Citrus Sinensis ID: 012109

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-

MNTGQMFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGSNMDVDNEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG

ccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccccccccEEEEEEEccccEEEEEEEEccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHcccccEEEEEcccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEccccHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEccHHHHHHHcccccccccccccHHHHHHcccccccccccccccEEEEcccccHHHHHHHHHcccccEEEEEEccccEEEEEEEHHHHHHHHHc

cccccccccccccccccccccccEEEcEEEEEcccccEEEEEEcccccccccccccccccccEEEEEEEcccccEEEEEEEccEEEccccccccccccccEcEEEEEccccccccccccccccccccccccHHHHHccccHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHcccEEcccccccccEEEEEEEHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHcccHHHHcccccccEEEccccHHHHHHHHHHHHHccccccEEccccccccccEEEEEHcHHHHHHHHHHHHHHcccccHHHcccHHHcccccEcccccccccccEEEEccccHHHHHHHHHHHHcccEcEEEccccEEEEHHHHHHHHHHHHccccccccccccEHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHccccEEEEEEEccccEEEEEEEHHHHHHHHHc

mntgqmfnpgmdaarepasvpdtvlipmrfvwpyggrsvflsgsfnrwsellpmspvegcptvfqiiwsippgyhqykfcvdgewrhdehqpfisseyGIVNTVLlatepnfmhginqgmpsgsnmdvdnEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQgismaplwdfskarfvgvlsASDFILILRELgnhgsnlteeelETHTISAWKEGKAYLNRQIdshgkafprplvyagpndnlKDVARKILhnevatvpiihsssqdgsfpqLLHIASLSGILKCVCRYfrhcssslpilklpicaipvgtwvpkigepnrrplamlrpsASLSAALNLLVQAqvssipivddndslldiYCRSDITALAKDKAYAHINLSEMTIHQALQlgqdsyspyelrsqrcqmclpsdtLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG

mntgqmfnpgmdaarepasvpDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGSNMDVDNEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSsipivddndsLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEagskrvegivslsdIFKFLLG

MNTGQMFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGSNMDVDNEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPsaslsaalnllvqaqvsSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG

*********************DTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGI****************FQRLVQIS***LTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLL*

*************************IPMRFVWPYGGRSVFLSGSFNRWSELLPM*****CPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGSNMDVDNEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG

*******************VPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGIN******SNMDV*NEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		471	2.2.26 [Sep-21-2011]
Q944A6		487	Sucrose nonfermenting 4-l	yes	no	0.978	0.946	0.653	0.0
P58108		330	5'-AMP-activated protein	yes	no	0.660	0.942	0.310	4e-30
O54950		330	5'-AMP-activated protein	yes	no	0.656	0.936	0.309	4e-30
Q09138		330	5'-AMP-activated protein	yes	no	0.577	0.824	0.319	4e-30
P54619		331	5'-AMP-activated protein	yes	no	0.577	0.821	0.326	5e-30
P80385		330	5'-AMP-activated protein	yes	no	0.577	0.824	0.326	1e-29
Q8T277		577	5'-AMP-activated protein	yes	no	0.600	0.490	0.301	6e-29
Q91WG5		566	5'-AMP-activated protein	no	no	0.571	0.475	0.307	1e-28
Q9UGJ0		569	5'-AMP-activated protein	no	no	0.571	0.472	0.304	7e-28
Q9UGI9		489	5'-AMP-activated protein	no	no	0.585	0.564	0.307	2e-27

>sp\|Q944A6\|SNF4_ARATH Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana GN=SNF4 PE=1 SV=1	Back alignment and function desciption

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/491 (65%), Positives = 377/491 (76%), Gaps = 30/491 (6%)

Query: 6   MFNPGMDAAREPASVPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVFQ 65
           MF   +D++R  ++    +L P RFVWPYGGR VFLSGSF RW+E +PMSP+EGCPTVFQ
Sbjct: 1   MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQ 60

Query: 66  IIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGSN 125
           +I ++ PGYHQYKF VDGEWRHDEHQPF+S   G+VNT+ +        G +      SN
Sbjct: 61  VICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFITGPDMVPAGFSPETLGRSN 120

Query: 126 MDVDNEAFQRLVQISDGSLTEAAERISEADLQ------------------------VVAL 161
           MDVD + F R    S     EA  R+S  DL+                        V+AL
Sbjct: 121 MDVD-DVFLRTADPSQ----EAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIAL 175

Query: 162 DIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELE 221
           D++LPVKQAFHILYEQGI +APLWDF K +FVGVL   DFILILRELG HGSNLTEEELE
Sbjct: 176 DVNLPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELE 235

Query: 222 THTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSS 281
           THTI+AWKEGKA+++RQ D  G+ +PRPLV  GP DNLKDVA KIL N+VA VP+I+SS 
Sbjct: 236 THTIAAWKEGKAHISRQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSL 295

Query: 282 QDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLA 341
           QDGS+PQLLH+ASLSGILKC+CRYFRH SSSLPIL+ PIC+IP+GTWVP+IGE + +PLA
Sbjct: 296 QDGSYPQLLHLASLSGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLA 355

Query: 342 MLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTI 401
            LRP ASL +AL LLVQA+VSSIP+VDDNDSL+DIY RSDITALAKDKAYA I+L +MT+
Sbjct: 356 TLRPHASLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTV 415

Query: 402 HQALQLGQDSYSPYEL-RSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIV 460
           HQALQLGQD+  PY +   QRC MCL SD+L KVMERLANPGVRRLVIVEAGSKRVEGI+
Sbjct: 416 HQALQLGQDASPPYGIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGII 475

Query: 461 SLSDIFKFLLG 471
           SLSD+F+FLLG
Sbjct: 476 SLSDVFQFLLG 486

Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.
Arabidopsis thaliana (taxid: 3702)

>sp\|P58108\|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2	Back alignment and function description

>sp\|O54950\|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2	Back alignment and function description

>sp\|Q09138\|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2	Back alignment and function description

>sp\|P54619\|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1	Back alignment and function description

>sp\|P80385\|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus GN=Prkag1 PE=1 SV=3	Back alignment and function description

>sp\|Q8T277\|PRKAG_DICDI 5'-AMP-activated protein kinase subunit gamma OS=Dictyostelium discoideum GN=prkag PE=3 SV=3	Back alignment and function description

>sp\|Q91WG5\|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2	Back alignment and function description

>sp\|Q9UGJ0\|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1	Back alignment and function description

>sp\|Q9UGI9\|AAKG3_HUMAN 5'-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		471
356529781		492	PREDICTED: sucrose nonfermenting 4-like	0.989	0.947	0.765	0.0
356556126		491	PREDICTED: sucrose nonfermenting 4-like	0.989	0.949	0.757	0.0
449450664		491	PREDICTED: sucrose nonfermenting 4-like	0.989	0.949	0.755	0.0
225432326		491	PREDICTED: sucrose nonfermenting 4-like	0.989	0.949	0.749	0.0
356519984		480	PREDICTED: sucrose nonfermenting 4-like	0.972	0.954	0.725	0.0
224123196		464	predicted protein [Populus trichocarpa]	0.934	0.948	0.743	0.0
356563906		482	PREDICTED: sucrose nonfermenting 4-like	0.963	0.941	0.710	0.0
225450904		488	PREDICTED: sucrose nonfermenting 4-like	0.980	0.946	0.709	0.0
224107351		447	predicted protein [Populus trichocarpa]	0.934	0.984	0.749	0.0
359487759		482	PREDICTED: sucrose nonfermenting 4-like	0.987	0.964	0.712	0.0

>gi\|356529781\|ref\|XP_003533466.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max]	Back alignment and taxonomy information

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/491 (76%), Positives = 423/491 (86%), Gaps = 25/491 (5%)

Query: 6   MFNPGMDAAREPAS-VPDTVLIPMRFVWPYGGRSVFLSGSFNRWSELLPMSPVEGCPTVF 64
           MF   MD+AR+ A  V  TVLIPMRFVWPYGGRSVFLSGSF RW ELLPMSPVEGCPTVF
Sbjct: 1   MFGQSMDSARDAAGGVAGTVLIPMRFVWPYGGRSVFLSGSFTRWLELLPMSPVEGCPTVF 60

Query: 65  QIIWSIPPGYHQYKFCVDGEWRHDEHQPFISSEYGIVNTVLLATEPNFMHGINQGMPSGS 124
           Q+I+++PPGYHQYKF VDGEWRHDEHQP++  EYGIVNTVLLAT+PN+M  +   + SG+
Sbjct: 61  QVIYNLPPGYHQYKFFVDGEWRHDEHQPYVPGEYGIVNTVLLATDPNYMPVLPPDVASGN 120

Query: 125 NMDVDNEAFQRLVQISDGSLTEAAERISEADLQ------------------------VVA 160
           +MDVDN+AF+R+ +++DG+L+E   RIS+ D+Q                        VVA
Sbjct: 121 SMDVDNDAFRRMARLTDGTLSEVLPRISDTDVQISRQRISAFLSSHTAYELLPESGKVVA 180

Query: 161 LDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEEL 220
           LD+DLPVKQAFHIL+EQG+ MAPLWDF K +FVGVLSASDFILILRELGNHGSNLTEEEL
Sbjct: 181 LDVDLPVKQAFHILHEQGVFMAPLWDFCKGQFVGVLSASDFILILRELGNHGSNLTEEEL 240

Query: 221 ETHTISAWKEGKAYLNRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSS 280
           ETHTISAWKEGK+YLNRQ + HG AF R  ++AGP DNLKD+A KIL  EV+TVPIIHSS
Sbjct: 241 ETHTISAWKEGKSYLNRQNNGHGTAFSRCFIHAGPYDNLKDIAMKILQKEVSTVPIIHSS 300

Query: 281 SQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPL 340
           S+D SFPQLLH+ASLSGILKC+CRYFRHCSSSLP+L+LPICAIPVGTWVPKIGE NRRPL
Sbjct: 301 SEDASFPQLLHLASLSGILKCICRYFRHCSSSLPVLQLPICAIPVGTWVPKIGESNRRPL 360

Query: 341 AMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMT 400
           AMLRP+ASL++ALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAK++AY HINL EMT
Sbjct: 361 AMLRPTASLASALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKNRAYTHINLDEMT 420

Query: 401 IHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIV 460
           +HQALQLGQD+YSPYELRSQRCQMCL SD LHKVMERLANPGVRRLVIVEAGSKRVEGIV
Sbjct: 421 VHQALQLGQDAYSPYELRSQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIV 480

Query: 461 SLSDIFKFLLG 471
           SLSDIFKF +G
Sbjct: 481 SLSDIFKFFIG 491

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356556126\|ref\|XP_003546378.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|449450664\|ref\|XP_004143082.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] gi\|449523153\|ref\|XP_004168589.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225432326\|ref\|XP_002274373.1\| PREDICTED: sucrose nonfermenting 4-like protein [Vitis vinifera] gi\|297736884\|emb\|CBI26085.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356519984\|ref\|XP_003528648.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|224123196\|ref\|XP_002330362.1\| predicted protein [Populus trichocarpa] gi\|222871566\|gb\|EEF08697.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356563906\|ref\|XP_003550198.1\| PREDICTED: sucrose nonfermenting 4-like protein-like [Glycine max]	Back alignment and taxonomy information

>gi\|225450904\|ref\|XP_002284480.1\| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224107351\|ref\|XP_002314455.1\| predicted protein [Populus trichocarpa] gi\|222863495\|gb\|EEF00626.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359487759\|ref\|XP_003633645.1\| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi\|296088362\|emb\|CBI36807.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		471
TAIR\|locus:2036079		487	SNF4 "homolog of yeast sucrose	0.743	0.718	0.667	3.5e-123
MGI\|MGI:1336153		566	Prkag2 "protein kinase, AMP-ac	0.399	0.332	0.283	1.1e-22
UNIPROTKB\|F1LLY5		528	Prkag2 "Protein Prkag2" [Rattu	0.399	0.356	0.278	4e-22
UNIPROTKB\|Q8N7V9		340	PRKAG1 "cDNA FLJ40287 fis, clo	0.418	0.579	0.269	5.4e-22
UNIPROTKB\|F1P1P1		382	PRKAG3 "Uncharacterized protei	0.269	0.332	0.358	7.3e-19
ZFIN\|ZDB-GENE-080723-44		269	prkab2 "protein kinase, AMP-ac	0.214	0.375	0.380	1.6e-15
MGI\|MGI:1336167		270	Prkab1 "protein kinase, AMP-ac	0.174	0.303	0.430	1.1e-14
RGD\|71057		270	Prkab1 "protein kinase, AMP-ac	0.174	0.303	0.430	1.1e-14
UNIPROTKB\|P80387		122	PRKAB1 "5'-AMP-activated prote	0.159	0.614	0.455	1.9e-14
UNIPROTKB\|Q5BIS9		270	PRKAB1 "5'-AMP-activated prote	0.174	0.303	0.441	2.8e-14

TAIR\|locus:2036079 SNF4 "homolog of yeast sucrose nonfermenting 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1211 (431.4 bits), Expect = 3.5e-123, P = 3.5e-123
 Identities = 237/355 (66%), Positives = 282/355 (79%)

Query:   118 QGMPSGSNMDVDNEAFQRLVQISDGSLTEAAERISEADLQVVALDIDLPVKQAFHILYEQ 177
             + +P  S +D++    +  V +S  +   A E + E+  +V+ALD++LPVKQAFHILYEQ
Sbjct:   136 EAVPRMSGVDLELSRHRISVLLSTRT---AYELLPESG-KVIALDVNLPVKQAFHILYEQ 191

Query:   178 GISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLTEEELETHTISAWKEGKAYLNR 237
             GI +APLWDF K +FVGVL   DFILILRELG HGSNLTEEELETHTI+AWKEGKA+++R
Sbjct:   192 GIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHTIAAWKEGKAHISR 251

Query:   238 QIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSG 297
             Q D  G+ +PRPLV  GP DNLKDVA KIL N+VA VP+I+SS QDGS+PQLLH+ASLSG
Sbjct:   252 QYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQDGSYPQLLHLASLSG 311

Query:   298 ILKCVCRYFRHCSSSLPILKLPICAIPVGTWVPKIGEPNRRPLAMLRPXXXXXXXXXXXX 357
             ILKC+CRYFRH SSSLPIL+ PIC+IP+GTWVP+IGE + +PLA LRP            
Sbjct:   312 ILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLV 371

Query:   358 XXXXXSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLSEMTIHQALQLGQDSYSPYEL 417
                  SIP+VDDNDSL+DIY RSDITALAKDKAYA I+L +MT+HQALQLGQD+  PY +
Sbjct:   372 QAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPYGI 431

Query:   418 -RSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLLG 471
                QRC MCL SD+L KVMERLANPGVRRLVIVEAGSKRVEGI+SLSD+F+FLLG
Sbjct:   432 FNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLG 486

GO:0005634 "nucleus" evidence=ISM

GO:0005515 "protein binding" evidence=IPI

GO:0030295 "protein kinase activator activity" evidence=ISS

GO:0042149 "cellular response to glucose starvation" evidence=IDA

GO:0004674 "protein serine/threonine kinase activity" evidence=IDA

GO:0046777 "protein autophosphorylation" evidence=IDA

MGI\|MGI:1336153 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LLY5 Prkag2 "Protein Prkag2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8N7V9 PRKAG1 "cDNA FLJ40287 fis, clone TESTI2027909, highly similar to 5'-AMP-ACTIVATED PROTEIN KINASE, GAMMA-1 SUBUNIT" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P1P1 PRKAG3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-080723-44 prkab2 "protein kinase, AMP-activated, beta 2 non-catalytic subunit" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1336167 Prkab1 "protein kinase, AMP-activated, beta 1 non-catalytic subunit" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|71057 Prkab1 "protein kinase, AMP-activated, beta 1 non-catalytic subunit" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P80387 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5BIS9 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q944A6	SNF4_ARATH	No assigned EC number	0.6537	0.9787	0.9466	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00019790001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (491 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		471
cd04641		120	cd04641, CBS_pair_28, The CBS domain, named after	1e-36
cd02859		80	cd02859, E_set_AMPKbeta_like_N, N-terminal Early s	9e-27
cd04618		98	cd04618, CBS_pair_5, The CBS domain, named after h	5e-25
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	6e-11
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after h	1e-07
cd04642		126	cd04642, CBS_pair_29, The CBS domain, named after	3e-07
cd02688		82	cd02688, E_set, Early set domain associated with t	7e-07
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont	2e-06
cd07184		86	cd07184, E_set_Isoamylase_like_N, N-terminal Early	2e-06
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	3e-06
cd04623		113	cd04623, CBS_pair_10, The CBS domain, named after	3e-06
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	4e-06
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	6e-06
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	1e-05
cd04588		110	cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c	2e-05
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	2e-05
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c	4e-05
cd04638		106	cd04638, CBS_pair_25, The CBS domain, named after	5e-05
pfam00571		57	pfam00571, CBS, CBS domain	6e-05
cd04803		122	cd04803, CBS_pair_15, The CBS domain, named after	9e-05
cd04642		126	cd04642, CBS_pair_29, The CBS domain, named after	1e-04
pfam00571		57	pfam00571, CBS, CBS domain	2e-04
pfam00571		57	pfam00571, CBS, CBS domain	3e-04
cd04627		123	cd04627, CBS_pair_14, The CBS domain, named after	3e-04
cd04630		114	cd04630, CBS_pair_17, The CBS domain, named after	4e-04
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	5e-04
cd04632		128	cd04632, CBS_pair_19, The CBS domain, named after	5e-04
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont	7e-04
cd04611		111	cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co	9e-04
COG2524		294	COG2524, COG2524, Predicted transcriptional regula	0.001
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	0.002
cd04605		110	cd04605, CBS_pair_MET2_assoc, This cd contains two	0.002
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	0.003
cd04595		110	cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con	0.003

>gnl\|CDD\|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

 Score =  130 bits (330), Expect = 1e-36
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 11/131 (8%)

Query: 338 RPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHINLS 397
           + +A  RP   L   L++LV+ +VS++PIVD+N  ++D+Y R D+  LAK+ AY   N  
Sbjct: 1   KNIATARPDTPLIDVLDMLVERRVSALPIVDENGKVVDVYSRFDVINLAKEGAY---NNL 57

Query: 398 EMTIHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVE 457
           ++T+ +AL+     +          + C P D L  + + +    V RLV+V+   KRVE
Sbjct: 58  DLTVGEALERRSQDFE-------GVRTCSPDDCLRTIFDLIVKARVHRLVVVDEN-KRVE 109

Query: 458 GIVSLSDIFKF 468
           GI+SLSDI +F
Sbjct: 110 GIISLSDILQF 120

CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 120

>gnl\|CDD\|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit	Back alignment and domain information

>gnl\|CDD\|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus	Back alignment and domain information

>gnl\|CDD\|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>gnl\|CDD\|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		471
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	99.95
cd02859		79	AMPKbeta_GBD_like AMP-activated protein kinase (AM	99.93
cd02861		82	E_set_proteins_like E or "early" set-like proteins	99.78
COG2524		294	Predicted transcriptional regulator, contains C-te	99.76
KOG1616		289	consensus Protein involved in Snf1 protein kinase	99.7
COG2524		294	Predicted transcriptional regulator, contains C-te	99.66
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.66
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.62
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	99.61
COG3620		187	Predicted transcriptional regulator with C-termina	99.61
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	99.58
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	99.57
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	99.56
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	99.54
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.52
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	99.52
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	99.52
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	99.52
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	99.51
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	99.5
KOG1764		381	consensus 5'-AMP-activated protein kinase, gamma s	99.49
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	99.48
PRK14869		546	putative manganese-dependent inorganic pyrophospha	99.48
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	99.48
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	99.48
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	99.48
COG3620		187	Predicted transcriptional regulator with C-termina	99.47
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	99.47
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	99.47
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	99.47
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	99.47
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	99.46
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	99.46
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	99.46
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	99.46
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	99.46
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	99.46
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	99.46
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	99.46
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	99.45
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	99.45
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	99.45
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	99.45
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	99.45
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	99.45
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	99.45
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	99.45
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	99.45
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	99.45
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	99.45
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	99.45
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	99.44
PRK14869		546	putative manganese-dependent inorganic pyrophospha	99.44
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	99.44
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	99.44
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	99.43
COG2905		610	Predicted signal-transduction protein containing c	99.43
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	99.43
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	99.43
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	99.42
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.42
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	99.42
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.42
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	99.41
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	99.41
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	99.41
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	99.41
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	99.41
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	99.4
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	99.4
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	99.4
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	99.39
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	99.39
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	99.39
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	99.37
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	99.37
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.37
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	99.37
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	99.37
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	99.36
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	99.36
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	99.36
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	99.36
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.36
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	99.36
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	99.35
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	99.35
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	99.34
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	99.34
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	99.33
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	99.33
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	99.33
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	99.33
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.33
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.33
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.32
cd02858		85	Esterase_N_term Esterase N-terminal domain. Estera	99.32
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	99.32
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	99.32
COG0517		117	FOG: CBS domain [General function prediction only]	99.31
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	99.31
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.31
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	99.3
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	99.3
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	99.3
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	99.29
COG4109		432	Predicted transcriptional regulator containing CBS	99.29
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	99.29
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.29
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	99.29
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	99.29
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	99.28
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	99.28
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	99.28
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	99.28
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	99.28
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.27
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.27
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	99.27
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	99.27
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	99.27
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	99.27
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	99.27
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	99.26
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	99.26
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	99.26
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	99.26
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	99.26
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.25
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	99.25
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	99.25
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	99.25
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	99.25
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	99.25
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	99.24
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	99.24
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	99.24
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	99.24
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	99.24
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	99.24
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	99.23
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	99.22
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	99.22
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	99.22
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	99.22
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	99.22
COG2905		610	Predicted signal-transduction protein containing c	99.22
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	99.21
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	99.21
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	99.21
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	99.2
COG0517		117	FOG: CBS domain [General function prediction only]	99.2
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	99.2
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	99.2
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	99.19
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	99.19
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	99.18
PRK11573		413	hypothetical protein; Provisional	99.17
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.17
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	99.16
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	99.15
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.15
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	99.15
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.14
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	99.14
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	99.13
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	99.13
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	99.13
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	99.11
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	99.1
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.1
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	99.1
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	99.09
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.08
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	99.07
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	99.04
COG4109		432	Predicted transcriptional regulator containing CBS	99.04
COG1253		429	TlyC Hemolysins and related proteins containing CB	98.99
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	98.95
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	98.94
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	98.92
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.9
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	98.88
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.86
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	98.84
PRK11573		413	hypothetical protein; Provisional	98.83
cd02688		83	E_set E or "early" set of sugar utilizing enzymes	98.81
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	98.79
cd02854		99	Glycogen_branching_enzyme_like_N_term Glycogen bra	98.75
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	98.67
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	98.66
COG1253		429	TlyC Hemolysins and related proteins containing CB	98.58
PF02922		85	CBM_48: Carbohydrate-binding module 48 (Isoamylase	98.53
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	98.53
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	98.41
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	98.4
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	98.39
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	98.36
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	98.21
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	98.1
KOG0474		762	consensus Cl- channel CLC-7 and related proteins (	98.09
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	97.87
cd02860		100	Pullulanase_N_term Pullulanase domain N-terminus.	97.86
PF00686		96	CBM_20: Starch binding domain; InterPro: IPR002044	97.86
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.82
cd02855		106	Glycogen_branching_enzyme_N_term Glycogen branchin	97.81
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	97.8
COG0296		628	GlgB 1,4-alpha-glucan branching enzyme [Carbohydra	97.73
cd05808		95	CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2	97.69
cd05814		120	CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-	97.68
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.64
PRK12568		730	glycogen branching enzyme; Provisional	97.52
cd02856		103	Glycogen_debranching_enzyme_N_term Glycogen_debran	97.51
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	97.51
PLN02447		758	1,4-alpha-glucan-branching enzyme	97.5
cd05809		99	CBM20_beta_amylase Beta-amylase, C-terminal CBM20	97.48
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	97.47
PRK12313		633	glycogen branching enzyme; Provisional	97.39
cd05820		103	CBM20_novamyl Novamyl (also known as acarviose tra	97.38
cd05818		92	CBM20_water_dikinase Phosphoglucan water dikinase	97.35
PRK14705		1224	glycogen branching enzyme; Provisional	97.34
PRK14706		639	glycogen branching enzyme; Provisional	97.27
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	97.1
cd05811		106	CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g	97.08
cd05813		95	CBM20_genethonin_1 Genethonin-1, C-terminal CBM20	97.0
PRK05402		726	glycogen branching enzyme; Provisional	96.99
cd02853		85	MTHase_N_term Maltooligosyl trehalose synthase (MT	96.96
cd02852		119	Isoamylase_N_term Isoamylase N-terminus domain. Is	96.91
cd05807		101	CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat	96.91
cd05810		97	CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol	96.84
cd05817		100	CBM20_DSP Dual-specificity phosphatase (DSP), N-te	96.83
KOG0475		696	consensus Cl- channel CLC-3 and related proteins (	96.73
cd05467		96	CBM20 The family 20 carbohydrate-binding module (C	96.68
TIGR02402		542	trehalose_TreZ malto-oligosyltrehalose trehalohydr	96.64
TIGR01515		613	branching_enzym alpha-1,4-glucan:alpha-1,4-glucan	96.58
cd05816		99	CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP	96.58
PRK05402		726	glycogen branching enzyme; Provisional	96.57
PF03423		87	CBM_25: Carbohydrate binding domain (family 25); I	95.83
cd05806		112	CBM20_laforin Laforin protein tyrosine phosphatase	95.65
cd05815		101	CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP	95.64
TIGR02104		605	pulA_typeI pullulanase, type I. Pullulan is an unu	95.47
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	95.36
KOG0476		931	consensus Cl- channel CLC-2 and related proteins (	95.26
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	95.07
PLN02960		897	alpha-amylase	94.87
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	94.55
PF11806		122	DUF3327: Domain of unknown function (DUF3327); Int	94.28
PLN02316		1036	synthase/transferase	94.27
PLN02316		1036	synthase/transferase	94.15
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	93.93
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	93.83
TIGR02100		688	glgX_debranch glycogen debranching enzyme GlgX. Th	93.54
PLN02950		909	4-alpha-glucanotransferase	93.4
TIGR02102		1111	pullulan_Gpos pullulanase, extracellular, Gram-pos	92.76
PLN02950		909	4-alpha-glucanotransferase	92.54
PRK03705		658	glycogen debranching enzyme; Provisional	92.01
TIGR02103		898	pullul_strch alpha-1,6-glucosidases, pullulanase-t	91.32
PRK10439		411	enterobactin/ferric enterobactin esterase; Provisi	88.96
PLN03244		872	alpha-amylase; Provisional	88.23
cd02857		116	CD_pullulan_degrading_enzymes_N_term CD and pullul	87.4
PRK14510		1221	putative bifunctional 4-alpha-glucanotransferase/g	86.91
KOG0470		757	consensus 1,4-alpha-glucan branching enzyme/starch	86.21
PLN02877		970	alpha-amylase/limit dextrinase	82.18

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

Probab=99.95  E-value=1.1e-26  Score=229.89  Aligned_cols=281  Identities=30%  Similarity=0.535  Sum_probs=232.1

Q ss_pred             eEEEEeCCCCHHHHHHHHHHcCCcccccccCCCCeeeeecchHHHHHHHHHhccCCCCCC-hhhHhhhcHHHHHHHHhhh
Q 012109          157 QVVALDIDLPVKQAFHILYEQGISMAPLWDFSKARFVGVLSASDFILILRELGNHGSNLT-EEELETHTISAWKEGKAYL  235 (471)
Q Consensus       157 ~vi~l~~~~sv~~A~~~m~~~~i~~~pV~d~~~~~~vGilt~~Di~~~l~~~~~~~~~~~-~~~l~~~~i~~~~~~~~~~  235 (471)
                      .+++++..+++.+|+.+|..++.+++|+||...++++|+++..|++.++...++.+.... .+.++...+..++....  
T Consensus        77 ~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~~~~~~g~~~~~d~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  154 (381)
T KOG1764|consen   77 KLVVFDTKLSVKKAFNALVQNGVRAAPLWDSKKQQFVGMLTITDFITVLLRYYKSKSSLDNIEVLEDSQLSKRREVEC--  154 (381)
T ss_pred             eeEEeeCCCcHHHHHHHHHhhceeeeccccCccceeEEEEEHHHHHHHHHHhhccCCcHHHHhhhhhhhccccchhhh--
Confidence            399999999999999999999999999999999999999999999999988876422221 22233333333332211  


Q ss_pred             ccccCCCCcccCCCceecCCCCCHHHHHHHHHhCCccEEEEEecCCCCCCCCeEEEeeehhhHHHHHhhhccccCCCCcc
Q 012109          236 NRQIDSHGKAFPRPLVYAGPNDNLKDVARKILHNEVATVPIIHSSSQDGSFPQLLHIASLSGILKCVCRYFRHCSSSLPI  315 (471)
Q Consensus       236 ~~~~~~~g~im~~~~v~v~~~~sl~~a~~~m~~~~~~~lpVvd~d~~~g~~~~l~Givt~~dil~~l~~~~~~~~~~~~~  315 (471)
                           ..+....++++.+.|..++.++...+.+++++++||.|  .+.+   .+.+++|++.|++++....+... +..+
T Consensus       155 -----~~~~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d--~~~~---~v~~ilt~~rIl~~l~~~~~~~~-~~~~  223 (381)
T KOG1764|consen  155 -----LLKETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVID--PETG---EVLYILTQRRILKFLWLNGRLLP-LPSL  223 (381)
T ss_pred             -----hhccccCCCceeecCcHHHHHHHHHHHhCCccceeeec--cccc---ceeeehhHHHHHHHHHHhhcccc-cHHH
Confidence                 11223455559999999999999999999999999994  4667   89999999999999987766544 4567


Q ss_pred             cccccccccccccccccCCCCCCCceEecCCCcHHHHHHHHHhcCCCEEEEEcCCCcEEEEEeHHHHHHHHhccccccCc
Q 012109          316 LKLPICAIPVGTWVPKIGEPNRRPLAMLRPSASLSAALNLLVQAQVSSIPIVDDNDSLLDIYCRSDITALAKDKAYAHIN  395 (471)
Q Consensus       316 ~~~~v~~~~i~~~~~~v~~~m~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g~lvGivt~~dl~~~~~~~~~~~l~  395 (471)
                      +..++.++.+++|.         .+..+..++++.+|+++|...+++++||+|+.|+.+|.++..|+..+...+.+..++
T Consensus       224 l~~s~~dl~ig~~~---------~i~~i~~~~~v~~al~~m~~~~is~lpvV~~~g~~v~~~s~~Dv~~l~~~~~~~~~~  294 (381)
T KOG1764|consen  224 LSKSLSDLGIGTWS---------NIASISEDTPVIEALKIMSERRISALPVVDENGKKVGNYSRFDVIHLAREGTYNNLD  294 (381)
T ss_pred             hhCCHHHhCcchhh---------hheeecCCCcHHHHHHHHHhcCcCcceEEcCCCceecceehhhhhhhhhcCccCccc
Confidence            88999999999987         588999999999999999999999999999999999999999999998887776654


Q ss_pred             ccccC-HHHHHhcCCCCCCcccccCCcceEeCCCCCHHHHHHHHHcCCCCEEEEEeCCCCeEEEEEehHHHHHHhh
Q 012109          396 LSEMT-IHQALQLGQDSYSPYELRSQRCQMCLPSDTLHKVMERLANPGVRRLVIVEAGSKRVEGIVSLSDIFKFLL  470 (471)
Q Consensus       396 ~~~~~-v~~~~~~~~~~~~~~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~l~Vvd~~~~~liGiIs~~Dil~~l~  470 (471)
                         .+ +.++...+.       .-...+++|+++++|.+++.+|..+++||+|||| ++|+++|+||++|++.+++
T Consensus       295 ---~~~l~~~~~~~~-------~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd-~~~~l~GvvSLsDil~~l~  359 (381)
T KOG1764|consen  295 ---LSCLSEALSHRP-------IRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVD-EDGVLVGVISLSDILSYLV  359 (381)
T ss_pred             ---hhHHHHHhhhcc-------cccCccEEEeecchHHHHHHHHHhcCceEEEEEc-CCCcEEEEeeHHHHHHHHH
Confidence               33 666654422       1134589999999999999999999999999999 5899999999999999885

>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD)	Back alignment and domain information

>cd02861 E_set_proteins_like E or "early" set-like proteins	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd02858 Esterase_N_term Esterase N-terminal domain	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd02860 Pullulanase_N_term Pullulanase domain N-terminus	Back alignment and domain information

>PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>PRK12568 glycogen branching enzyme; Provisional	Back alignment and domain information

>cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02447 1,4-alpha-glucan-branching enzyme	Back alignment and domain information

>cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12313 glycogen branching enzyme; Provisional	Back alignment and domain information

>cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>PRK14705 glycogen branching enzyme; Provisional	Back alignment and domain information

>PRK14706 glycogen branching enzyme; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>PRK05402 glycogen branching enzyme; Provisional	Back alignment and domain information

>cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain	Back alignment and domain information

>cd02852 Isoamylase_N_term Isoamylase N-terminus domain	Back alignment and domain information

>cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase)	Back alignment and domain information

>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase	Back alignment and domain information

>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase	Back alignment and domain information

>cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2	Back alignment and domain information

>PRK05402 glycogen branching enzyme; Provisional	Back alignment and domain information

>PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity	Back alignment and domain information

>cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain	Back alignment and domain information

>cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1	Back alignment and domain information

>TIGR02104 pulA_typeI pullulanase, type I	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02960 alpha-amylase	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase	Back alignment and domain information

>PLN02316 synthase/transferase	Back alignment and domain information

>PLN02316 synthase/transferase	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX	Back alignment and domain information

>PLN02950 4-alpha-glucanotransferase	Back alignment and domain information

>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive	Back alignment and domain information

>PLN02950 4-alpha-glucanotransferase	Back alignment and domain information

>PRK03705 glycogen debranching enzyme; Provisional	Back alignment and domain information

>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type	Back alignment and domain information

>PRK10439 enterobactin/ferric enterobactin esterase; Provisional	Back alignment and domain information

>PLN03244 alpha-amylase; Provisional	Back alignment and domain information

>cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain	Back alignment and domain information

>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional	Back alignment and domain information

>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02877 alpha-amylase/limit dextrinase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		471
2v8q_E		330	Crystal Structure Of The Regulatory Fragment Of Mam		9e-26
1z0m_A		96	The Glycogen-Binding Domain Of The Amp-Activated Pr		5e-16
1z0n_A		96	The Glycogen-Binding Domain Of The Amp-Activated Pr		9e-16
2oox_G		333	Crystal Structure Of The Adenylate Sensor From Amp-		1e-15
2qr1_G		334	Crystal Structure Of The Adenylate Sensor From Amp-		1e-15
3t4n_C		323	Structure Of The Regulatory Fragment Of Saccharomyc		1e-15
2qlv_C		315	Crystal Structure Of The Heterotrimer Core Of The S		2e-15
2f15_A		96	Glycogen-Binding Domain Of The Amp-Activated Protei		5e-14
2uv5_A		152	Crystal Structure Of A Cbs Domain Pair From The Reg		3e-08
2uv6_A		152	Crystal Structure Of A Cbs Domain Pair From The Reg		1e-07
2qlv_B		252	Crystal Structure Of The Heterotrimer Core Of The S		3e-07
2uv7_A		152	Crystal Structure Of A Cbs Domain Pair From The Reg		3e-07
2nyc_A		144	Crystal Structure Of The Bateman2 Domain Of Yeast S		1e-06
2nye_A		144	Crystal Structure Of The Bateman2 Domain Of Yeast S		1e-05
3nme_A		294	Structure Of A Plant Phosphatase Length = 294		5e-05

>pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330