Citrus Sinensis ID: 012249


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
ccHHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccccccHHccccccccccccccccccccEEEccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEcccccccccccccccccHHHHHcccccccccccccccEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEccHHcccccccccccccccccccEEc
ccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHEEEHHccccccccccccccccccEEEEEccccccccccHHHHHHccccEEEEccccccHHccccHHHHHHHHEEEccccccccccHHHHHHHHHcEEEcccccHHHccHHHHHHHHcEEEEccccccccccccHHHHHHHHcEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEccccccHHHHHHHHHccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHcccccHccccccccccccccccccccccccccccccccEEEEEEccccHccccHHHHccccccccEEEEcccHHHHHEEcccccccccccccccccccccccHHEEEEEcccccHHHHccccccccccccEEEEEEccHHHcccccccHHHHccccccccccEEEEccHHHHHHcccccHHHHHHccccccc
MHDLIRDMALRITSKSPLFMVKAGLrllefpgeqeWEENLERVSLMRNNieeipsnmsphCEILSTLLLQRNENLQRIPECFFVHMHGlkvvnlsstdievlpssvsdltnlrslslgwcrrlkrvPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSlqlkkfpagilprLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIyvkstdgrgsknYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVdevtslndvlprelglvnigkfshdlkvlrfdscknlknlfslrllpalqnLKVLAVISCNSIEEivavededtekelatntiintvtlprlkklrfydlpefksfcsyngvlvcnslqeievrrcpklkrlslslplldhgqpsppaALKVIKIEKELWESLDWDQANAKEVLNSYCKF
MHDLIRDMAlritsksplfMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVlpssvsdltnlrslslgwcrrlkrvPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIvavededtekelatntiintvtlprlkkLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSlplldhgqpspPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSlarllalqyldlydTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRrcpklkrlslslpllDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
*******MALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEI***MSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDH******AALKVIKIEKELWESLDWDQANAKEVLN*****
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDE**************VTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVE*************INTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIEKELWESLDWDQANAKEVLNSYCKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query467 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.867 0.440 0.302 2e-37
Q9T048985 Disease resistance protei no no 0.905 0.429 0.283 3e-28
Q9C8T9898 Putative disease resistan no no 0.845 0.439 0.282 3e-20
Q42484909 Disease resistance protei no no 0.850 0.436 0.259 5e-20
Q9LVT3948 Probable disease resistan no no 0.832 0.410 0.268 5e-16
Q9C8K0854 Probable disease resistan no no 0.766 0.419 0.285 9e-16
Q8RXS5888 Probable disease resistan no no 0.822 0.432 0.268 3e-15
O82484892 Putative disease resistan no no 0.351 0.183 0.357 3e-15
Q9FLB4874 Putative disease resistan no no 0.841 0.449 0.270 4e-14
Q940K0889 Probable disease resistan no no 0.293 0.154 0.349 1e-13
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  156 bits (395), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 241/479 (50%), Gaps = 74/479 (15%)

Query: 1   MHDLIRDMALR-ITSKSPLF--MVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNM 57
           MHD++RD A+  ++S+   F  +V AG  L+EFP + ++  +++RVSLM N +E +P+N+
Sbjct: 431 MHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFP-QDKFVSSVQRVSLMANKLERLPNNV 489

Query: 58  SPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSL 117
               E L  LLLQ N +++ +P  F      L++++LS   I  LP S S+L +LRSL L
Sbjct: 490 IEGVETL-VLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVL 548

Query: 118 GWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLS-SLQLKKFPAGIL 176
             C++L+ +PSL  L+ LQ+LDL+++ I E+P G+E L +L ++ +S + QL+  PAG +
Sbjct: 549 RNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTI 608

Query: 177 PRLRSLYKLKL-----SFGNEA----LRETVEE----------AARLSDRLDY---FEGY 214
            +L SL  L +     S+G +      + T++E          A +L D L +   F+  
Sbjct: 609 LQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSL 668

Query: 215 FSTLKDFNIY---VKSTDGRGSKNYCLALS----AHGMGGCLVTHLEVDKSVFLYGCK-- 265
              L  F      ++S    G+   CLA+S    ++   G L+ H+    S+ L  C+  
Sbjct: 669 TKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHV---TSLDLNYCEGL 725

Query: 266 -------ICEIKETIVLLKDVQC---------------LQMFEVDEVTSLNDVLPRELGL 303
                  + + K + V +K +                 L +F   E  SL++V    +G 
Sbjct: 726 NGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGE 785

Query: 304 VN--IGKFSHDLKVLRFDSCKNLKNLFSLRLLPA-LQNLKVLAVISCNSIEEIVAVEDED 360
           +N  +G     LK+L+   C+ LK LFS ++L   L NL+ + V+SC  +EE+       
Sbjct: 786 LNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVP 845

Query: 361 TEKELATNTIINTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRL 419
            +             LP+L  ++   LP+ +S C  N  +V  SL+ +EV  C  LK L
Sbjct: 846 VD-------FCAESLLPKLTVIKLKYLPQLRSLC--NDRVVLESLEHLEVESCESLKNL 895




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
224112395 1062 nbs-lrr resistance protein [Populus tric 0.982 0.432 0.406 1e-81
224108229 900 BED finger-nbs-lrr resistance protein [P 0.980 0.508 0.390 4e-77
224115986 1093 BED finger-nbs-lrr resistance protein [P 0.976 0.417 0.399 2e-71
224110812 681 predicted protein [Populus trichocarpa] 0.978 0.671 0.385 2e-71
224102275 938 nbs-lrr resistance protein [Populus tric 0.961 0.478 0.385 5e-71
224096143 596 predicted protein [Populus trichocarpa] 0.976 0.765 0.389 2e-70
224145639 1010 BED finger-nbs-lrr resistance protein [P 0.963 0.445 0.369 3e-70
224113569 1139 BED finger-nbs-lrr resistance protein [P 0.980 0.402 0.388 4e-70
224107841503 predicted protein [Populus trichocarpa] 0.957 0.888 0.371 1e-69
224109372 1077 BED finger-nbs-lrr resistance protein [P 0.993 0.430 0.376 4e-69
>gi|224112395|ref|XP_002332783.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833192|gb|EEE71669.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  310 bits (794), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 206/507 (40%), Positives = 284/507 (56%), Gaps = 48/507 (9%)

Query: 1    MHDLIRDMALRITSKSPLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPH 60
            MHDLIRDMA+ I   +   MVKAG +L E P  +EW ENL RVSL+RN I+EIPS+ SP 
Sbjct: 561  MHDLIRDMAIHILQDNSQVMVKAGAQLKELPDAEEWTENLTRVSLIRNKIKEIPSSYSPR 620

Query: 61   CEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWC 120
            C  LSTL L  N  L+ I + FF  +HGLKV+NLS T IE LP SVSDL +L +L L +C
Sbjct: 621  CPYLSTLFLCANGGLRFIGDSFFKQLHGLKVLNLSGTGIENLPDSVSDLVSLTALLLSYC 680

Query: 121  RRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENLSHLYLSSLQLKKFPAGILPRLR 180
              L+ VPSL +L AL+ LDL+DT +E++P+GME L NL HL ++    K+FP+GILP L 
Sbjct: 681  YNLRHVPSLKKLRALKRLDLFDTTLEKMPQGMECLTNLRHLRMNGCGEKEFPSGILPNLS 740

Query: 181  SL--YKLKLSFGNEALRETVEEAARLSDR-LDYFEGYFSTLKDFNIYVKSTDGRGSKN-- 235
             L  + L+   GN     TV+     S R L+  E +F    DF  Y++S DG  S +  
Sbjct: 741  HLQVFVLEEFMGNCYAPITVKGKEVGSLRNLETLECHFEGFSDFVEYLRSRDGIQSLSTY 800

Query: 236  ----------YCLALSAH--------GMGGCLVTHLEVDKSVFLYGCK--ICEIKET--- 272
                      Y   + A+        G+G   +      K  F  G +  +CE  +    
Sbjct: 801  KILVGMVDDFYWANMDANIDDITKTVGLGNLSINGDGDFKVKFFNGIQRLVCERIDARSL 860

Query: 273  --IVLLKDVQCLQMFEVDEVTSLNDVL--------PRELGLVNIGKFSHDLKVLRFDSCK 322
              ++ L++   L+ F + +  ++  ++        P  L   N G FS  LK      C 
Sbjct: 861  YDVLSLENATELEAFMIRDCNNMESLVSSSWFCYTPPRLPSYN-GTFS-GLKEFYCGGCN 918

Query: 323  NLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKL 382
            N+K LF L LLP   NL+ + V  C  +EEIV   DE++    +T+  I    LP+L+ L
Sbjct: 919  NMKKLFPLVLLPNFVNLEDIYVRDCEKMEEIVGTTDEES----STSNSITGFILPKLRSL 974

Query: 383  RFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAAL-KVIK 441
              + LPE KS CS    L CNSL+ I V  C KLKR+++ LPLL++GQPSPP +L ++I 
Sbjct: 975  ELFGLPELKSICS--AKLTCNSLETISVMHCEKLKRMAICLPLLENGQPSPPPSLEEIIV 1032

Query: 442  IEKELWES-LDWDQANAKEVLNSYCKF 467
              KE WES ++W+  NAK+VL  + +F
Sbjct: 1033 YPKEWWESVVEWEHPNAKDVLRPFVEF 1059




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224108229|ref|XP_002333416.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222836514|gb|EEE74921.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115986|ref|XP_002332020.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222875245|gb|EEF12376.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110812|ref|XP_002333023.1| predicted protein [Populus trichocarpa] gi|222834655|gb|EEE73118.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102275|ref|XP_002334197.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222870013|gb|EEF07144.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224096143|ref|XP_002334714.1| predicted protein [Populus trichocarpa] gi|222874252|gb|EEF11383.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145639|ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862589|gb|EEF00096.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113569|ref|XP_002332538.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222832682|gb|EEE71159.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224107841|ref|XP_002333460.1| predicted protein [Populus trichocarpa] gi|222836928|gb|EEE75321.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109372|ref|XP_002333267.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222835868|gb|EEE74289.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.398 0.202 0.354 3e-31
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.400 0.189 0.357 6e-17
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.244 0.125 0.355 3e-16
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.432 0.228 0.317 1.3e-14
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.426 0.222 0.314 1.3e-14
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.389 0.205 0.331 8.7e-14
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.244 0.127 0.409 8.2e-13
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.691 0.340 0.251 7.3e-12
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.261 0.126 0.371 8.6e-12
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.428 0.225 0.323 1.2e-11
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 3.0e-31, Sum P(2) = 3.0e-31
 Identities = 68/192 (35%), Positives = 113/192 (58%)

Query:     1 MHDLIRDMALR-ITSKSPLF--MVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNM 57
             MHD++RD A+  ++S+   F  +V AG  L+EFP + ++  +++RVSLM N +E +P+N+
Sbjct:   431 MHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFP-QDKFVSSVQRVSLMANKLERLPNNV 489

Query:    58 SPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSL 117
                 E L  LLLQ N +++ +P  F      L++++LS   I  LP S S+L +LRSL L
Sbjct:   490 IEGVETL-VLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVL 548

Query:   118 GWCRRLKRVPSXXXXXXXXXXXXXXTRIEEVPEGMEMLENLSHLYLSSL-QLKKFPAGIL 176
               C++L+ +PS              + I E+P G+E L +L ++ +S+  QL+  PAG +
Sbjct:   549 RNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTI 608

Query:   177 PRLRSLYKLKLS 188
              +L SL  L ++
Sbjct:   609 LQLSSLEVLDMA 620


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-04
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 60.8 bits (147), Expect = 5e-10
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 4/150 (2%)

Query: 39  NLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTD 98
           NL  + L  NNI +IP  +      L  L L  N  ++ +P     ++  LK ++LS  D
Sbjct: 117 NLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDN-KIESLPSPLR-NLPNLKNLDLSFND 174

Query: 99  IEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDTRIEEVPEGMEMLENL 158
           +  LP  +S+L+NL +L L   +     P +  L AL+ LDL +  I E+   +  L+NL
Sbjct: 175 LSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNL 234

Query: 159 SHLYLSSLQLKKFPAGI--LPRLRSLYKLK 186
           S L LS+ +L+  P  I  L  L +L    
Sbjct: 235 SGLELSNNKLEDLPESIGNLSNLETLDLSN 264


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.5
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.37
KOG4237498 consensus Extracellular matrix protein slit, conta 99.36
KOG4237498 consensus Extracellular matrix protein slit, conta 99.28
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.25
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG4341483 consensus F-box protein containing LRR [General fu 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.76
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.72
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
KOG4341483 consensus F-box protein containing LRR [General fu 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.35
PLN03150623 hypothetical protein; Provisional 98.31
PLN03150623 hypothetical protein; Provisional 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.15
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.68
PRK15386426 type III secretion protein GogB; Provisional 97.65
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.6
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.43
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.25
PRK15386426 type III secretion protein GogB; Provisional 97.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.86
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.11
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.85
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.29
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.78
smart0037026 LRR Leucine-rich repeats, outliers. 87.34
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.34
smart0037026 LRR Leucine-rich repeats, outliers. 86.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.59
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.94
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.13
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.93  E-value=8.3e-25  Score=240.22  Aligned_cols=377  Identities=19%  Similarity=0.273  Sum_probs=231.6

Q ss_pred             ChhhHHHHHHHhhhcCC-------ceEEEc--------CC---C----------cc---cCCcCccCCCCccEEEeecCC
Q 012249            1 MHDLIRDMALRITSKSP-------LFMVKA--------GL---R----------LL---EFPGEQEWEENLERVSLMRNN   49 (467)
Q Consensus         1 mhdl~~dl~~~~~~~~~-------~~~~~~--------~~---~----------l~---~~~~~~~~l~~l~~L~l~~~~   49 (467)
                      |||++||||+++++++.       +.+...        +.   .          ..   --+.+|..+++|+.|.+..+.
T Consensus       490 MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~  569 (1153)
T PLN03210        490 MHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKK  569 (1153)
T ss_pred             hhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEeccc
Confidence            99999999999987652       111100        00   0          00   012246678899999887553


Q ss_pred             Cc-------ccCCCccCCCCCCCEEEccCCCCCCCCchhHhhcCCCCcEEEccCCCCCCchhhhhcCcCCCEEEcCCCCC
Q 012249           50 IE-------EIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRR  122 (467)
Q Consensus        50 ~~-------~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~L~~L~l~~~~~  122 (467)
                      ..       .+|..+..-.++||.|++.++. ...+|..+  ...+|+.|++.++.+..++..+..+++|++|++++|..
T Consensus       570 ~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~-l~~lP~~f--~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~  646 (1153)
T PLN03210        570 WDQKKEVRWHLPEGFDYLPPKLRLLRWDKYP-LRCMPSNF--RPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKN  646 (1153)
T ss_pred             ccccccceeecCcchhhcCcccEEEEecCCC-CCCCCCcC--CccCCcEEECcCccccccccccccCCCCCEEECCCCCC
Confidence            21       3455443223569999999987 77788765  67899999999999999998899999999999999888


Q ss_pred             CCcCCCccccCCccEEEccCC-cCccccccccCCCCCcEEeccCCC-CCCcCCccccCCCCCcEEEcccCCCcccccHHH
Q 012249          123 LKRVPSLARLLALQYLDLYDT-RIEEVPEGMEMLENLSHLYLSSLQ-LKKFPAGILPRLRSLYKLKLSFGNEALRETVEE  200 (467)
Q Consensus       123 ~~~~p~l~~l~~L~~L~l~~~-~~~~lp~~~~~l~~L~~L~l~~~~-~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~  200 (467)
                      ++.+|.+..+++|++|++++| .+..+|..++++++|+.|++++|. +..+|..+  ++++|+.|++++|......+  .
T Consensus       647 l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i--~l~sL~~L~Lsgc~~L~~~p--~  722 (1153)
T PLN03210        647 LKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI--NLKSLYRLNLSGCSRLKSFP--D  722 (1153)
T ss_pred             cCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC--CCCCCCEEeCCCCCCccccc--c
Confidence            999999999999999999999 788999999999999999999985 68888764  79999999999885443322  1


Q ss_pred             HHhhhccCcEEEcccCCccchhhhhhccCCCCChhhhhhhhhcCCCccccccccccceeeeecCccccchhhhhhhcccc
Q 012249          201 AARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGSKNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQ  280 (467)
Q Consensus       201 l~~l~~~L~~L~l~~~~~~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~  280 (467)
                        .. .+|+.|++..+.+..++...       .+..+..|....... ...+..+...          .......++.|+
T Consensus       723 --~~-~nL~~L~L~~n~i~~lP~~~-------~l~~L~~L~l~~~~~-~~l~~~~~~l----------~~~~~~~~~sL~  781 (1153)
T PLN03210        723 --IS-TNISWLDLDETAIEEFPSNL-------RLENLDELILCEMKS-EKLWERVQPL----------TPLMTMLSPSLT  781 (1153)
T ss_pred             --cc-CCcCeeecCCCccccccccc-------cccccccccccccch-hhcccccccc----------chhhhhccccch
Confidence              23 78899999887764433211       112222111100000 0000000000          000011233455


Q ss_pred             eeeeeecccccccccccccccccccccCccccccEEEEecCCCCccccccchHHhhhccceeeeCCccchhhhhcccCch
Q 012249          281 CLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDLKVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDED  360 (467)
Q Consensus       281 ~L~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~  360 (467)
                      .|.+.++..+..++.         ....+++ |+.|+|++|..++.++...   .+++|+.|++++|..+..++.....-
T Consensus       782 ~L~Ls~n~~l~~lP~---------si~~L~~-L~~L~Ls~C~~L~~LP~~~---~L~sL~~L~Ls~c~~L~~~p~~~~nL  848 (1153)
T PLN03210        782 RLFLSDIPSLVELPS---------SIQNLHK-LEHLEIENCINLETLPTGI---NLESLESLDLSGCSRLRTFPDISTNI  848 (1153)
T ss_pred             heeCCCCCCccccCh---------hhhCCCC-CCEEECCCCCCcCeeCCCC---CccccCEEECCCCCcccccccccccc
Confidence            555544433322110         1223445 6666666666555543221   45566666666665554432211000


Q ss_pred             hhhhhccccc---c-ccccccccccccccccccccccccCCCccccCCcceEEEeCCCCccccC
Q 012249          361 TEKELATNTI---I-NTVTLPRLKKLRFYDLPEFKSFCSYNGVLVCNSLQEIEVRRCPKLKRLS  420 (467)
Q Consensus       361 ~~~~~~~~~~---~-~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~i~~C~~L~~lp  420 (467)
                      ..-.++...+   + +...+++|+.|++.+|.+++.++...  ..+++|+.+.+.+|++|+.++
T Consensus       849 ~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~--~~L~~L~~L~l~~C~~L~~~~  910 (1153)
T PLN03210        849 SDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNI--SKLKHLETVDFSDCGALTEAS  910 (1153)
T ss_pred             CEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCccc--ccccCCCeeecCCCccccccc
Confidence            0000000000   0 12267778888888888887776655  457778888888888777654



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Iteration: 1

Score = 48.5 bits (114), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 42/146 (28%), Positives = 65/146 (44%), Gaps = 26/146 (17%) Query: 39 NLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTD 98 NL + L N ++ +P+ + L L+L N+ LQ +P+ F + L +NL+ Sbjct: 86 NLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQ-LQSLPDGVFDKLTNLTYLNLAHNQ 144 Query: 99 IEVLPSSVSD-LTNLRSLSLGWCRRLKRVPSXXXXXXXXXXXXXXTRIEEVPEGM-EMLE 156 ++ LP V D LTNL L L + +++ +PEG+ + L Sbjct: 145 LQSLPKGVFDKLTNLTELDLSY-----------------------NQLQSLPEGVFDKLT 181 Query: 157 NLSHLYLSSLQLKKFPAGILPRLRSL 182 L L L QLK P G+ RL SL Sbjct: 182 QLKDLRLYQNQLKSVPDGVFDRLTSL 207
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
 Score = 90.8 bits (226), Expect = 1e-20
 Identities = 44/155 (28%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 39  NLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSS-T 97
             +R+ L  N I  +P+     C  L+ L L  N  L RI    F  +  L+ ++LS   
Sbjct: 33  ASQRIFLHGNRISHVPAASFRACRNLTILWLHSN-VLARIDAAAFTGLALLEQLDLSDNA 91

Query: 98  DIEVLPSSV-SDLTNLRSLSLGWCRRLKRVPS--LARLLALQYLDLYDTRIEEVPEGM-E 153
            +  +  +    L  L +L L  C  L+ +       L ALQYL L D  ++ +P+    
Sbjct: 92  QLRSVDPATFHGLGRLHTLHLDRC-GLQELGPGLFRGLAALQYLYLQDNALQALPDDTFR 150

Query: 154 MLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLS 188
            L NL+HL+L   ++   P      L SL +L L 
Sbjct: 151 DLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLH 185


>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.61
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.55
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.53
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.74
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.47
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.98
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.86
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.66
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.51
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.37
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=99.93  E-value=1.8e-25  Score=231.63  Aligned_cols=173  Identities=22%  Similarity=0.241  Sum_probs=138.2

Q ss_pred             CceEEEcCCCcccCCcCccCCCCccEEEeecCCCcccCCCccCCCCCCCEEEccCCCCCCCCchhHhhcCCCCcEEEccC
Q 012249           17 PLFMVKAGLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSS   96 (467)
Q Consensus        17 ~~~~~~~~~~l~~~~~~~~~l~~l~~L~l~~~~~~~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~   96 (467)
                      ...+...+.++..+|..+.  +++++|++++|.+..++...+.++++|+.|++++|. +..+++..|.++++|++|++++
T Consensus        13 ~~~~~c~~~~l~~ip~~~~--~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~-l~~i~~~~~~~l~~L~~L~Ls~   89 (606)
T 3vq2_A           13 NITYQCMDQKLSKVPDDIP--SSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCE-IETIEDKAWHGLHHLSNLILTG   89 (606)
T ss_dssp             TTEEECTTSCCSSCCTTSC--TTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCC-CCEECTTTTTTCTTCCEEECTT
T ss_pred             CCceEccCCCcccCCCCCC--CCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCc-ccccCHHHhhchhhcCEeECCC
Confidence            3456777888999998665  689999999999998888777799999999999997 5666555568999999999999


Q ss_pred             CCCCCc-hhhhhcCcCCCEEEcCCCCCCCcCC-CccccCCccEEEccCCcCc--cccccccCCCCCcEEeccCCCCCCcC
Q 012249           97 TDIEVL-PSSVSDLTNLRSLSLGWCRRLKRVP-SLARLLALQYLDLYDTRIE--EVPEGMEMLENLSHLYLSSLQLKKFP  172 (467)
Q Consensus        97 ~~~~~l-~~~~~~l~~L~~L~l~~~~~~~~~p-~l~~l~~L~~L~l~~~~~~--~lp~~~~~l~~L~~L~l~~~~~~~~~  172 (467)
                      |.+..+ |..++++++|++|++++|......+ .++++++|++|++++|.++  .+|..++++++|++|++++|.+..++
T Consensus        90 n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~l~~~~  169 (606)
T 3vq2_A           90 NPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTIT  169 (606)
T ss_dssp             CCCCCCCTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSCCCEEC
T ss_pred             CcccccChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCcceecC
Confidence            999876 7888999999999999975444343 6899999999999999887  47888999999999999999887766


Q ss_pred             CccccCCCCCc----EEEcccCCC
Q 012249          173 AGILPRLRSLY----KLKLSFGNE  192 (467)
Q Consensus       173 ~~~l~~l~~L~----~L~l~~~~~  192 (467)
                      ...++.+++|+    .|+++.|..
T Consensus       170 ~~~~~~l~~L~~~l~~L~l~~n~l  193 (606)
T 3vq2_A          170 VNDLQFLRENPQVNLSLDMSLNPI  193 (606)
T ss_dssp             TTTTHHHHHCTTCCCEEECTTCCC
T ss_pred             hhhhhhhhccccccceeeccCCCc
Confidence            54334443333    555555543



>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 467
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 52.3 bits (124), Expect = 4e-08
 Identities = 29/163 (17%), Positives = 65/163 (39%), Gaps = 7/163 (4%)

Query: 24  GLRLLEFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFF 83
            L L + P  ++   +   + L  N I EI      + + L TL+L  N  + +I    F
Sbjct: 19  DLGLEKVP--KDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINN-KISKISPGAF 75

Query: 84  VHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSLSLGWCRRLKRVPSLARLLALQYLDLYDT 143
             +  L+ + LS   ++ LP  +        +      ++++      L  +  ++L   
Sbjct: 76  APLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRK-SVFNGLNQMIVVELGTN 134

Query: 144 RIEEV---PEGMEMLENLSHLYLSSLQLKKFPAGILPRLRSLY 183
            ++         + ++ LS++ ++   +   P G+ P L  L+
Sbjct: 135 PLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELH 177


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.91
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.57
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.48
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.38
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.76  E-value=2.6e-17  Score=157.87  Aligned_cols=298  Identities=18%  Similarity=0.253  Sum_probs=170.1

Q ss_pred             CCCCccEEEeecCCCcccCCCccCCCCCCCEEEccCCCCCCCCchhHhhcCCCCcEEEccCCCCCCchhhhhcCcCCCEE
Q 012249           36 WEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNENLQRIPECFFVHMHGLKVVNLSSTDIEVLPSSVSDLTNLRSL  115 (467)
Q Consensus        36 ~l~~l~~L~l~~~~~~~l~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~L~~L  115 (467)
                      .+.++++|+++++.++.+. ++. .+++|+.|++++|. +..+++  ++++++|++|++++|.+..++. ++.+++|+.|
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~-~L~nL~~L~Ls~N~-l~~l~~--l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L  115 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVE-YLNNLTQINFSNNQ-LTDITP--LKNLTKLVDILMNNNQIADITP-LANLTNLTGL  115 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGG-GCTTCCEEECCSSC-CCCCGG--GTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEE
T ss_pred             HhCCCCEEECCCCCCCCcc-ccc-cCCCCCEEeCcCCc-CCCCcc--ccCCcccccccccccccccccc-cccccccccc
Confidence            4568999999999998774 343 78999999999997 667765  5899999999999999987764 7899999999


Q ss_pred             EcCCCCCCCcCCCccccCCccEEEccCCcCccc------------------------------------------ccccc
Q 012249          116 SLGWCRRLKRVPSLARLLALQYLDLYDTRIEEV------------------------------------------PEGME  153 (467)
Q Consensus       116 ~l~~~~~~~~~p~l~~l~~L~~L~l~~~~~~~l------------------------------------------p~~~~  153 (467)
                      ++.++. ....+.......+.......+.+..+                                          .....
T Consensus       116 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  194 (384)
T d2omza2         116 TLFNNQ-ITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLA  194 (384)
T ss_dssp             ECCSSC-CCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGG
T ss_pred             cccccc-ccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccc
Confidence            998853 44443223333333333322211100                                          11223


Q ss_pred             CCCCCcEEeccCCCCCCcCCccccCCCCCcEEEcccCCCcccccHHHHHhhhccCcEEEcccCCccchhhhhhccCCCCC
Q 012249          154 MLENLSHLYLSSLQLKKFPAGILPRLRSLYKLKLSFGNEALRETVEEAARLSDRLDYFEGYFSTLKDFNIYVKSTDGRGS  233 (467)
Q Consensus       154 ~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~~L~~L~l~~~~~~~~~~~~~~~~~~~~  233 (467)
                      .+++++.++++.+.+..++.  ...+++|++|++++|.....   ..+..+ ++|+.+++..+.+....           
T Consensus       195 ~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~---~~l~~l-~~L~~L~l~~n~l~~~~-----------  257 (384)
T d2omza2         195 KLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI---GTLASL-TNLTDLDLANNQISNLA-----------  257 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC---GGGGGC-TTCSEEECCSSCCCCCG-----------
T ss_pred             cccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc---chhhcc-cccchhccccCccCCCC-----------
Confidence            33444444444444433332  12334444444444432221   123333 44444444333321110           


Q ss_pred             hhhhhhhhhcCCCccccccccccceeeeecCccccchhhhhhhcccceeeeeecccccccccccccccccccccCccccc
Q 012249          234 KNYCLALSAHGMGGCLVTHLEVDKSVFLYGCKICEIKETIVLLKDVQCLQMFEVDEVTSLNDVLPRELGLVNIGKFSHDL  313 (467)
Q Consensus       234 l~~l~~l~~~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~L~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~L  313 (467)
                                          .+..                  .+.++.|.+.++. ++.          ......++. +
T Consensus       258 --------------------~~~~------------------~~~L~~L~l~~~~-l~~----------~~~~~~~~~-l  287 (384)
T d2omza2         258 --------------------PLSG------------------LTKLTELKLGANQ-ISN----------ISPLAGLTA-L  287 (384)
T ss_dssp             --------------------GGTT------------------CTTCSEEECCSSC-CCC----------CGGGTTCTT-C
T ss_pred             --------------------cccc------------------cccCCEeeccCcc-cCC----------CCccccccc-c
Confidence                                0111                  1233333333221 111          112233455 7


Q ss_pred             cEEEEecCCCCccccccchHHhhhccceeeeCCccchhhhhcccCchhhhhhcccccccccccccccccccccccccccc
Q 012249          314 KVLRFDSCKNLKNLFSLRLLPALQNLKVLAVISCNSIEEIVAVEDEDTEKELATNTIINTVTLPRLKKLRFYDLPEFKSF  393 (467)
Q Consensus       314 ~~L~l~~c~~l~~l~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~  393 (467)
                      +.+.+..+. ++.+   ..+..+++++.|+++++ .++++....                 .+|+|++|++.+| .++.+
T Consensus       288 ~~l~~~~n~-l~~~---~~~~~~~~l~~L~ls~n-~l~~l~~l~-----------------~l~~L~~L~L~~n-~l~~l  344 (384)
T d2omza2         288 TNLELNENQ-LEDI---SPISNLKNLTYLTLYFN-NISDISPVS-----------------SLTKLQRLFFANN-KVSDV  344 (384)
T ss_dssp             SEEECCSSC-CSCC---GGGGGCTTCSEEECCSS-CCSCCGGGG-----------------GCTTCCEEECCSS-CCCCC
T ss_pred             ccccccccc-cccc---cccchhcccCeEECCCC-CCCCCcccc-----------------cCCCCCEEECCCC-CCCCC
Confidence            777777643 3332   23566778888888875 566553222                 7888888888887 46665


Q ss_pred             ccCCCccccCCcceEEEeCCCCccccCCccCcccCCCCCCCCcceeeeeh
Q 012249          394 CSYNGVLVCNSLQEIEVRRCPKLKRLSLSLPLLDHGQPSPPAALKVIKIE  443 (467)
Q Consensus       394 ~~~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~l~~~~~~~~~~L~~l~i~  443 (467)
                      ...   ..+++|++|++.+| +++++|. +..+        ++|+.|++.
T Consensus       345 ~~l---~~l~~L~~L~l~~N-~l~~l~~-l~~l--------~~L~~L~L~  381 (384)
T d2omza2         345 SSL---ANLTNINWLSAGHN-QISDLTP-LANL--------TRITQLGLN  381 (384)
T ss_dssp             GGG---GGCTTCCEEECCSS-CCCBCGG-GTTC--------TTCSEEECC
T ss_pred             hhH---cCCCCCCEEECCCC-cCCCChh-hccC--------CCCCEeeCC
Confidence            532   35888999999877 6777653 4444        388888775



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure