbjct: 224 AIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLIL-KDCSNLLTLPLDIHRLTQLEKL 282

Query: 443 DISD-DQIRILPDSFRLLSKLRV 464
           D+     +  LP     L    +
Sbjct: 283 DLRGCVNLSRLPSLIAQLPANCI 305
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.5
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.98
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.22
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.95  E-value=9.1e-28  Score=262.91  Aligned_cols=266  Identities=23%  Similarity=0.327  Sum_probs=177.8

Q ss_pred             cCCCcEEEEecCCCCCcc----c-----------ccchhcC--CCCCccEEEeeCCCCC-CCchhhcCCCCccEEEeecC
Q 012082          200 AKTGAVVLDLRGKLTDQI----E-----------WLPVSIG--KLKDVTELNLSENRIM-ALPSSIAGIKTLKKLDIHSN  261 (471)
Q Consensus       200 ~~~~l~~L~l~~~~~~~~----~-----------~l~~~~~--~l~~L~~L~L~~~~~~-~l~~~i~~l~~L~~L~L~~~  261 (471)
                      ...+++.|+++++.....    .           .+|..++  ++++|++|++++|.+. .+|..+.++++|++|++++|
T Consensus       446 ~L~~L~~L~Ls~N~Lsg~~i~~~~~~~s~n~~~g~iP~~l~f~~L~~L~~L~Ls~N~l~~~iP~~l~~L~~L~~L~Ls~N  525 (876)
T 4ecn_A          446 RLTKLQIIYFANSPFTYDNIAVDWEDANSDYAKQYENEELSWSNLKDLTDVELYNCPNMTQLPDFLYDLPELQSLNIACN  525 (876)
T ss_dssp             GCTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCCGGGCTTCCEEEEESCTTCCSCCGGGGGCSSCCEEECTTC
T ss_pred             cCCCCCEEECcCCcCCCCcccccccccccccccccCChhhhhccCCCCCEEECcCCCCCccChHHHhCCCCCCEEECcCC
Confidence            456778888887755431    0           1566666  7788888888887644 46777777888888888877


Q ss_pred             C-CCC--cchhhcCCC-------CCcEEEeeCCCCCCcch--hhhCCCCCcEEecCCCCCCcCccccCCCCCCCEEEeeC
Q 012082          262 Q-LIN--LPDSFGDLI-------NLIDLDLHANRLKTLPA--TFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVET  329 (471)
Q Consensus       262 ~-i~~--lp~~i~~l~-------~L~~L~L~~~~l~~lp~--~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~l~~  329 (471)
                      . ++.  +|..++++.       +|++|++++|.++.+|.  .+.++++|++|++++|.++.+| .++.+++|+.|++++
T Consensus       526 ~~lsg~~iP~~i~~L~~~~~~l~~L~~L~Ls~N~L~~ip~~~~l~~L~~L~~L~Ls~N~l~~lp-~~~~L~~L~~L~Ls~  604 (876)
T 4ecn_A          526 RGISAAQLKADWTRLADDEDTGPKIQIFYMGYNNLEEFPASASLQKMVKLGLLDCVHNKVRHLE-AFGTNVKLTDLKLDY  604 (876)
T ss_dssp             TTSCHHHHHHHHHHHHHCTTTTTTCCEEECCSSCCCBCCCHHHHTTCTTCCEEECTTSCCCBCC-CCCTTSEESEEECCS
T ss_pred             CCcccccchHHHHhhhhcccccCCccEEEeeCCcCCccCChhhhhcCCCCCEEECCCCCcccch-hhcCCCcceEEECcC
Confidence            6 663  666555444       77777777777777777  7777777777777777777776 677777777777777


Q ss_pred             CCCCCcccccCCCCC-CcEEEccCCCCCcchhhhCCC-------------------------------CCCcEEEeecCC
Q 012082          330 NELEDLPYTIGNCSS-LTELRLDFNQLRALPEAIGKL-------------------------------ECLEILTLHYNR  377 (471)
Q Consensus       330 ~~l~~l~~~l~~l~~-L~~L~l~~~~l~~l~~~l~~l-------------------------------~~L~~L~l~~~~  377 (471)
                      |.+..+|..+..+++ |+.|++++|.++.+|..+..+                               ++|+.|++++|.
T Consensus       605 N~l~~lp~~l~~l~~~L~~L~Ls~N~L~~lp~~~~~~~~~~L~~L~Ls~N~l~g~ip~l~~~l~~~~~~~L~~L~Ls~N~  684 (876)
T 4ecn_A          605 NQIEEIPEDFCAFTDQVEGLGFSHNKLKYIPNIFNAKSVYVMGSVDFSYNKIGSEGRNISCSMDDYKGINASTVTLSYNE  684 (876)
T ss_dssp             SCCSCCCTTSCEECTTCCEEECCSSCCCSCCSCCCTTCSSCEEEEECCSSCTTTTSSSCSSCTTTCCCCCEEEEECCSSC
T ss_pred             CccccchHHHhhccccCCEEECcCCCCCcCchhhhccccCCCCEEECcCCcCCCccccchhhhccccCCCcCEEEccCCc
Confidence            777767766777766 777777777666555443322                               245555555555


Q ss_pred             CCCCchhc-cCCCCCcEEEeeCCCCCcchhhhcCCC--------CCcEEEccCCcCCCCccchhcc--CCCCccEEEeec
Q 012082          378 IKGLPTTI-GNLTKLKELDVSFNELESITENLCFAV--------SLKKLNVGNNFADLRALPRSIG--NLEMLEQLDISD  446 (471)
Q Consensus       378 l~~l~~~l-~~l~~L~~L~L~~n~l~~l~~~l~~~~--------~L~~L~L~~n~~~l~~lp~~l~--~l~~L~~L~L~~  446 (471)
                      ++.+|..+ ..+++|+.|+|++|.+..+|..+....        +|+.|+|++|  .+..+|..+.  .+++|+.|+|++
T Consensus       685 L~~lp~~~~~~l~~L~~L~Ls~N~L~~ip~~~~~~~~~~l~nl~~L~~L~Ls~N--~L~~lp~~l~~~~l~~L~~L~Ls~  762 (876)
T 4ecn_A          685 IQKFPTELFATGSPISTIILSNNLMTSIPENSLKPKDGNYKNTYLLTTIDLRFN--KLTSLSDDFRATTLPYLSNMDVSY  762 (876)
T ss_dssp             CCSCCHHHHHTTCCCSEEECCSCCCSCCCTTSSSCTTSCCTTGGGCCEEECCSS--CCCCCCGGGSTTTCTTCCEEECCS
T ss_pred             CCccCHHHHccCCCCCEEECCCCcCCccChHHhccccccccccCCccEEECCCC--CCccchHHhhhccCCCcCEEEeCC
Confidence            55555443 356667777777776666665443322        6777777766  4446666665  677777777777


Q ss_pred             CCCCcCchhhhcCCCCcEEEcc
Q 012082          447 DQIRILPDSFRLLSKLRVFRAM  468 (471)
Q Consensus       447 n~l~~lp~~l~~L~~L~~L~l~  468 (471)
                      |+++.+|..+..+++|+.|++.
T Consensus       763 N~L~~lp~~l~~L~~L~~L~Ls  784 (876)
T 4ecn_A          763 NCFSSFPTQPLNSSQLKAFGIR  784 (876)
T ss_dssp             SCCSSCCCGGGGCTTCCEEECC
T ss_pred             CCCCccchhhhcCCCCCEEECC
Confidence            7777777667777777777664
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 471
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-23
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-13
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-09
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-10
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1m9la_ 198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 9e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 98.5 bits (244), Expect = 4e-23
 Identities = 47/204 (23%), Positives = 87/204 (42%), Gaps = 8/204 (3%)

Query: 219 WLPVSIGKLKDVTELNLSENRIMALPSSIAGIKTLKKLDIHSNQLINLPDSFGDLINLID 278
                + KL ++  L  + N+I  +      +  L +L ++ NQL ++  +   L NL D
Sbjct: 188 SDISVLAKLTNLESLIATNNQISDITPLG-ILTNLDELSLNGNQLKDIG-TLASLTNLTD 245

Query: 279 LDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYT 338
           LDL  N++  L      L  L  L LG+N+ +++    G   +  T         +    
Sbjct: 246 LDLANNQISNLAP-LSGLTKLTELKLGANQISNISPLAGL--TALTNLELNENQLEDISP 302

Query: 339 IGNCSSLTELRLDFNQLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSF 398
           I N  +LT L L FN +  +   +  L  L+ L    N++  + + + NLT +  L    
Sbjct: 303 ISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVSS-LANLTNINWLSAGH 360

Query: 399 NELESITENLCFAVSLKKLNVGNN 422
           N++  +T  L     + +L + + 
Sbjct: 361 NQISDLTP-LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query471
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.62
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.92  E-value=4.1e-23  Score=204.09  Aligned_cols=186  Identities=27%  Similarity=0.421  Sum_probs=123.9

Q ss_pred             CCCcEEEeeCCCCCCcchhhhCCCCCcEEecCCCCCCcCccccCCCCCCCEEEeeCCCCCCcccccCCCCCCcEEEccCC
Q 012082          274 INLIDLDLHANRLKTLPATFGNLINLMNLDLGSNEFTHLPDTIGCLTSLKTLNVETNELEDLPYTIGNCSSLTELRLDFN  353 (471)
Q Consensus       274 ~~L~~L~L~~~~l~~lp~~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~l~~~  353 (471)
                      ++++.+++++|.++.++. ...+++|++|++++|.++.++ .+..+++|+.|++++|.+..++. +..+++|+.|+++++
T Consensus       197 ~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~-~~~~~~L~~L~l~~~  273 (384)
T d2omza2         197 TNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAP-LSGLTKLTELKLGAN  273 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSS
T ss_pred             cccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCc-ccccccCCEeeccCc
Confidence            334444444444333321 233445555555555554443 34455555555555555554442 455555666666555


Q ss_pred             CCCcchhhhCCCCCCcEEEeecCCCCCCchhccCCCCCcEEEeeCCCCCcchhhhcCCCCCcEEEccCCcCCCCccchhc
Q 012082          354 QLRALPEAIGKLECLEILTLHYNRIKGLPTTIGNLTKLKELDVSFNELESITENLCFAVSLKKLNVGNNFADLRALPRSI  433 (471)
Q Consensus       354 ~l~~l~~~l~~l~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~~~~L~~L~L~~n~~~l~~lp~~l  433 (471)
                      .+..++. +..++.++.+.+..|.+..++ .+..+++++.|++++|.++.++. +..+++|++|++++|  .+..++ .+
T Consensus       274 ~l~~~~~-~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n--~l~~l~-~l  347 (384)
T d2omza2         274 QISNISP-LAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANN--KVSDVS-SL  347 (384)
T ss_dssp             CCCCCGG-GTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSS--CCCCCG-GG
T ss_pred             ccCCCCc-ccccccccccccccccccccc-ccchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCC--CCCCCh-hH
Confidence            5555543 445555666666666555543 46778899999999999998764 788999999999999  566776 68


Q ss_pred             cCCCCccEEEeecCCCCcCchhhhcCCCCcEEEccC
Q 012082          434 GNLEMLEQLDISDDQIRILPDSFRLLSKLRVFRAMR  469 (471)
Q Consensus       434 ~~l~~L~~L~L~~n~l~~lp~~l~~L~~L~~L~l~~  469 (471)
                      +.+++|++|++++|+++.+++ +.+|++|+.|++.+
T Consensus       348 ~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~  382 (384)
T d2omza2         348 ANLTNINWLSAGHNQISDLTP-LANLTRITQLGLND  382 (384)
T ss_dssp             GGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCC
T ss_pred             cCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCC
Confidence            899999999999999999886 89999999999875
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure