Citrus Sinensis ID: 012173

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MRLQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFFGSNMEVATTSK
cccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEcccccccccccccccccEEEEEcccccccccccEEEEEEEEEEEcccccccccccccEEEEEEEccccccEEEEEccccccccccEEEEEEEcccccccccccccccEEEEEEEccccEEEcccccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccEEccccc
ccccccccccHcccccccEEEEcccccccccccHHHHcccccEEEccccccHHcccHHHcccccccEEEcccccHHHHccHHHccHHHccEEEccccccccccccHcccccccEEEccccccccccccccccHEEEccccccccccccccccccccEEEcccccccHcccccHHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEEccccccccccccccccccccEEEccccHHHHcccccHHHHHHHHHHHHHccccccccccccccccccHHHcccccccEEEEEccccccccccccEEEEEEEEEcccccccccccccEEEEEEEEcccccEEEcccccccccccccEEEEEEccccccccccccccccccEEEEEEEEEEEEEccccccEEEEEcEEEEEEEccccccccccccEEccccccEEEccccccccccccccccc
MRLQLKKFPQIVTTMKDlselnldgtsitevpssiellpglellnlndcknlarvpssinglkspktlnlsgccklenvpdtlgqvesleeldisetavrrppssifLMKNLRTLslfgcngppswhlhlpfnlmgkSSCLVALMlpslsglrsltkldlsdcglgegaipsdignlhSLNELYlsknnfvtLPASINSLLNLKELEMEDCkrlqslpqlppniifVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVsdplkdfstvvpeskipkwfmyqnegpsitvtrpsylynMNKIVGYAICCVFHVRRYSTRIKKRRHSYELqccmdgsdrgffitfggkfshsgsDHLWLLFLSRRecydrrwifesnhfklsfndarekydlagsgtglkvkrcgfhpvymhEVEELDqttkqwthftsyslyesdhdffgsnmevattsk
MRLQLKKFPQIVTTmkdlselnldgTSITEVPSSIELLPGLELLNLNDCKNLARVPssinglkspktlnLSGCCKLENVPDTLGQVESLeeldisetavrrppssIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFesnhfklsfndaREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFFGSNMEVATTSK
MRLQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIellpglellnlnDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFFGSNMEVATTSK
**********IVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDI*********SSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFF***********
*RLQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMH***************************************
MRLQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFFGSNMEVATTSK
****LKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEV*************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALKLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECYDRRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFTSYSLYESDHDFFGSNMEVATTSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query469 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.650 0.266 0.338 5e-38
P0CB161201 Putative disease resistan no no 0.422 0.164 0.301 3e-16
Q9SZ671895 Probable WRKY transcripti no no 0.232 0.057 0.428 4e-13
Q1ZXD6 2800 Probable serine/threonine yes no 0.392 0.065 0.315 9e-11
A4IIK1 997 Malignant fibrous histioc no no 0.405 0.190 0.287 2e-09
O825001095 Putative disease resistan no no 0.607 0.260 0.240 4e-09
Q80U72 1612 Protein scribble homolog yes no 0.402 0.117 0.268 4e-09
Q14160 1630 Protein scribble homolog yes no 0.402 0.115 0.268 4e-09
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.321 0.147 0.293 6e-09
P93194 1109 Receptor-like protein kin N/A no 0.377 0.159 0.313 6e-09
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  159 bits (401), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 170/331 (51%), Gaps = 26/331 (7%)

Query: 5    LKKFPQIVTTMKDLSELNLDGTSITEVPSSI-ELLPGLELLNLNDCKNLARVPSSINGLK 63
            L+K P+I   MK   ++++ G+ I E+PSSI +    +  L L + KNL  +PSSI  LK
Sbjct: 701  LEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLK 760

Query: 64   SPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGP 123
            S  +L++SGC KLE++P+ +G +++L   D S+T + RPPSSI  +  L  L   G    
Sbjct: 761  SLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKD- 819

Query: 124  PSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNEL 183
               H   P               P   GL SL  L+LS C L +G +P +IG+L SL +L
Sbjct: 820  -GVHFEFP---------------PVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKL 863

Query: 184  YLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVTLLGALK 243
             LS+NNF  LP+SI  L  L+ L+++DC+RL  LP+LPP +  + V+ C   +  +  L 
Sbjct: 864  DLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVD-CHMALKFIHYLV 922

Query: 244  LCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSD-------PLKDFSTVVPESKIPK 296
              +     ++  D+      N +A  M +       D        L  F+      KIP 
Sbjct: 923  TKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPS 982

Query: 297  WFMYQNEGPSITVTRPSYLYNMNKIVGYAIC 327
            WF +Q    S++V  P   Y  +K +G+A+C
Sbjct: 983  WFHHQGWDSSVSVNLPENWYIPDKFLGFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 Back     alignment and function description
>sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.899 0.350 0.422 6e-75
224146780540 predicted protein [Populus trichocarpa] 0.880 0.764 0.424 8e-73
359496026 1250 PREDICTED: TMV resistance protein N-like 0.882 0.331 0.406 6e-65
296090591 771 unnamed protein product [Vitis vinifera] 0.882 0.536 0.404 8e-65
255561514 994 leucine-rich repeat-containing protein, 0.914 0.431 0.370 9e-64
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.810 0.339 0.395 1e-63
224114311 1144 tir-nbs-lrr resistance protein [Populus 0.897 0.368 0.373 2e-63
224126507 1741 tir-nbs-lrr resistance protein [Populus 0.855 0.230 0.393 3e-63
359493273 1233 PREDICTED: TMV resistance protein N-like 0.886 0.337 0.373 3e-63
224116210 1017 tir-nbs-lrr resistance protein [Populus 0.795 0.366 0.393 1e-60
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  287 bits (735), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 192/454 (42%), Positives = 272/454 (59%), Gaps = 32/454 (7%)

Query: 4    QLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLK 63
            +LK+FP+I    K L +L LD TSI E+P SI+ L GL  L+L DCK L+ +PSSINGLK
Sbjct: 725  KLKEFPEIEGNKKCLRKLCLDQTSIEELPPSIQYLVGLISLSLKDCKKLSCLPSSINGLK 784

Query: 64   SPKTLNLSGCCKLENVPDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGP 123
            S KTL+LSGC +LEN+P+  GQ+E L ELD+S TA+R PP SIF +KNL+ LS  GC   
Sbjct: 785  SLKTLHLSGCSELENLPENFGQLECLNELDVSGTAIREPPVSIFSLKNLKILSFHGCAES 844

Query: 124  PS-----WHLHLPFNLM-GKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNL 177
                   W   L F LM GK +   +L+LPSLSGL SLT+L LS+C LGEGA+P+DIG L
Sbjct: 845  SRSTTNIWQ-RLMFPLMPGKRANSTSLVLPSLSGLSSLTRLGLSNCNLGEGAVPNDIGYL 903

Query: 178  HSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPNIIFVKVNGCSSLVT 237
             SL +L LS+N FV+LP SI+ L  L+ L MEDCK LQSLP+LP N+   +VNGC+SL  
Sbjct: 904  SSLRQLNLSRNKFVSLPTSIDQLSGLQFLRMEDCKMLQSLPELPSNLEEFRVNGCTSLEK 963

Query: 238  LLGALKLCKSNGIVIESIDSLKLLGNNGWAIL---MLREYLEAVSDPLKDFSTVVPESKI 294
            +  + KLC+ N +    I+  +L  ++ W  +   +LR+  +   + ++ FS ++P S+I
Sbjct: 964  MQFSRKLCQLNYLRYLFINCWRLSESDCWNNMFPTLLRKCFQGPPNLIESFSVIIPGSEI 1023

Query: 295  PKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVRRYSTRIKKRRHSYELQCCMDG 354
            P WF +Q+EG S++V  P + +  ++ +GYA+C       +   + +      +QC  +G
Sbjct: 1024 PTWFSHQSEGSSVSVQTPPHSHENDEWLGYAVCASLGYPDFPPNVFRS----PMQCFFNG 1079

Query: 355  S-DRGFFITFGGKFSHSGSDHLWLLFL-SRRECYDRRWIFESNHFKLSFNDAREKYDLAG 412
              +    I    K     SDHLW L+  SR + +DR       H +  F D         
Sbjct: 1080 DGNESESIYVRLKPCEILSDHLWFLYFPSRFKRFDR-------HVRFRFED--------- 1123

Query: 413  SGTGLKVKRCGFHPVYMHEVEELDQTTKQWTHFT 446
            + +  KV +CG   VY  +VEEL++ T  + + T
Sbjct: 1124 NCSQTKVIKCGVRLVYQQDVEELNRMTNLYENST 1157

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561514|ref|XP_002521767.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223538980|gb|EEF40577.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126507|ref|XP_002319855.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222858231|gb|EEE95778.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116210|ref|XP_002331988.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832112|gb|EEE70589.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.863 0.312 0.294 3.9e-27
TAIR|locus:21674571191 AT5G36930 [Arabidopsis thalian 0.554 0.218 0.362 4.8e-27
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.861 0.328 0.263 6.8e-21
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.729 0.280 0.293 2.5e-20
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.605 0.239 0.319 3.1e-20
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.680 0.278 0.303 2.4e-19
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.767 0.305 0.263 1.5e-18
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.635 0.215 0.262 5.3e-17
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.639 0.250 0.281 7.2e-17
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.635 0.191 0.256 4.7e-16
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 3.9e-27, P = 3.9e-27
 Identities = 133/451 (29%), Positives = 215/451 (47%)

Query:     3 LQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIXXXXXXXXXXXXDCKNLARVPSSINGL 62
             L + +FP++ T+++    L +  TSI E+P+ I            + K LA +P SI+ L
Sbjct:   798 LNVNEFPRVSTSIE---VLRISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISEL 854

Query:    63 KSPKTLNLSGCCKLENVPDTLGQVES-LEELDISETAVRRPPSSIFLMKNLRTL--SLFG 119
             +S + L LSGC  LE+ P  + Q  S L   D+  T+++  P +I  +  L  L  S   
Sbjct:   855 RSLEKLKLSGCSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTV 914

Query:   120 CNGPPSWHL----HLPFNLMGKS----SCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIP 171
                 P W +     L    +G S      L+  + P LS    L  L LS+  + E  IP
Sbjct:   915 IRRAP-WSIARLTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTE--IP 971

Query:   172 SDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLP-QLPPNIIFVKVN 230
             + IGNL +L EL LS NNF  +PASI  L  L  L + +C+RLQ+LP +LP  ++++ ++
Sbjct:   972 NSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIH 1031

Query:   231 GCSSLVTLLGAL-KLCKSNGIVIESIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVV 289
              C+SLV++ G   + C     ++ S +  KL   +  A +++   L+  S   K   +  
Sbjct:  1032 SCTSLVSISGCFNQYCLRK--LVAS-NCYKL---DQAAQILIHRNLKLES--AKPEHSYF 1083

Query:   290 PESKIPKWFMYQNEGPSITVTRPSYLYNMNKIVGYAICCVFHVR-RYSTRIKKRRHSYEL 348
             P S IP  F +Q  GPS+ +  P    + + I+G++ C +  V  +Y     K   S  L
Sbjct:  1084 PGSDIPTCFNHQVMGPSLNIQLPQS-ESSSDILGFSACIMIGVDGQYPMNNLKIHCSCIL 1142

Query:   349 Q----CCMDGSDRGFFITFGGKFSHS--GSDHLWLLFLSRRECYDRRWIFESNHFKLSF- 401
             +    C +   D  ++      F++   GSDHL LLF   R C       E+  F+ S  
Sbjct:  1143 KDADACELVVMDEVWYPD-PKAFTNMYFGSDHL-LLF--SRTCTSMEAYSEAL-FEFSVE 1197

Query:   402 NDAREKYDLAGSGTGLKVKRCGFHPVYMHEV 432
             N   + +   G     +VK+C  H + + ++
Sbjct:  1198 NTEGDSFSPLG-----EVKKCAVHLISLKDM 1223
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01250006
tir-nbs-lrr resistance protein (1203 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-18
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-15
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 88.0 bits (218), Expect = 2e-18
 Identities = 77/252 (30%), Positives = 119/252 (47%), Gaps = 42/252 (16%)

Query: 4   QLKKFPQIVTTMKDLSELNLDGT-SITEVPSSIELLPGLELLNLNDCKNLARVPSSINGL 62
           +L+K    V ++  L  ++L G+ ++ E+P  + +   LE L L+DC +L  +PSSI  L
Sbjct: 622 KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYL 680

Query: 63  KSPKTLNLSGCCKLENVP-----DTLGQVE---------------SLEELDISETAVRRP 102
              + L++S C  LE +P      +L ++                ++  LD+ ETA+   
Sbjct: 681 NKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEF 740

Query: 103 PSSIFLMKNLRTLSLFGCNGPPSWHLHLPFN-LMGKSSCLVALMLPSLSGLRSLTKLDLS 161
           PS++ L +NL  L L        W    P   LM         ML       SLT+L LS
Sbjct: 741 PSNLRL-ENLDELILCEMKSEKLWERVQPLTPLMT--------MLSP-----SLTRLFLS 786

Query: 162 DC-GLGEGAIPSDIGNLHSLNELYLSK-NNFVTLPASINSLLNLKELEMEDCKRLQSLPQ 219
           D   L E  +PS I NLH L  L +    N  TLP  IN L +L+ L++  C RL++ P 
Sbjct: 787 DIPSLVE--LPSSIQNLHKLEHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFPD 843

Query: 220 LPPNIIFVKVNG 231
           +  NI  + ++ 
Sbjct: 844 ISTNISDLNLSR 855

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 469
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.5
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.5
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.47
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.29
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.08
KOG4237498 consensus Extracellular matrix protein slit, conta 98.83
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.81
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
PRK15386426 type III secretion protein GogB; Provisional 98.66
PRK15386426 type III secretion protein GogB; Provisional 98.66
PLN03150623 hypothetical protein; Provisional 98.61
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.58
PLN03150623 hypothetical protein; Provisional 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.37
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.11
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.83
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.56
KOG4341483 consensus F-box protein containing LRR [General fu 97.48
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.42
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.62
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.49
KOG4341483 consensus F-box protein containing LRR [General fu 96.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.98
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.84
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.8
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.6
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.91
smart0037026 LRR Leucine-rich repeats, outliers. 88.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.4
smart0037026 LRR Leucine-rich repeats, outliers. 87.4
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.04
KOG4308478 consensus LRR-containing protein [Function unknown 83.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.21
KOG4308478 consensus LRR-containing protein [Function unknown 82.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.0
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=3e-35  Score=331.82  Aligned_cols=400  Identities=20%  Similarity=0.307  Sum_probs=233.8

Q ss_pred             cCcccchhcCCCCCCcEEeeeccCCcccCcccCCCCCCCEEeccCCCCCcccCccCCCCCCCCEEEeeCCCCCccccccc
Q 012173            4 QLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDTL   83 (469)
Q Consensus         4 ~L~~lp~~~~~l~~L~~L~L~~~~l~~lp~~i~~l~~L~~L~L~~c~~l~~lp~~i~~L~sL~~L~Ls~c~~l~~lp~~l   83 (469)
                      .++.+|..+ ...+|+.|+|.++++..+|..++.+++|+.|+|++|..+..+|. +..+++|++|++++|..+..+|..+
T Consensus       600 ~l~~lP~~f-~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si  677 (1153)
T PLN03210        600 PLRCMPSNF-RPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSI  677 (1153)
T ss_pred             CCCCCCCcC-CccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhh
Confidence            445555554 34566666666666655555555566666666665555555554 5555566666666665555555555


Q ss_pred             cCCCCcCEEeccCc-CCCCCCccccCCcCCceeeccCCCCCCCcc------------------C----------------
Q 012173           84 GQVESLEELDISET-AVRRPPSSIFLMKNLRTLSLFGCNGPPSWH------------------L----------------  128 (469)
Q Consensus        84 ~~l~~L~~L~L~~~-~i~~lp~~l~~l~~L~~L~l~~~~~~~~~~------------------~----------------  128 (469)
                      +++++|+.|++++| .+..+|..+ ++++|+.|++++|..+...+                  +                
T Consensus       678 ~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~  756 (1153)
T PLN03210        678 QYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCE  756 (1153)
T ss_pred             hccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccc
Confidence            55566666666554 344455433 45555555555543211000                  0                


Q ss_pred             --------------------cccccccCCccc-cccccCCCCCCCCCCCEEEccCCCCCCCCCCCCC-------------
Q 012173          129 --------------------HLPFNLMGKSSC-LVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDI-------------  174 (469)
Q Consensus       129 --------------------~~~~~~~~~~~~-~~~~~~~~l~~l~~L~~L~Ls~~~l~~~~~p~~l-------------  174 (469)
                                          ...+..+....+ ....+|.+++.+++|+.|++++|... ..+|..+             
T Consensus       757 ~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L-~~LP~~~~L~sL~~L~Ls~c  835 (1153)
T PLN03210        757 MKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINL-ETLPTGINLESLESLDLSGC  835 (1153)
T ss_pred             cchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCc-CeeCCCCCccccCEEECCCC
Confidence                                000111112222 23445677777888888888777532 2344332             


Q ss_pred             -------CCCCCCcEEEcCCCCCcccCccccCCCCcCEEeccCCcccCcCCCCC---CCccEEEecCCCCCcccccchhh
Q 012173          175 -------GNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLP---PNIIFVKVNGCSSLVTLLGALKL  244 (469)
Q Consensus       175 -------~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~c~~L~~lp~lp---~~L~~L~i~~C~~L~~l~~~~~~  244 (469)
                             ....+|+.|+|++|.++.+|.++..+++|+.|++++|++++.+|..+   ++|+.+++.+|.+|+.++.....
T Consensus       836 ~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~  915 (1153)
T PLN03210        836 SRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSP  915 (1153)
T ss_pred             CccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCc
Confidence                   11245777777778888899999999999999999999999988654   56788899999999876542110


Q ss_pred             h------cccccchh------hhhhHhhhccchHHHHHHHHHHhhccCCCCceEEEcCCCCCCCccccCCCCCeEE-EEc
Q 012173          245 C------KSNGIVIE------SIDSLKLLGNNGWAILMLREYLEAVSDPLKDFSTVVPESKIPKWFMYQNEGPSIT-VTR  311 (469)
Q Consensus       245 ~------~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~si~-i~l  311 (469)
                      .      .++.....      ..+|.+ +....        .++.   ......+++||.++|+||.||+.|++++ |++
T Consensus       916 ~~~~~~~~n~~~~~p~~~~l~f~nC~~-L~~~a--------~l~~---~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l  983 (1153)
T PLN03210        916 SEVAMATDNIHSKLPSTVCINFINCFN-LDQEA--------LLQQ---QSIFKQLILSGEEVPSYFTHRTTGASLTNIPL  983 (1153)
T ss_pred             hhhhhhcccccccCCchhccccccccC-CCchh--------hhcc---cccceEEECCCccCchhccCCcccceeeeecc
Confidence            0      00000000      000000 11000        1111   1123467899999999999999999998 999


Q ss_pred             CCCCcCCCceeeEEEEEEEeeeccccccc-ccCCCceeeEEEecCCCCceEEeccCcccCCCCeEEEEEeeccccc----
Q 012173          312 PSYLYNMNKIVGYAICCVFHVRRYSTRIK-KRRHSYELQCCMDGSDRGFFITFGGKFSHSGSDHLWLLFLSRRECY----  386 (469)
Q Consensus       312 p~~~~~~~~~~gfa~c~v~~~~~~~~~~~-~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~sdh~~l~~~~~~~~~----  386 (469)
                      |+.|+ ...+.||++|+|+   +...... ...+.+.+.|.+.+ ..+..+.      ....+|+|+.|.....+.    
T Consensus       984 ~~~~~-~~~~~~f~~c~v~---~~~~~~~~~~~~~~~~~c~~~~-~~~~~~~------~~~~~~~~~~~~~~~~l~~~~~ 1052 (1153)
T PLN03210        984 LHISP-CQPFFRFRACAVV---DSESFFIISVSFDIQVCCRFID-RLGNHFD------SPYQPHVFSVTKKGSHLVIFDC 1052 (1153)
T ss_pred             CCccc-CCCccceEEEEEE---ecCccccCCCceeEEEEEEEEC-CCCCccc------cCCCceeEeeeccccceEEecc
Confidence            99998 6789999999999   3333211 22345678888877 4443332      124456665555421110    


Q ss_pred             ------c--cccccccceEEEEEecccccccccCCCCCceEEEecceEEeecccccccc
Q 012173          387 ------D--RRWIFESNHFKLSFNDAREKYDLAGSGTGLKVKRCGFHPVYMHEVEELDQ  437 (469)
Q Consensus       387 ------~--~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~vk~cGv~liy~~~~~~~~~  437 (469)
                            +  ......++|+++.|...    .   ....++||+|||+++|+++..+...
T Consensus      1053 ~~~~~~~~~~~~~~~~~~~~~~f~~~----~---~~~~~~~~~cg~~~~~~~~~~~~~~ 1104 (1153)
T PLN03210       1053 CFPLNEDNAPLAELNYDHVDIQFRLT----N---KNSQLKLKGCGIRLSEDDSSLNNTL 1104 (1153)
T ss_pred             cccccccccchhccCCceeeEEEEEe----c---CCCCeEEEeeeEEEeccCCCcccCC
Confidence                  0  01122467877777621    1   1224799999999999776555433

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-06
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 98/238 (41%), Gaps = 38/238 (15%)
Query: 5   LKKFPQIVTTMKDLSELNLDGTSITEVPSSIXXXXXXXXXXXXDCKNLAR-VPSSINGLK 63
           L +FP     +  L    +D   + E+P +               +N  R +P+SI  L 
Sbjct: 93  LPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTL--ARNPLRALPASIASLN 150
Query: 64  SPKTLNLSGCCKLENVPDTLGQVES---------LEELDISETAVRRPPSSIFLMKNLRT 114
             + L++  C +L  +P+ L   ++         L+ L +  T +R  P+SI  ++NL++
Sbjct: 151 RLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKS 210
Query: 115 LSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDI 174
           L +             P + +G          P++  L  L +LDL  C       P   
Sbjct: 211 LKIRNS----------PLSALG----------PAIHHLPKLEELDLRGCTALRN-YPPIF 249
Query: 175 GNLHSLNELYLSK-NNFVTLPASINSLLNLKELEMEDCKRLQSLP----QLPPNIIFV 227
           G    L  L L   +N +TLP  I+ L  L++L++  C  L  LP    QLP N I +
Sbjct: 250 GGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIIL 307
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  157 bits (398), Expect = 3e-44
 Identities = 60/230 (26%), Positives = 98/230 (42%), Gaps = 32/230 (13%)

Query: 4   QLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLK 63
            L +FP     +  L  + +D   + E+P +++   GLE L L     L  +P+SI  L 
Sbjct: 92  PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIASLN 150

Query: 64  SPKTLNLSGCCKLENVPDTLGQVE---------SLEELDISETAVRRPPSSIFLMKNLRT 114
             + L++  C +L  +P+ L   +         +L+ L +  T +R  P+SI  ++NL++
Sbjct: 151 RLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKS 210

Query: 115 LSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDI 174
           L +                       L AL  P++  L  L +LDL  C       P   
Sbjct: 211 LKIRNSP-------------------LSAL-GPAIHHLPKLEELDLRGCTALRN-YPPIF 249

Query: 175 GNLHSLNELYLS-KNNFVTLPASINSLLNLKELEMEDCKRLQSLPQLPPN 223
           G    L  L L   +N +TLP  I+ L  L++L++  C  L  LP L   
Sbjct: 250 GGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ 299
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.84
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.76
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.75
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.74
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.66
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.58
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.55
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.39
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.3
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.29
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.25
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.88
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.78
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.78
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.67
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.88
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.85
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.6
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.29
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.05
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.92  E-value=3e-25  Score=217.65  Aligned_cols=195  Identities=28%  Similarity=0.514  Sum_probs=117.9

Q ss_pred             CcCcccchhcCCCCCCcEEeeeccCCcccCcccCCCCCCCEEeccCCCCCcccCccCCCCCCCCEEEeeCCCCCcccccc
Q 012173            3 LQLKKFPQIVTTMKDLSELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPDT   82 (469)
Q Consensus         3 ~~L~~lp~~~~~l~~L~~L~L~~~~l~~lp~~i~~l~~L~~L~L~~c~~l~~lp~~i~~L~sL~~L~Ls~c~~l~~lp~~   82 (469)
                      ++++.+|..++++++|++|+|++|.++.+|..++.+++|++|+|++|. +..+|..+.++++|++|++++|..++.+|..
T Consensus        91 n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~-l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~  169 (328)
T 4fcg_A           91 VPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEP  169 (328)
T ss_dssp             SCCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCC-CCCCCGGGGGCTTCCEEEEEEETTCCCCCSC
T ss_pred             CCchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCc-cccCcHHHhcCcCCCEEECCCCCCccccChh
Confidence            445566665555666666666666666666666666666666666654 3356666666666666666666666666655


Q ss_pred             ccC---------CCCcCEEeccCcCCCCCCccccCCcCCceeeccCCCCCCCccCcccccccCCccccccccCCCCCCCC
Q 012173           83 LGQ---------VESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLR  153 (469)
Q Consensus        83 l~~---------l~~L~~L~L~~~~i~~lp~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~  153 (469)
                      ++.         +++|++|++++|.+..+|..++.+++|++|++++|...                    .+++.+..++
T Consensus       170 ~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~--------------------~l~~~l~~l~  229 (328)
T 4fcg_A          170 LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLS--------------------ALGPAIHHLP  229 (328)
T ss_dssp             SEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCC--------------------CCCGGGGGCT
T ss_pred             HhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCC--------------------cCchhhccCC
Confidence            443         66666666666666666666666666666666665411                    1234455566


Q ss_pred             CCCEEEccCCCCCCCCCCCCCCCCCCCcEEEcCCCCCc-ccCccccCCCCcCEEeccCCcccCcCCC
Q 012173          154 SLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFV-TLPASINSLLNLKELEMEDCKRLQSLPQ  219 (469)
Q Consensus       154 ~L~~L~Ls~~~l~~~~~p~~l~~l~~L~~L~L~~n~l~-~lp~~i~~l~~L~~L~L~~c~~L~~lp~  219 (469)
                      +|++|++++|++. +.+|..++.+++|+.|+|++|++. .+|..+..+++|+.|+|++|+.++.+|.
T Consensus       230 ~L~~L~Ls~n~~~-~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~  295 (328)
T 4fcg_A          230 KLEELDLRGCTAL-RNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPS  295 (328)
T ss_dssp             TCCEEECTTCTTC-CBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCG
T ss_pred             CCCEEECcCCcch-hhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccH
Confidence            6666666666554 455666666666666666665444 4555666666666666666666655553
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 469
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 60.0 bits (144), Expect = 2e-10
 Identities = 32/191 (16%), Positives = 67/191 (35%), Gaps = 9/191 (4%)

Query: 20  ELNLDGTSITEVPSSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENV 79
            L      I+++   + +L  L+ L+L    N  +   ++  L +   L+L+   ++ N+
Sbjct: 201 SLIATNNQISDITP-LGILTNLDELSL--NGNQLKDIGTLASLTNLTDLDLANN-QISNL 256

Query: 80  PDTLGQVESLEELDISETAVRRPPSSIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSS 139
              L  +  L EL +    +        L                S   +L         
Sbjct: 257 AP-LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLY 315

Query: 140 CLVALMLPSLSGLRSLTKLDLSDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINS 199
                 +  +S L  L +L  ++  + +    S + NL ++N L    N    L   + +
Sbjct: 316 FNNISDISPVSSLTKLQRLFFANNKVSD---VSSLANLTNINWLSAGHNQISDLTP-LAN 371

Query: 200 LLNLKELEMED 210
           L  + +L + D
Sbjct: 372 LTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.11
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.83  E-value=1.5e-19  Score=169.39  Aligned_cols=185  Identities=23%  Similarity=0.235  Sum_probs=119.3

Q ss_pred             CcCcccchhcCCCCCCcEEeeeccCCcccC-cccCCCCCCCEEeccCCCCCcccCccCCCCCCCCEEEeeCCCCCccccc
Q 012173            3 LQLKKFPQIVTTMKDLSELNLDGTSITEVP-SSIELLPGLELLNLNDCKNLARVPSSINGLKSPKTLNLSGCCKLENVPD   81 (469)
Q Consensus         3 ~~L~~lp~~~~~l~~L~~L~L~~~~l~~lp-~~i~~l~~L~~L~L~~c~~l~~lp~~i~~L~sL~~L~Ls~c~~l~~lp~   81 (469)
                      +.|+++|+.++  ++|++|+|++|+|+.+| ..+.++++|++|+|++|. +..+|. ++.+++|++|++++| .+...+.
T Consensus        20 ~~L~~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~-l~~l~~-~~~l~~L~~L~Ls~N-~l~~~~~   94 (266)
T d1p9ag_          20 RNLTALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAE-LTKLQV-DGTLPVLGTLDLSHN-QLQSLPL   94 (266)
T ss_dssp             SCCSSCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSC-CCEEEC-CSCCTTCCEEECCSS-CCSSCCC
T ss_pred             CCCCeeCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccccc-cccccc-ccccccccccccccc-ccccccc
Confidence            45666776543  56777777777777665 346777777777777764 556654 456777777777775 4555566


Q ss_pred             cccCCCCcCEEeccCcCCCCCCc-cccCCcCCceeeccCCCCCCCccCcccccccCCccccccccCCCCCCCCCCCEEEc
Q 012173           82 TLGQVESLEELDISETAVRRPPS-SIFLMKNLRTLSLFGCNGPPSWHLHLPFNLMGKSSCLVALMLPSLSGLRSLTKLDL  160 (469)
Q Consensus        82 ~l~~l~~L~~L~L~~~~i~~lp~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~L  160 (469)
                      .+..+++|+.|+++++.+..++. ....+.+++.|++.+|...                   ...+..+..+++|+.|++
T Consensus        95 ~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~-------------------~l~~~~~~~l~~l~~l~l  155 (266)
T d1p9ag_          95 LGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELK-------------------TLPPGLLTPTPKLEKLSL  155 (266)
T ss_dssp             CTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCC-------------------CCCTTTTTTCTTCCEEEC
T ss_pred             ccccccccccccccccccceeeccccccccccccccccccccc-------------------eeccccccccccchhccc
Confidence            66677777777777776665533 3445667777777665421                   111334455677777777


Q ss_pred             cCCCCCCCCCCCCCCCCCCCcEEEcCCCCCcccCccccCCCCcCEEeccCCc
Q 012173          161 SDCGLGEGAIPSDIGNLHSLNELYLSKNNFVTLPASINSLLNLKELEMEDCK  212 (469)
Q Consensus       161 s~~~l~~~~~p~~l~~l~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~L~~c~  212 (469)
                      ++|++. ...+..+..+++|+.|+|++|+++.+|..+..+++|+.|+|++++
T Consensus       156 ~~N~l~-~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~Np  206 (266)
T d1p9ag_         156 ANNNLT-ELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNP  206 (266)
T ss_dssp             TTSCCS-CCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEECCSCC
T ss_pred             cccccc-ccCccccccccccceeecccCCCcccChhHCCCCCCCEEEecCCC
Confidence            777765 333445666777777777777777777777777777777777663
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure