Citrus Sinensis ID: 012265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDAGAAGASSNSTSSQATSSKGAAQNVAQSSKGSSKSSRKKSRN
cHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHcccccccHHHHHHccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHEcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHccccHHHHHHcccccccHcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccHHccccccccccccHHccccccccEcccHHHHHHccccccccccccccccccccccccccccccccHcccccc
MILMYLIFVRIGqetltddnfaeddieiELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVAlkgpkdvndsLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAAlpdmfpdsvMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAanhpfiaaeslakipdiqhmpATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKlrhgreedASHLFEELVKTHGSIEALVGLVTTsahvdvdkaesyekrlkplpglngvdvdslektsgakhvesasyfevneahgegknkdkakkkrkrkprypkgfdpanpgpppdperwlpkrerssyrprrkdkraaqvrgsqgavvrekhdagaagassnstssqatsskgaaqnvaqsskgsskssrkksrn
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNlvalkgpkdvndSLKKLDRikekdmqnfqlarvldlrlspkqREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAesyekrlkplpglngvdvdSLEKTSGakhvesasyfevneahgegknkdkakkkrkrkprypkgfdpanpgpppdperwlpkrerssyrprrkdkraaqvrgsqgavvrekhdagaagassnstssqatsskgaaqnvaqsskgsskssrkksrn
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLaraqvaaaaNHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGknkdkakkkrkrkprypkgfdpanpgpppdpERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDagaagassnstssqatsskgaaqNVAQsskgsskssrkksrN
*ILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPK****************MQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRH*****ASHLFEELVKTHGSIEALVGLVTTSAHVDVD*************************************************************************************************************************************************************
MILMYLIFVRI*****************ELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARE********FPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVD****************GVDVDSL*******************************************************ERWLPK*************************************************************************
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVN*********************YPKGFDPANPGPPPDPERWLPKRE***********************************************************************
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSG**********************************YPKGFDPANPGPPPDPERWLPKRERSSY*******************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDAGAAGASSNSTSSQATSSKGAAQNVAQSSKGSSKSSRKKSRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query467 2.2.26 [Sep-21-2011]
P33731671 Signal recognition partic yes no 0.860 0.599 0.351 3e-50
O76094671 Signal recognition partic yes no 0.860 0.599 0.348 7e-50
Q54EP7672 Signal recognition partic yes no 0.811 0.563 0.269 4e-29
P49965707 Signal recognition partic N/A no 0.802 0.530 0.289 6e-27
P91240635 Signal recognition partic yes no 0.758 0.557 0.290 6e-20
O59787561 Signal recognition partic yes no 0.768 0.639 0.234 1e-09
P38688640 Signal recognition partic yes no 0.062 0.045 0.620 4e-05
>sp|P33731|SRP72_CANFA Signal recognition particle 72 kDa protein OS=Canis familiaris GN=SRP72 PE=1 SV=3 Back     alignment and function desciption
 Score =  199 bits (507), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 238/433 (54%), Gaps = 31/433 (7%)

Query: 18  DDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVA 77
           D +  E+D + ELA I  Q+AY+ QL G T+EA   Y  IIK    D    AV  NN++ 
Sbjct: 213 DSDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYNQIIKLKPTDVGLLAVIANNIIT 272

Query: 78  LKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQA 137
           +   ++V DS KK+             A  ++ +LS KQ +AI  N+ LL ++ N+ +Q 
Sbjct: 273 INKDQNVFDSKKKVKLTN---------AEGVEFKLSKKQLQAIEFNKALLAMYTNQAEQC 323

Query: 138 RELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVA 197
           R++ A+L    P+ ++P+L+QAA L RE +  KA ELL +F+++ P+ +  I L  AQ+ 
Sbjct: 324 RKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIELLQEFSDQHPENAAEIKLTMAQLK 383

Query: 198 AAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTED 257
            +  +   A   L  I +++H P  V+ LV +     DID A  V   AI+W+ N   + 
Sbjct: 384 ISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEEDIDSAIEVFTQAIQWYQNHQPKS 443

Query: 258 NKLSVIMQEAASFKLRHGREEDASHLFEELVKTH-GSIEALVGLVTTSAHVDVDKAESYE 316
           +    +++EAA+FKL++GR+++A    E+L K +   I  L  L++  + VD +KA++  
Sbjct: 444 SAHLSLIREAANFKLKYGRKKEAISDLEQLWKQNPKDIHTLAQLISAYSLVDPEKAKALS 503

Query: 317 KRLKPLPGLN-GVDVDSLEKTSGAKHVESASYFEVNEA----HGEGKNKDKAKKKRKRKP 371
           K L     ++  VDV++LE + GA ++         ++     G+G   D  KKK+K+K 
Sbjct: 504 KHLPSSDSMSLKVDVEALENSPGATYIRKKGGKVAGDSQPKEQGQG---DLKKKKKKKKG 560

Query: 372 RYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQV-RGSQGAVVREKHDAGAAG 430
           + PK +DP      PDPERWLP RERS YR R+K K+  Q+ +G+QGA          AG
Sbjct: 561 KLPKNYDPK---VTPDPERWLPMRERSYYRGRKKGKKKDQIGKGTQGAT---------AG 608

Query: 431 ASSNSTSSQATSS 443
           ASS   +S+  SS
Sbjct: 609 ASSELDASKTVSS 621




Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
Canis familiaris (taxid: 9615)
>sp|O76094|SRP72_HUMAN Signal recognition particle 72 kDa protein OS=Homo sapiens GN=SRP72 PE=1 SV=3 Back     alignment and function description
>sp|Q54EP7|SRP72_DICDI Signal recognition particle 72 kDa protein homolog OS=Dictyostelium discoideum GN=srp72 PE=3 SV=1 Back     alignment and function description
>sp|P49965|SRP72_SCHMA Signal recognition particle 72 kDa protein OS=Schistosoma mansoni GN=SRP72 PE=3 SV=1 Back     alignment and function description
>sp|P91240|SRP72_CAEEL Signal recognition particle 72 kDa protein homolog OS=Caenorhabditis elegans GN=F08D12.1 PE=3 SV=2 Back     alignment and function description
>sp|O59787|SRP72_SCHPO Signal recognition particle subunit srp72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp72 PE=3 SV=1 Back     alignment and function description
>sp|P38688|SRP72_YEAST Signal recognition particle subunit SRP72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP72 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
225425902 673 PREDICTED: signal recognition particle 7 0.942 0.653 0.779 0.0
297738340 696 unnamed protein product [Vitis vinifera] 0.931 0.625 0.781 0.0
255547830 664 Signal recognition particle subunit srp7 0.946 0.665 0.801 1e-176
356525126 662 PREDICTED: signal recognition particle 7 0.937 0.661 0.765 1e-175
356512347 662 PREDICTED: signal recognition particle 7 0.937 0.661 0.761 1e-165
449435027 667 PREDICTED: signal recognition particle 7 0.948 0.664 0.737 1e-165
147802240 1085 hypothetical protein VITISV_028102 [Viti 0.850 0.365 0.789 1e-164
297841469 652 hypothetical protein ARALYDRAFT_475871 [ 0.914 0.654 0.728 1e-163
15220511 664 signal recognition particle subunit SRP7 0.929 0.653 0.713 1e-161
28392976536 unknown protein [Arabidopsis thaliana] 0.929 0.809 0.650 1e-161
>gi|225425902|ref|XP_002271378.1| PREDICTED: signal recognition particle 72 kDa protein [Vitis vinifera] Back     alignment and taxonomy information
 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/445 (77%), Positives = 399/445 (89%), Gaps = 5/445 (1%)

Query: 10  RIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFA 69
           R+GQETL +DN A+D+IEIELAP+AVQLAYVQQLLGNT EA  AYT II RNLADESS A
Sbjct: 210 RVGQETLMEDNLADDEIEIELAPLAVQLAYVQQLLGNTPEAMEAYTGIINRNLADESSLA 269

Query: 70  VAVNNLVALKGPKDVNDSLKKLDRIKEKD--MQNFQLARVLDLRLSPKQREAIYANRVLL 127
           VAVNNLVALKGPKD++DSL+KLDR+ EK    Q+FQL+  L+ +LSPKQRE IY NRVLL
Sbjct: 270 VAVNNLVALKGPKDISDSLRKLDRLMEKGNGAQSFQLSNGLESKLSPKQRETIYTNRVLL 329

Query: 128 LLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSK 187
           LLHAN+MDQARELVAALPDMF DSVMP+LLQAAVLVRENK+GKAEE+LGQFAEK PDK+K
Sbjct: 330 LLHANRMDQARELVAALPDMFADSVMPVLLQAAVLVRENKSGKAEEILGQFAEKFPDKAK 389

Query: 188 IILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAI 247
           ++LLARAQ+AA A HP IAAESL+KI DIQH+PATVAT+V+LKERAGDIDGA AV DSAI
Sbjct: 390 VVLLARAQIAAVAGHPQIAAESLSKIADIQHLPATVATIVSLKERAGDIDGAEAVFDSAI 449

Query: 248 KWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHV 307
           +WW NAMTEDNKL+VIMQEAASFKL+HGRE++A+ L+EELVK+HGS++AL+GLVTT+A V
Sbjct: 450 QWWSNAMTEDNKLTVIMQEAASFKLKHGREKEAARLYEELVKSHGSVQALIGLVTTAARV 509

Query: 308 DVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKR 367
           DVDKAE+YEK+LKPLPGL GVDV+SLE+TSGAKH++S S   + EA+ E KNK+KAKKKR
Sbjct: 510 DVDKAEAYEKQLKPLPGLKGVDVESLERTSGAKHIQSDSRVGITEAYEESKNKEKAKKKR 569

Query: 368 KRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDAG 427
           KRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRP+RKDKRAAQVRGSQGAVVREKH+A 
Sbjct: 570 KRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPKRKDKRAAQVRGSQGAVVREKHEAA 629

Query: 428 AAGAS---SNSTSSQATSSKGAAQN 449
            +  S   SNS S QAT+SKG++QN
Sbjct: 630 GSDTSANTSNSKSDQATTSKGSSQN 654




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297738340|emb|CBI27541.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547830|ref|XP_002514972.1| Signal recognition particle subunit srp72, putative [Ricinus communis] gi|223546023|gb|EEF47526.1| Signal recognition particle subunit srp72, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356525126|ref|XP_003531178.1| PREDICTED: signal recognition particle 72 kDa protein-like [Glycine max] Back     alignment and taxonomy information
>gi|356512347|ref|XP_003524881.1| PREDICTED: signal recognition particle 72 kDa protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449435027|ref|XP_004135297.1| PREDICTED: signal recognition particle 72 kDa protein-like [Cucumis sativus] gi|449530207|ref|XP_004172087.1| PREDICTED: signal recognition particle 72 kDa protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147802240|emb|CAN63819.1| hypothetical protein VITISV_028102 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297841469|ref|XP_002888616.1| hypothetical protein ARALYDRAFT_475871 [Arabidopsis lyrata subsp. lyrata] gi|297334457|gb|EFH64875.1| hypothetical protein ARALYDRAFT_475871 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220511|ref|NP_176936.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] gi|11072013|gb|AAG28892.1|AC008113_8 F12A21.17 [Arabidopsis thaliana] gi|28392947|gb|AAO41909.1| unknown protein [Arabidopsis thaliana] gi|28827690|gb|AAO50689.1| unknown protein [Arabidopsis thaliana] gi|332196560|gb|AEE34681.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28392976|gb|AAO41923.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:2008610664 AT1G67680 [Arabidopsis thalian 0.721 0.507 0.719 8.1e-140
TAIR|locus:2008540651 AT1G67650 [Arabidopsis thalian 0.732 0.525 0.682 3.6e-135
UNIPROTKB|Q5ZKZ5671 SRP72 "Uncharacterized protein 0.687 0.478 0.354 8.6e-50
UNIPROTKB|E1BVX9671 SRP72 "Uncharacterized protein 0.687 0.478 0.351 2e-49
UNIPROTKB|P33731671 SRP72 "Signal recognition part 0.676 0.470 0.336 1.1e-48
UNIPROTKB|E1BB38671 SRP72 "Uncharacterized protein 0.676 0.470 0.336 3.4e-48
UNIPROTKB|O76094671 SRP72 "Signal recognition part 0.687 0.478 0.330 3.4e-48
ZFIN|ZDB-GENE-030131-5546670 srp72 "signal recognition part 0.698 0.486 0.321 3.6e-47
UNIPROTKB|D4A7R0671 Srp72 "Protein Srp72" [Rattus 0.676 0.470 0.296 2.7e-38
RGD|1564787395 Srp72 "signal recognition part 0.509 0.602 0.312 3.1e-37
TAIR|locus:2008610 AT1G67680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1227 (437.0 bits), Expect = 8.1e-140, Sum P(2) = 8.1e-140
 Identities = 244/339 (71%), Positives = 285/339 (84%)

Query:    10 RIGQETLTDDNFA--EDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESS 67
             RIGQETL DD+ A  +++IEIELAPIAVQLAYVQQ+LG TQE+  +Y D IKRNLADE S
Sbjct:   219 RIGQETLNDDDIALTDEEIEIELAPIAVQLAYVQQILGQTQESTSSYVDFIKRNLADEPS 278

Query:    68 FAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLL 127
              AVAVNNLVALKG KD++D L+K D +K+KD Q FQL++ LD +LS K +EAIYANRVLL
Sbjct:   279 LAVAVNNLVALKGFKDISDGLRKFDLLKDKDSQTFQLSQALDAKLSQKHKEAIYANRVLL 338

Query:   128 LLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSK 187
             LLHANKMDQAREL AALP MFP+S++P LLQAAVLVRENKA KAEELLGQ AEK P+KSK
Sbjct:   339 LLHANKMDQARELCAALPGMFPESIIPTLLQAAVLVRENKAAKAEELLGQCAEKFPEKSK 398

Query:   188 IILLXXXXXXXXXNHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAI 247
             ++LL         +HP +AAESL+KIPDIQH+PATVAT+VALKERAGD DGAAAVLDSAI
Sbjct:   399 LVLLARAQIAASASHPHVAAESLSKIPDIQHLPATVATIVALKERAGDNDGAAAVLDSAI 458

Query:   248 KWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHV 307
             KWW N+MTE +KL V+M EAA+FKLRHG+EE+AS L+EE+VK H S +ALVGLVTT A V
Sbjct:   459 KWWSNSMTESSKLRVLMPEAAAFKLRHGQEEEASRLYEEIVKNHNSTDALVGLVTTLARV 518

Query:   308 DVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESAS 346
             +V+KAESYEK+LKPLPGL  VDVD LEKT GAK +E A+
Sbjct:   519 NVEKAESYEKQLKPLPGLKAVDVDKLEKTYGAKPIEGAA 557


GO:0005737 "cytoplasm" evidence=ISM
GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA
GO:0008312 "7S RNA binding" evidence=IEA
GO:0048500 "signal recognition particle" evidence=IEA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2008540 AT1G67650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKZ5 SRP72 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVX9 SRP72 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P33731 SRP72 "Signal recognition particle 72 kDa protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BB38 SRP72 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O76094 SRP72 "Signal recognition particle 72 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5546 srp72 "signal recognition particle 72" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A7R0 Srp72 "Protein Srp72" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1564787 Srp72 "signal recognition particle 72" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
pfam0849257 pfam08492, SRP72, SRP72 RNA-binding domain 6e-15
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
>gnl|CDD|149515 pfam08492, SRP72, SRP72 RNA-binding domain Back     alignment and domain information
 Score = 68.6 bits (168), Expect = 6e-15
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 3/43 (6%)

Query: 360 KDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRP 402
           K K   K+KRKP+ PK F   NP   PDPERWLP R+RS YRP
Sbjct: 18  KKKKSAKKKRKPKLPKNF---NPVVTPDPERWLPMRDRSYYRP 57


This region has been identified as the binding site of the SRP72 protein to SRP RNA. Length = 57

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
KOG2376652 consensus Signal recognition particle, subunit Srp 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.8
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.8
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 99.78
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.78
PRK11788389 tetratricopeptide repeat protein; Provisional 99.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.76
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.76
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.75
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.74
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.74
PRK11788389 tetratricopeptide repeat protein; Provisional 99.74
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.72
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.66
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.65
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.62
PRK11189296 lipoprotein NlpI; Provisional 99.61
PRK12370553 invasion protein regulator; Provisional 99.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.58
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.57
PRK12370553 invasion protein regulator; Provisional 99.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.53
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.52
KOG2003840 consensus TPR repeat-containing protein [General f 99.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.52
KOG1126638 consensus DNA-binding cell division cycle control 99.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.45
KOG1129478 consensus TPR repeat-containing protein [General f 99.43
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.43
KOG2376652 consensus Signal recognition particle, subunit Srp 99.42
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.4
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.39
PLN03218 1060 maturation of RBCL 1; Provisional 99.39
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.39
PRK11189296 lipoprotein NlpI; Provisional 99.38
PLN03218 1060 maturation of RBCL 1; Provisional 99.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.36
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.35
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.34
KOG0547606 consensus Translocase of outer mitochondrial membr 99.33
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.31
PRK14574 822 hmsH outer membrane protein; Provisional 99.31
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.3
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.3
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.29
PRK14574 822 hmsH outer membrane protein; Provisional 99.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.27
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.26
KOG2076 895 consensus RNA polymerase III transcription factor 99.26
PRK10370198 formate-dependent nitrite reductase complex subuni 99.26
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.26
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.25
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.24
KOG1125579 consensus TPR repeat-containing protein [General f 99.24
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.23
PLN03077857 Protein ECB2; Provisional 99.23
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.21
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.18
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.17
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.15
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.15
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.14
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.12
KOG1125579 consensus TPR repeat-containing protein [General f 99.12
PLN03077857 Protein ECB2; Provisional 99.1
PRK10370198 formate-dependent nitrite reductase complex subuni 99.1
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
KOG1129478 consensus TPR repeat-containing protein [General f 99.03
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.02
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.02
PRK15359144 type III secretion system chaperone protein SscB; 99.01
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.01
PRK15359144 type III secretion system chaperone protein SscB; 99.0
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.99
PLN02789320 farnesyltranstransferase 98.99
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.96
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.94
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.92
KOG2076 895 consensus RNA polymerase III transcription factor 98.91
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.91
PLN02789320 farnesyltranstransferase 98.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.86
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.86
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.86
KOG2003840 consensus TPR repeat-containing protein [General f 98.85
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.85
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.82
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.75
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.74
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.69
PRK04841903 transcriptional regulator MalT; Provisional 98.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.67
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.66
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.65
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.63
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.61
KOG0553304 consensus TPR repeat-containing protein [General f 98.59
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.59
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.59
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.57
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.55
KOG0553304 consensus TPR repeat-containing protein [General f 98.55
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.54
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.53
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.52
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.52
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.5
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.5
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.49
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.48
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.44
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.44
PRK10803263 tol-pal system protein YbgF; Provisional 98.41
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.39
KOG1128777 consensus Uncharacterized conserved protein, conta 98.37
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.37
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.37
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.34
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.33
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.32
PRK10803263 tol-pal system protein YbgF; Provisional 98.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.31
KOG1915677 consensus Cell cycle control protein (crooked neck 98.3
PRK04841903 transcriptional regulator MalT; Provisional 98.3
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.29
KOG1128777 consensus Uncharacterized conserved protein, conta 98.2
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.2
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.17
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.17
PF1337173 TPR_9: Tetratricopeptide repeat 98.17
COG4700251 Uncharacterized protein conserved in bacteria cont 98.15
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.14
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
COG3898531 Uncharacterized membrane-bound protein [Function u 98.12
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.12
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.11
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.1
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.09
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.07
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.07
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.06
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.05
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.04
PF12688120 TPR_5: Tetratrico peptide repeat 98.02
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.01
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.0
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.99
PF13512142 TPR_18: Tetratricopeptide repeat 97.94
PF12688120 TPR_5: Tetratrico peptide repeat 97.93
PRK15331165 chaperone protein SicA; Provisional 97.9
PRK15331165 chaperone protein SicA; Provisional 97.87
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.85
PF1337173 TPR_9: Tetratricopeptide repeat 97.84
COG4700251 Uncharacterized protein conserved in bacteria cont 97.84
KOG1585308 consensus Protein required for fusion of vesicles 97.83
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.82
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.79
PRK11906458 transcriptional regulator; Provisional 97.78
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.77
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.77
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.77
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.76
PRK11906458 transcriptional regulator; Provisional 97.72
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.71
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.71
PF13512142 TPR_18: Tetratricopeptide repeat 97.67
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.65
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.55
KOG4234271 consensus TPR repeat-containing protein [General f 97.55
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.53
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.51
KOG1586288 consensus Protein required for fusion of vesicles 97.42
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.41
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.39
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.37
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 97.36
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.26
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.22
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.2
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.19
PF1342844 TPR_14: Tetratricopeptide repeat 97.17
KOG1586288 consensus Protein required for fusion of vesicles 97.17
PF1342844 TPR_14: Tetratricopeptide repeat 97.15
KOG1941518 consensus Acetylcholine receptor-associated protei 97.15
KOG4234271 consensus TPR repeat-containing protein [General f 97.13
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.1
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.1
KOG4555175 consensus TPR repeat-containing protein [Function 97.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.06
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.04
KOG2471 696 consensus TPR repeat-containing protein [General f 97.03
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.01
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.97
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.97
COG3898531 Uncharacterized membrane-bound protein [Function u 96.97
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.92
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.88
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.81
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.73
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.69
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.6
PF1343134 TPR_17: Tetratricopeptide repeat 96.58
KOG1585308 consensus Protein required for fusion of vesicles 96.44
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.2
KOG4555175 consensus TPR repeat-containing protein [Function 96.19
KOG4648536 consensus Uncharacterized conserved protein, conta 96.18
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.16
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.14
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.09
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.03
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.0
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.98
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 95.97
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.83
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.83
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.71
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.58
KOG2471 696 consensus TPR repeat-containing protein [General f 95.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.5
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.44
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.37
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.33
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.29
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 95.24
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.12
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.94
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.91
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.88
KOG20411189 consensus WD40 repeat protein [General function pr 94.82
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.73
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.56
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.53
PF1343134 TPR_17: Tetratricopeptide repeat 94.49
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.48
KOG2300629 consensus Uncharacterized conserved protein [Funct 94.44
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.38
PRK10941269 hypothetical protein; Provisional 94.27
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.23
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.15
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.14
KOG1914656 consensus mRNA cleavage and polyadenylation factor 93.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.82
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 93.77
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.65
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 93.57
KOG1941518 consensus Acetylcholine receptor-associated protei 93.53
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 93.39
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 93.33
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 93.19
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 93.19
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.08
KOG2300629 consensus Uncharacterized conserved protein [Funct 93.07
KOG3616 1636 consensus Selective LIM binding factor [Transcript 93.02
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.0
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 92.76
KOG1914656 consensus mRNA cleavage and polyadenylation factor 92.54
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.26
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.11
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 92.02
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 91.86
KOG1258577 consensus mRNA processing protein [RNA processing 91.72
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.1
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.82
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.69
KOG4507886 consensus Uncharacterized conserved protein, conta 90.46
COG5159421 RPN6 26S proteasome regulatory complex component [ 90.44
KOG3616 1636 consensus Selective LIM binding factor [Transcript 90.36
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 90.32
KOG3364149 consensus Membrane protein involved in organellar 90.16
KOG4507886 consensus Uncharacterized conserved protein, conta 90.04
KOG15381081 consensus Uncharacterized conserved protein WDR10, 90.0
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.95
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.85
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.51
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 89.23
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.19
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.14
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 88.92
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.58
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 88.17
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.0
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.74
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.36
PF1304150 PPR_2: PPR repeat family 86.78
PRK10941269 hypothetical protein; Provisional 86.7
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 86.29
KOG1258577 consensus mRNA processing protein [RNA processing 86.17
KOG2422665 consensus Uncharacterized conserved protein [Funct 85.64
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 85.62
KOG2422665 consensus Uncharacterized conserved protein [Funct 84.67
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 84.08
COG2912269 Uncharacterized conserved protein [Function unknow 83.8
KOG4814 872 consensus Uncharacterized conserved protein [Funct 83.68
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 83.61
COG4455273 ImpE Protein of avirulence locus involved in tempe 83.53
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.47
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.07
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 82.95
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 82.91
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 82.61
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.18
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.9
KOG1463411 consensus 26S proteasome regulatory complex, subun 81.88
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 81.7
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 81.53
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 81.13
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 80.43
PF1285434 PPR_1: PPR repeat 80.16
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=6.5e-78  Score=596.39  Aligned_cols=426  Identities=51%  Similarity=0.709  Sum_probs=374.8

Q ss_pred             cchHHHHHHHhhhhhcCCCCChhhHHhhhhhHHHHHHHHHHHhCChHHHHHHHHHHhccCCCchHHHHHHHhhhhhccCC
Q 012265            2 ILMYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGP   81 (467)
Q Consensus         2 ~~~l~~A~~~~~~~l~~~~~~~ee~~~El~~i~~qlA~v~~~~G~~~eA~~~y~~~l~~~p~d~~~~~va~nnl~~l~~~   81 (467)
                      |..|..|+++|+++|+++|..+|||+.||++|++|+|||+|++|+.+||..+|..++..+|.|.++.+|+.|||+++.++
T Consensus       195 ~elL~kA~~~~~e~l~~~d~~eEeie~el~~IrvQlayVlQ~~Gqt~ea~~iy~~~i~~~~~D~~~~Av~~NNLva~~~d  274 (652)
T KOG2376|consen  195 IELLEKALRICREKLEDEDTNEEEIEEELNPIRVQLAYVLQLQGQTAEASSIYVDIIKRNPADEPSLAVAVNNLVALSKD  274 (652)
T ss_pred             HHHHHHHHHHHHHhhcccccchhhHHHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHhcCCCchHHHHHhcchhhhccc
Confidence            56799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChhHHHHhhhhhhhhhhhHHHHHHHhhcCCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHhccccCCCCchHHHHHHHH
Q 012265           82 KDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAV  161 (467)
Q Consensus        82 ~~~~~a~~~l~~~~~~~~~~~~~~~~l~~kL~~~q~~~l~~n~all~l~~~~~~~A~~~~~~l~~~~P~~~~~~ll~a~l  161 (467)
                      .++++......    ...+.+.+.+.++++|+..|+..+++|.+++.+++|+.++++++...+...+|.+....++.+..
T Consensus       275 ~~~~d~~~l~~----k~~~~~~l~~~~l~~Ls~~qk~~i~~N~~lL~l~tnk~~q~r~~~a~lp~~~p~~~~~~ll~~~t  350 (652)
T KOG2376|consen  275 QNYFDGDLLKS----KKSQVFKLAEFLLSKLSKKQKQAIYRNNALLALFTNKMDQVRELSASLPGMSPESLFPILLQEAT  350 (652)
T ss_pred             cccCchHHHHH----HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHhCCccCchHHHHHHHHHHH
Confidence            98887421111    11234566777889999999999999999999999999999999999999999998888888888


Q ss_pred             HHhcCChhHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHcCChHHHHHHHh--------ccccCCCChhHHHHHHHHHHHc
Q 012265          162 LVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLA--------KIPDIQHMPATVATLVALKERA  233 (467)
Q Consensus       162 ~~~~~~~~~A~~~l~~~l~~~P~~~~~~~l~Laql~~~~g~~~~A~~~L~--------~~~~~~~~p~~~~~l~~ly~~~  233 (467)
                      .++...+.+|+.+|..+.+.+|+....+.|+++|+.+.+|++..|+.+|.        ++.++.+.|+++..++.+|...
T Consensus       351 ~~~~~~~~ka~e~L~~~~~~~p~~s~~v~L~~aQl~is~gn~~~A~~il~~~~~~~~ss~~~~~~~P~~V~aiv~l~~~~  430 (652)
T KOG2376|consen  351 KVREKKHKKAIELLLQFADGHPEKSKVVLLLRAQLKISQGNPEVALEILSLFLESWKSSILEAKHLPGTVGAIVALYYKI  430 (652)
T ss_pred             HHHHHHHhhhHHHHHHHhccCCchhHHHHHHHHHHHHhcCCHHHHHHHHHHHhhhhhhhhhhhccChhHHHHHHHHHHhc
Confidence            88888999999999999999999866667999999999999999999999        7888888999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHhccCCchHHHHHHHHHHHHHHCCChhHHHHHHHHHHHhcC-CHHHHHHHHHHhccCChhHH
Q 012265          234 GDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHG-SIEALVGLVTTSAHVDVDKA  312 (467)
Q Consensus       234 g~~~~A~~~l~~al~~~~~~~~~~~~~~~ll~~la~~~l~~g~~~~A~~~le~ll~~~p-d~~ala~Lv~a~~~~d~~kA  312 (467)
                      ++.+.|.++|.+|+.||....+....+..+|..++.|.++.|+.++|..+|+++++.+| |.++++++|.+|+.+|+++|
T Consensus       431 ~~~~~a~~vl~~Ai~~~~~~~t~s~~l~~~~~~aa~f~lr~G~~~ea~s~leel~k~n~~d~~~l~~lV~a~~~~d~eka  510 (652)
T KOG2376|consen  431 KDNDSASAVLDSAIKWWRKQQTGSIALLSLMREAAEFKLRHGNEEEASSLLEELVKFNPNDTDLLVQLVTAYARLDPEKA  510 (652)
T ss_pred             cCCccHHHHHHHHHHHHHHhcccchHHHhHHHHHhHHHHhcCchHHHHHHHHHHHHhCCchHHHHHHHHHHHHhcCHHHH
Confidence            99999999999999999988877778888999999999999999999999999999884 68999999999999999999


Q ss_pred             HHHHhcCCCCCCCCCcChhhhhhhcCCCcccccccccccccccCCCcchhhhhhhcCCCCCCCCCCCCCCCCCCCCCCCC
Q 012265          313 ESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWL  392 (467)
Q Consensus       313 ~~l~~~L~~~~~~~~vDvd~Le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~krkrk~~~pk~~dp~~~~~~pDPERWL  392 (467)
                      +.|.+.|||.+.+.+||||+||.+.|+++.......+............++|++||||.++||||||   .++|||||||
T Consensus       511 ~~l~k~L~p~~~l~~vdVd~LE~s~ga~~~~~~k~ta~S~~~~~~~~~~kKKk~rKrkgk~pknyn~---~~tPDPERWL  587 (652)
T KOG2376|consen  511 ESLSKKLPPLKGLKAVDVDALEKSDGAKYSEAYKKTAVSQVEEKKSKELKKKKKRKRKGKLPKNYNP---KVTPDPERWL  587 (652)
T ss_pred             HHHhhcCCCcccchhcCchHhhhccCcchhhhhccccccchhhccchhhhhhcccccccCCcccCCC---CCCCChhhcc
Confidence            9999999999998899999999988999987741111111111111112334458899999999999   5899999999


Q ss_pred             CccccccCCccchhhhhhhhcCCCCCcccccc-ccCCCCCCCC
Q 012265          393 PKRERSSYRPRRKDKRAAQVRGSQGAVVREKH-DAGAAGASSN  434 (467)
Q Consensus       393 P~~eRs~yr~k~k~~~~~~~~gtQG~~~~~~~-~~~~~~~~~~  434 (467)
                      |+||||+||||||++++++++|||||++.++. ..++++++|.
T Consensus       588 P~reRS~yr~KrK~k~~~~~kgtQG~~~~~~se~v~~~~~s~~  630 (652)
T KOG2376|consen  588 PRRERSTYRPKRKGKRAAIIKGTQGGAANDKSEQVPSTSKSPR  630 (652)
T ss_pred             cchhccccCcccccchhhhhccccccccccchhhccCCCCCCC
Confidence            99999999999998888899999999998776 3345666666



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 57.2 bits (137), Expect = 8e-09
 Identities = 82/453 (18%), Positives = 146/453 (32%), Gaps = 130/453 (28%)

Query: 4   MYLIFVRIGQETLTDD-NFAEDDIEIE-LAPIAVQLAYVQQL--LGNTQEAFGAYT---- 55
           M   FV   +E L  +  F    I+ E   P  +   Y++Q   L N  + F  Y     
Sbjct: 78  MVQKFV---EEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRL 134

Query: 56  ---DIIKRNL-ADESSFAVAVNN--------LVAL----KGPKDVND------SLKKLDR 93
                +++ L     +  V ++         +          +   D      +LK  + 
Sbjct: 135 QPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNS 194

Query: 94  IKE--KDMQNFQLARVLDLRLSPKQREAI-YANRVLLLLHANKMDQARELVAALPDMFPD 150
            +   + +Q       L  ++ P       +++ + L +H+ +  + R L+ + P  + +
Sbjct: 195 PETVLEMLQK------LLYQIDPNWTSRSDHSSNIKLRIHSIQ-AELRRLLKSKP--YEN 245

Query: 151 SVMPLLLQAAVL--VRENKAGKAEELLGQFAEKLPD-KSKIILLAR-AQVAAAAN----- 201
                LL   VL  V+  KA  A      F     +   KI+L  R  QV    +     
Sbjct: 246 C----LL---VLLNVQNAKAWNA------F-----NLSCKILLTTRFKQVTDFLSAATTT 287

Query: 202 --------HPFIAAES---LAKIPDI--QHMPATVAT----LVALKERAGDIDGAAAVLD 244
                         E    L K  D   Q +P  V T     +++      I  A ++ D
Sbjct: 288 HISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSI------I--AESIRD 339

Query: 245 SAIKW--WLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELV----KTHGSIEALV 298
               W  W +   +  KL+ I++  +S  L      +   +F+ L       H     L 
Sbjct: 340 GLATWDNWKHVNCD--KLTTIIE--SS--LNVLEPAEYRKMFDRLSVFPPSAHIPTILLS 393

Query: 299 GLVTTSAHVDVDK--AESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGE 356
            +       DV     + ++  L        V+    E T     +    Y E+      
Sbjct: 394 LIWFDVIKSDVMVVVNKLHKYSL--------VEKQPKESTISIPSI----YLELKV---- 437

Query: 357 GKNKDKAKKKRKRKPRY--PKGFDPANPGPPPD 387
            K +++    R     Y  PK FD  +  PP  
Sbjct: 438 -KLENEYALHRSIVDHYNIPKTFDSDDLIPPYL 469


>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.82
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.82
3u4t_A272 TPR repeat-containing protein; structural genomics 99.81
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.8
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.8
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.79
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.74
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.74
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.71
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.71
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.7
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.7
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.69
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.69
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.68
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.68
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.67
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.67
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.66
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.63
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.63
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.62
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.61
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.6
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.58
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.58
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.57
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.56
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.54
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.52
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.52
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.5
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.49
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.49
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.49
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.48
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.48
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.48
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.48
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.47
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.46
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.46
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.42
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.41
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.41
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.39
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.37
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.34
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.33
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.33
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.3
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.3
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.29
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.28
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.28
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.25
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.24
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.23
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.21
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.2
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.2
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.18
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.12
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.12
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.12
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.1
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.1
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.1
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.07
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.06
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.05
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.02
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.0
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.0
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.0
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.99
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.98
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.98
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.98
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.97
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.97
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.96
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.96
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.95
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.94
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.93
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.92
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.91
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.9
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.9
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.89
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.88
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.87
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.86
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.86
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.84
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.83
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.82
3k9i_A117 BH0479 protein; putative protein binding protein, 98.82
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.78
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.77
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.67
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.66
3k9i_A117 BH0479 protein; putative protein binding protein, 98.64
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.62
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.61
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.61
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.59
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.58
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.55
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.48
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.45
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.45
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.43
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.31
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.27
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.13
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.05
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.96
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.93
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.92
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.77
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.63
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.53
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.4
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.37
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.01
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.98
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.65
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.62
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.57
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.42
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.34
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.97
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.82
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.64
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.54
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.3
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.18
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.08
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.53
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.43
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.38
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.12
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.08
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.88
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.5
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.42
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.39
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.05
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 92.99
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.86
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.8
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.61
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.49
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.43
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.01
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.31
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.12
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.89
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 84.07
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 82.63
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 81.06
2p58_C116 Putative type III secretion protein YSCG; type III 80.7
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 80.47
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=99.88  E-value=1.9e-20  Score=187.76  Aligned_cols=295  Identities=13%  Similarity=0.072  Sum_probs=197.2

Q ss_pred             hHHHHHHHhhhhhcCCCCChhhHHhhhhhHHHHHHHHHHHhCChHHHHHHHHHHhccCCCchHHHHHHHhhhhhccCCCC
Q 012265            4 MYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKD   83 (467)
Q Consensus         4 ~l~~A~~~~~~~l~~~~~~~ee~~~El~~i~~qlA~v~~~~G~~~eA~~~y~~~l~~~p~d~~~~~va~nnl~~l~~~~~   83 (467)
                      .++.|...++..+..+        +....++..+|.++..+|++++|+..|++++..+|++..++...+..+...++...
T Consensus        48 ~~~~a~~~~~~a~~~~--------p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~  119 (388)
T 1w3b_A           48 RLDRSAHFSTLAIKQN--------PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG  119 (388)
T ss_dssp             CHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSH
T ss_pred             CHHHHHHHHHHHHhcC--------CCchHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHH
Confidence            4567777777777533        23446678888888899999999999999888888887766544444444444444


Q ss_pred             hhHHHHhhhhhhhhhhhHHH-----------------HHHHhhc--CCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHhc
Q 012265           84 VNDSLKKLDRIKEKDMQNFQ-----------------LARVLDL--RLSPKQREAIYANRVLLLLHANKMDQARELVAAL  144 (467)
Q Consensus        84 ~~~a~~~l~~~~~~~~~~~~-----------------~~~~l~~--kL~~~q~~~l~~n~all~l~~~~~~~A~~~~~~l  144 (467)
                      +...+..+...   .|+...                 ....++.  ++. +.....+++.+.++...|++++|...++++
T Consensus       120 A~~~~~~al~~---~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a  195 (388)
T 1w3b_A          120 AVQAYVSALQY---NPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKA  195 (388)
T ss_dssp             HHHHHHHHHHH---CTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHh---CCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            44433333222   111000                 0000000  000 112345667777778888888888888888


Q ss_pred             cccCCCCchHHHHHHHHHHhcCChhHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHcCChHHHHHHHhccccCCC-ChhHH
Q 012265          145 PDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQH-MPATV  223 (467)
Q Consensus       145 ~~~~P~~~~~~ll~a~l~~~~~~~~~A~~~l~~~l~~~P~~~~~~~l~Laql~~~~g~~~~A~~~L~~~~~~~~-~p~~~  223 (467)
                      +..+|++..++...+.++...|++++|+..+++++..+|++... +..++.+|..+|++++|+..|+++++..+ .+.++
T Consensus       196 l~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~-~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~  274 (388)
T 1w3b_A          196 VTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVV-HGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAY  274 (388)
T ss_dssp             HHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHH-HHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHH
T ss_pred             HhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHH-HHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHH
Confidence            88888887777777777888888888888888888888877654 47778888888888888888888877654 56677


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHHHHHhccCCchHHHHHHHHHHHHHHCCChhHHHHHHHHHHHhcCC-HHHHHHHHH
Q 012265          224 ATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGS-IEALVGLVT  302 (467)
Q Consensus       224 ~~l~~ly~~~g~~~~A~~~l~~al~~~~~~~~~~~~~~~ll~~la~~~l~~g~~~~A~~~le~ll~~~pd-~~ala~Lv~  302 (467)
                      ..++.+|...|++++|+.+|++++...    |.+   ...+..+|.++...|++++|..+|+++++.+|+ ..++..+..
T Consensus       275 ~~l~~~~~~~g~~~~A~~~~~~al~~~----p~~---~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~  347 (388)
T 1w3b_A          275 CNLANALKEKGSVAEAEDCYNTALRLC----PTH---ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLAS  347 (388)
T ss_dssp             HHHHHHHHHHSCHHHHHHHHHHHHHHC----TTC---HHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHH
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHhhC----ccc---HHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHH
Confidence            777888888888888888888877652    111   234555778888888888888888888877765 455666666


Q ss_pred             Hh-ccCChhHHHHHHhc
Q 012265          303 TS-AHVDVDKAESYEKR  318 (467)
Q Consensus       303 a~-~~~d~~kA~~l~~~  318 (467)
                      ++ ...+.+.|..+.+.
T Consensus       348 ~~~~~g~~~~A~~~~~~  364 (388)
T 1w3b_A          348 VLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHHTTTCCHHHHHHHHH
T ss_pred             HHHHcCCHHHHHHHHHH
Confidence            65 34456777666543



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 467
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: ImpE-like
superfamily: ImpE-like
family: ImpE-like
domain: Hypothetical protein VPA1032
species: Vibrio parahaemolyticus [TaxId: 670]
 Score = 38.9 bits (90), Expect = 7e-04
 Identities = 21/122 (17%), Positives = 37/122 (30%), Gaps = 1/122 (0%)

Query: 128 LLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSK 187
            L   ++ QA EL+       P           +L  +    +A+E L Q  +  P+   
Sbjct: 6   ALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLP 65

Query: 188 I-ILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSA 246
               L     AA A   F    + AK+               L   + D +  + +    
Sbjct: 66  GASQLRHLVKAAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQI 125

Query: 247 IK 248
            +
Sbjct: 126 EE 127


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.86
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.82
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.61
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.46
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.45
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.36
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.3
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.17
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.16
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.15
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.14
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.13
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.1
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.09
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.05
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.03
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.03
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.0
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.99
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.93
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.7
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.68
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.68
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.58
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.58
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.51
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.5
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.47
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.43
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.41
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.37
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.3
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.97
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.95
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.69
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.49
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.19
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 85.59
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 85.0
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=1.1e-19  Score=176.87  Aligned_cols=296  Identities=12%  Similarity=0.062  Sum_probs=224.3

Q ss_pred             hHHHHHHHhhhhhcCCCCChhhHHhhhhhHHHHHHHHHHHhCChHHHHHHHHHHhccCCCchHHHHHHHhhhhhccCCCC
Q 012265            4 MYLIFVRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKD   83 (467)
Q Consensus         4 ~l~~A~~~~~~~l~~~~~~~ee~~~El~~i~~qlA~v~~~~G~~~eA~~~y~~~l~~~p~d~~~~~va~nnl~~l~~~~~   83 (467)
                      .+..|+++|++.+..+.   +     -..++..+|.++..+|++++|+..|++++..+|.+..++...+.-+...++   
T Consensus        14 ~~~~A~~~~~~~l~~~p---~-----~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~---   82 (388)
T d1w3ba_          14 DFEAAERHCMQLWRQEP---D-----NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ---   82 (388)
T ss_dssp             CHHHHHHHHHHHHHHCT---T-----CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC---
T ss_pred             CHHHHHHHHHHHHHhCC---C-----CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcc---
Confidence            46789999999987542   2     235678899999999999999999999999999998877655444433333   


Q ss_pred             hhHHHHhhhhhhhhhhhH--------------------------------------HHHHHHhhcCCC------------
Q 012265           84 VNDSLKKLDRIKEKDMQN--------------------------------------FQLARVLDLRLS------------  113 (467)
Q Consensus        84 ~~~a~~~l~~~~~~~~~~--------------------------------------~~~~~~l~~kL~------------  113 (467)
                      ..+++..+.......+..                                      ............            
T Consensus        83 ~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhh
Confidence            222222222211100000                                      000000000000            


Q ss_pred             --HHHHHHHHHHHHHHHHHcCCHHHHHHHHHhccccCCCCchHHHHHHHHHHhcCChhHHHHHHHHHHHhCCCcHHHHHH
Q 012265          114 --PKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILL  191 (467)
Q Consensus       114 --~~q~~~l~~n~all~l~~~~~~~A~~~~~~l~~~~P~~~~~~ll~a~l~~~~~~~~~A~~~l~~~l~~~P~~~~~~~l  191 (467)
                        .+....+.++.+.++...|.++.|...+++++..+|++..++...|.++...|++++|+..+.+.+...|..... ++
T Consensus       163 ~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~-~~  241 (388)
T d1w3ba_         163 ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVV-HG  241 (388)
T ss_dssp             HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHH-HH
T ss_pred             ccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHH-HH
Confidence              001134667788899999999999999999999999999999999999999999999999999999999998765 48


Q ss_pred             HHHHHHHHcCChHHHHHHHhccccCCC-ChhHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhccCCchHHHHHHHHHHH
Q 012265          192 ARAQVAAAANHPFIAAESLAKIPDIQH-MPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASF  270 (467)
Q Consensus       192 ~Laql~~~~g~~~~A~~~L~~~~~~~~-~p~~~~~l~~ly~~~g~~~~A~~~l~~al~~~~~~~~~~~~~~~ll~~la~~  270 (467)
                      .+|.+|...|++++|+..|++++++.+ ++.++..++.+|...|++++|+..|+.++...    +.   ....+..+|.+
T Consensus       242 ~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~----~~---~~~~~~~l~~~  314 (388)
T d1w3ba_         242 NLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC----PT---HADSLNNLANI  314 (388)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC----TT---CHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC----Cc---cchhhhHHHHH
Confidence            899999999999999999999998775 67788899999999999999999999988652    11   12345668999


Q ss_pred             HHHCCChhHHHHHHHHHHHhcCC-HHHHHHHHHHhc-cCChhHHHHHHhc
Q 012265          271 KLRHGREEDASHLFEELVKTHGS-IEALVGLVTTSA-HVDVDKAESYEKR  318 (467)
Q Consensus       271 ~l~~g~~~~A~~~le~ll~~~pd-~~ala~Lv~a~~-~~d~~kA~~l~~~  318 (467)
                      +...|++++|+..|+++++.+|+ ..++..+..++. ..+.+.|..+..+
T Consensus       315 ~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         315 KREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             HHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            99999999999999999999986 577777877774 4567888776653



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure