Citrus Sinensis ID: 012372
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 465 | ||||||
| 356557291 | 510 | PREDICTED: uncharacterized protein LOC10 | 0.892 | 0.813 | 0.566 | 1e-122 | |
| 225442553 | 476 | PREDICTED: uncharacterized protein LOC10 | 0.804 | 0.785 | 0.595 | 1e-119 | |
| 449491754 | 538 | PREDICTED: uncharacterized protein LOC10 | 0.860 | 0.743 | 0.545 | 1e-117 | |
| 449448002 | 499 | PREDICTED: uncharacterized protein LOC10 | 0.860 | 0.801 | 0.545 | 1e-116 | |
| 388512801 | 506 | unknown [Medicago truncatula] | 0.881 | 0.810 | 0.559 | 1e-115 | |
| 297743237 | 923 | unnamed protein product [Vitis vinifera] | 0.823 | 0.414 | 0.545 | 1e-115 | |
| 357454839 | 560 | Activating signal cointegrator 1 complex | 0.881 | 0.732 | 0.557 | 1e-114 | |
| 388491020 | 504 | unknown [Lotus japonicus] | 0.860 | 0.793 | 0.547 | 1e-113 | |
| 255549898 | 416 | nucleic acid binding protein, putative [ | 0.660 | 0.737 | 0.663 | 1e-108 | |
| 224054382 | 440 | predicted protein [Populus trichocarpa] | 0.670 | 0.709 | 0.619 | 1e-102 |
| >gi|356557291|ref|XP_003546951.1| PREDICTED: uncharacterized protein LOC100785531 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 445 bits (1145), Expect = e-122, Method: Compositional matrix adjust.
Identities = 243/429 (56%), Positives = 312/429 (72%), Gaps = 14/429 (3%)
Query: 5 SCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKK 64
+CR+ L V+R+LKFT+TYV SR + QG +Y+ LSC++ M G + K
Sbjct: 3 ACRS---LIGVERVLKFTNTYVASRSYCF-QGQSAYHCLSCNFMMSGRKKKICLEDHSIK 58
Query: 65 QKIINPVWRPVSTQASVNEESLVKDV---SEDGSQIQEMHCSTSSNVSDAQLGVEVAEAV 121
QK +N +WRP++T AS +ESL+KD SEDG ++QE CSTSS +S+ L AEA+
Sbjct: 59 QKKMNYIWRPIATNASSCDESLMKDALVESEDGCKVQETGCSTSSTISNEHLTKIAAEAM 118
Query: 122 NEGTDLTLSSSVSLDDIKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEK 181
+E + S S LD++++ LEG+ S E+HS+SV VGAS+ RFIKGK GSTQKK E+
Sbjct: 119 SEIAESDTSPSQLLDNVENRVLEGDSSVSTEKHSISVLVGASLFRFIKGKGGSTQKKIEE 178
Query: 182 EMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVH 241
+MGVKII+P+SK+ED + IEG S +SV ASEKIQAII E V S +LDYSHF+SLPLA+H
Sbjct: 179 DMGVKIIMPTSKEEDFVTIEGISVNSVNSASEKIQAIIDETVNSRNLDYSHFISLPLAIH 238
Query: 242 PELVDKLVNFQNTILGITDVCLDEN--VGSKSNED---ASDSEEKEQQVDQEHKVAVELN 296
PELV+KL++FQ++ILGI C+DEN S SNED +D++E +Q + VAVEL
Sbjct: 239 PELVNKLISFQHSILGIGS-CMDENTYTESDSNEDEGTTTDTKEVDQLSKENSGVAVELK 297
Query: 297 IGDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDR 356
DNSE VKV+ T+IP+V Y KAS+ S SDLGIDKSIFIKPKTFHLTVLMLKLWN +R
Sbjct: 298 ANDNSESVKVNLTNIPLVSYAPKASKSSAPSDLGIDKSIFIKPKTFHLTVLMLKLWNNER 357
Query: 357 VNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHA 416
+ A+ VL+SISSKVM+ALDNRPL IRLKGL+ M+GS KAR+LYAPVEEI RLL A
Sbjct: 358 IKTASEVLQSISSKVMEALDNRPLSIRLKGLECMKGSLAKARVLYAPVEEIASEGRLLRA 417
Query: 417 CRILI-AFV 424
C+++I A+V
Sbjct: 418 CQVIIDAYV 426
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225442553|ref|XP_002279009.1| PREDICTED: uncharacterized protein LOC100266864 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449491754|ref|XP_004158994.1| PREDICTED: uncharacterized protein LOC101227110 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449448002|ref|XP_004141755.1| PREDICTED: uncharacterized protein LOC101217658 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388512801|gb|AFK44462.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297743237|emb|CBI36104.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357454839|ref|XP_003597700.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] gi|355486748|gb|AES67951.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388491020|gb|AFK33576.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|255549898|ref|XP_002516000.1| nucleic acid binding protein, putative [Ricinus communis] gi|223544905|gb|EEF46420.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224054382|ref|XP_002298232.1| predicted protein [Populus trichocarpa] gi|222845490|gb|EEE83037.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 465 | ||||||
| TAIR|locus:2094907 | 257 | AT3G16220 "AT3G16220" [Arabido | 0.227 | 0.412 | 0.598 | 4.4e-36 | |
| ZFIN|ZDB-GENE-050417-80 | 353 | ascc1 "activating signal coint | 0.215 | 0.283 | 0.320 | 5.1e-12 | |
| UNIPROTKB|Q0IIJ9 | 357 | ASCC1 "Uncharacterized protein | 0.215 | 0.280 | 0.307 | 6.2e-12 | |
| UNIPROTKB|E2RKL0 | 357 | ASCC1 "Uncharacterized protein | 0.215 | 0.280 | 0.298 | 1.8e-11 | |
| UNIPROTKB|I3L6H8 | 357 | ASCC1 "Uncharacterized protein | 0.215 | 0.280 | 0.298 | 2.8e-11 | |
| UNIPROTKB|F1NT55 | 354 | ASCC1 "Uncharacterized protein | 0.245 | 0.322 | 0.262 | 4e-11 | |
| UNIPROTKB|I3LBQ6 | 407 | ASCC1 "Uncharacterized protein | 0.215 | 0.245 | 0.298 | 4.5e-11 | |
| UNIPROTKB|F5H874 | 379 | ASCC1 "Activating signal coint | 0.215 | 0.263 | 0.307 | 1.4e-10 | |
| MGI|MGI:1916340 | 356 | Ascc1 "activating signal coint | 0.212 | 0.278 | 0.310 | 1.5e-10 | |
| RGD|1359255 | 356 | Ascc1 "activating signal coint | 0.212 | 0.278 | 0.300 | 2e-10 |
| TAIR|locus:2094907 AT3G16220 "AT3G16220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 311 (114.5 bits), Expect = 4.4e-36, Sum P(2) = 4.4e-36
Identities = 64/107 (59%), Positives = 82/107 (76%)
Query: 324 STSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIR 383
ST +++GI+KSIF+ PKTFHLTV+MLKL N + V A N+L+SI S V AL NRP+FIR
Sbjct: 74 STLAEMGIEKSIFVTPKTFHLTVVMLKLENNESVVKAQNILQSIFSNVRQALKNRPVFIR 133
Query: 384 LKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILI-AFVSSIFA 429
L+GL+ M GS DK R+LYAPVEE+G RLL+AC ++I AF + FA
Sbjct: 134 LRGLECMSGSLDKTRVLYAPVEEVGREGRLLNACHVIIDAFENVGFA 180
|
|
| ZFIN|ZDB-GENE-050417-80 ascc1 "activating signal cointegrator 1 complex subunit 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0IIJ9 ASCC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKL0 ASCC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6H8 ASCC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NT55 ASCC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LBQ6 ASCC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H874 ASCC1 "Activating signal cointegrator 1 complex subunit 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916340 Ascc1 "activating signal cointegrator 1 complex subunit 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359255 Ascc1 "activating signal cointegrator 1 complex subunit 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034352001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (425 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 465 | |||
| PLN00108 | 257 | PLN00108, PLN00108, unknown protein; Provisional | 9e-35 | |
| pfam10469 | 205 | pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like d | 4e-24 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 7e-08 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-06 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 9e-06 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-05 | |
| PLN00108 | 257 | PLN00108, PLN00108, unknown protein; Provisional | 2e-04 | |
| PRK13763 | 180 | PRK13763, PRK13763, putative RNA-processing protei | 0.001 | |
| cd02395 | 120 | cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho | 0.001 | |
| TIGR03665 | 172 | TIGR03665, arCOG04150, arCOG04150 universal archae | 0.001 | |
| pfam10469 | 205 | pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like d | 0.004 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 0.004 |
| >gnl|CDD|177724 PLN00108, PLN00108, unknown protein; Provisional | Back alignment and domain information |
|---|
Score = 130 bits (327), Expect = 9e-35
Identities = 65/107 (60%), Positives = 83/107 (77%), Gaps = 1/107 (0%)
Query: 324 STSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIR 383
ST +++GI+KSIF+ PKTFHLTV+MLKL N + V A N+LKSI S V AL +RP+FIR
Sbjct: 74 STLAEMGIEKSIFVSPKTFHLTVVMLKLENNESVVKAQNILKSICSNVRQALKDRPVFIR 133
Query: 384 LKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILI-AFVSSIFA 429
L+GLD M GS DK R+LYAPVEE+G RLL+AC ++I AF ++ FA
Sbjct: 134 LRGLDCMNGSLDKTRVLYAPVEEVGHEGRLLNACHVIIDAFENAGFA 180
|
Length = 257 |
| >gnl|CDD|220770 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|177724 PLN00108, PLN00108, unknown protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|220770 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 100.0 | |
| PLN00108 | 257 | unknown protein; Provisional | 100.0 | |
| PF10469 | 209 | AKAP7_NLS: AKAP7 2'5' RNA ligase-like domain; Inte | 99.96 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.33 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.29 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.2 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.0 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.85 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 98.83 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.8 | |
| PF13014 | 43 | KH_3: KH domain | 98.68 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.67 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.62 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.58 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.57 | |
| TIGR02258 | 179 | 2_5_ligase 2'-5' RNA ligase. This protein family c | 98.56 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.48 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.43 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 98.33 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.2 | |
| PRK15124 | 176 | 2'-5' RNA ligase; Provisional | 97.99 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 97.98 | |
| COG1514 | 180 | LigT 2'-5' RNA ligase [Translation, ribosomal stru | 97.97 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 97.95 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 97.93 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 97.9 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.88 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 97.81 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 97.74 | |
| PHA02574 | 149 | 57B hypothetical protein; Provisional | 97.5 | |
| PRK13679 | 168 | hypothetical protein; Provisional | 97.45 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 97.44 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 97.3 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 97.21 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 97.17 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 97.03 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 96.96 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.93 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 96.89 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 96.86 | |
| PF05213 | 248 | Corona_NS2A: Coronavirus NS2A protein; InterPro: I | 96.84 | |
| PF13563 | 153 | 2_5_RNA_ligase2: 2'-5' RNA ligase superfamily; PDB | 96.44 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 96.03 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 96.01 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 95.98 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.83 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 95.83 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 95.68 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 95.6 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 95.1 | |
| PF02834 | 87 | LigT_PEase: LigT like Phosphoesterase; InterPro: I | 94.98 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 94.21 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 93.58 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 93.06 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 92.43 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 91.3 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 88.43 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 88.14 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 87.3 | |
| PRK13764 | 602 | ATPase; Provisional | 86.7 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 86.54 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 85.88 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 85.82 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 85.53 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 85.39 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 83.94 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 81.01 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 80.36 |
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-43 Score=354.07 Aligned_cols=275 Identities=31% Similarity=0.446 Sum_probs=236.5
Q ss_pred ccccccccCCceeeeccccccccccccccccCCCCCceEee-ecccCCcccccccceeeeeecccccccccCcccccccc
Q 012372 60 YGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEM-HCSTSSNVSDAQLGVEVAEAVNEGTDLTLSSSVSLDDI 138 (465)
Q Consensus 60 ~~~kk~k~~~~~wrpvst~as~~~~~l~~~~~~~~~~v~e~-~~~~s~~~s~~~~~~~~~~~~~e~~~~~~sss~~~~~~ 138 (465)
+..++++..|.+|+|++|+..+.. .+++...|++ .|.++...+. ++ .
T Consensus 2 ~~~~~~~~~n~~~~~~~~~t~~~~-------~~~~~e~~~~~~c~d~p~~~~------------dv-------------~ 49 (345)
T KOG2814|consen 2 YRKTRYNLVNDVSFDLNTDTTFAD-------MSEEFEAQTSAECVDMPGDTV------------DV-------------E 49 (345)
T ss_pred cchhhhhhhhhcccCccccccccc-------CchhhHHHhHhhcccCCCChH------------Hh-------------h
Confidence 456789999999999999988763 3445566666 7777764433 11 0
Q ss_pred cccccCCCCccCCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCC-CCCcEEEEecCHHHHHHHHHHHHH
Q 012372 139 KDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSK-KEDSIIIEGNSTDSVAKASEKIQA 217 (465)
Q Consensus 139 e~~~~~~~~~~~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~-~sg~I~ItG~ske~V~~A~~rI~~ 217 (465)
+.. -.++|+.+++|++.++++|||+.|.|+|+||+||+|+|-+|+++ +.+.|+|+|.++++|.+|.+||..
T Consensus 50 ~~~--------~~~~~~~si~v~s~~~~~lig~~g~trkkle~Etq~~i~lp~p~~n~~~i~i~~~~~~~V~~a~~Ri~~ 121 (345)
T KOG2814|consen 50 DDA--------GAKDFSSSILVRSSFIGWLIGKQGKTRKKLEEETQTNIFLPRPNTNKEEIKIIGISRNCVIQALERIAK 121 (345)
T ss_pred hcc--------ccccchhhhhhhHHHhhhhhcccchHHHHHHHhhccceEccCCCCCcceEEEeehhHHHHHHHHHHHHH
Confidence 011 12289999999999999999999999999999999999999998 589999999999999999999999
Q ss_pred HHHHHhhCCCCcccceEeeccccchhhhhhHHHHHHHHhcCcCcccccccCCCCCCCCCchHHHHHhhhhhhhhhhhhcc
Q 012372 218 IIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSNEDASDSEEKEQQVDQEHKVAVELNI 297 (465)
Q Consensus 218 Iv~e~~kk~k~~~thFVsIPl~~hP~I~~~~~~Fq~sIL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~ 297 (465)
++++.++ +.++|||+++|++ ..++.++|..|+...+-..
T Consensus 122 ~ids~r~--s~p~thflal~ln-e~eVqe~f~~fke~~~~~e-------------------------------------- 160 (345)
T KOG2814|consen 122 LIDSDRK--SFPITHFLALPLN-EHEVQEGFLAFKELKPFIE-------------------------------------- 160 (345)
T ss_pred HHHhhhh--cCchhhhhhhhcc-hHHHHHHHHHHHhhhhhHH--------------------------------------
Confidence 9999887 6999999999998 7889999999983322210
Q ss_pred CCCCcceecccccccccccccccCCCCCCCCCCCCCcCccCCCeeeEEEeeeEeCChhHHHHHHHHHHHhHHHHHhhhCC
Q 012372 298 GDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDN 377 (465)
Q Consensus 298 ~~~~~~v~~~~~~~~~v~~~~~~~~~~~~~~~GIdesiF~~p~tLHLTLgVL~L~~~eev~kA~~~L~slk~~I~~iL~~ 377 (465)
..-+.|++.++|++|+++||||||++|++++++++|+++|+++.++++..+++
T Consensus 161 ---------------------------sl~~~g~~~s~F~~p~~~HLTvgm~~L~~dd~vq~a~e~les~~~e~~~~~~~ 213 (345)
T KOG2814|consen 161 ---------------------------SLLDGGIDKSLFQGPGTFHLTVGMLKLLNDDDVQKALEILESTFQEIRIDVGE 213 (345)
T ss_pred ---------------------------HhhccchhhccccCCceeeEEEEEEEecChHHHHHHHHHHHHHHHHHHhccCC
Confidence 01256899999999999999999999999999999999999999999999999
Q ss_pred CCcEEEEeecccCCCCCCcceEEEEeceecCCcchHHHHH-HHHHHHHHHh--ccCCCcceEEeeeeh
Q 012372 378 RPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHAC-RILIAFVSSI--FAPLCTSLIIKMKQY 442 (465)
Q Consensus 378 ~pL~I~LkGL~~MnddPs~a~VLYAk~~~~d~~~rL~~~c-q~I~d~F~e~--F~p~~~~~i~~~~~~ 442 (465)
+|+.|.++|+++|||||+.++||||+|.+.+...+|+.+| +.|..+|+.. +.--...++|||+..
T Consensus 214 kp~~i~lkG~~~mnddP~~~kVLYAkv~~~~~e~~l~~~~~~~i~~~f~~~~li~k~~~~~kLH~Tvm 281 (345)
T KOG2814|consen 214 KPLFIDLKGLDKMNDDPSLTKVLYAKVEPDDYEKFLQHRCGERILERFVASGLIKKESSSLKLHCTVM 281 (345)
T ss_pred CceeeeccchhhhcCCHhHheeeeeeccCcchHHHHHHHHHHHHHHHHHHhcchhccccccEEEEEEe
Confidence 9999999999999999999999999999888899999999 9999999985 666677899999975
|
|
| >PLN00108 unknown protein; Provisional | Back alignment and domain information |
|---|
| >PF10469 AKAP7_NLS: AKAP7 2'5' RNA ligase-like domain; InterPro: IPR019510 This entry represents the N-terminal nuclear localisation signal-containing domain found in the cyclic AMP-dependent protein kinase A (PKA) anchor protein, AKAP7 | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02258 2_5_ligase 2'-5' RNA ligase | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK15124 2'-5' RNA ligase; Provisional | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >COG1514 LigT 2'-5' RNA ligase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02574 57B hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13679 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05213 Corona_NS2A: Coronavirus NS2A protein; InterPro: IPR007878 This entry is represented by Coronavirus non-structural protein 2A (32kDa); it is a family of uncharacterised viral proteins | Back alignment and domain information |
|---|
| >PF13563 2_5_RNA_ligase2: 2'-5' RNA ligase superfamily; PDB: 1IUH_A | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02834 LigT_PEase: LigT like Phosphoesterase; InterPro: IPR014051 This entry represents a domain found in a number of known and predicted phosphoesterases | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 465 | |||
| 2vfk_A | 205 | AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Hom | 4e-15 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 9e-10 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 5e-09 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 7e-09 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-08 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-07 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-06 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 5e-05 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 7e-05 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 2e-04 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-04 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-04 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 5e-04 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 5e-04 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 7e-04 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 7e-04 |
| >2vfk_A AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Homo sapiens} PDB: 2vfl_A* 2vfy_A Length = 205 | Back alignment and structure |
|---|
Score = 73.1 bits (179), Expect = 4e-15
Identities = 19/99 (19%), Positives = 40/99 (40%), Gaps = 6/99 (6%)
Query: 333 KSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRG 392
+ +FH+T+L+++L N+D VN T+ L + V + L+ + L + G+ +G
Sbjct: 35 TKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQG 94
Query: 393 SKDKARILYAPVEEIGDGDRLLHAC-RILIAFVSSIFAP 430
++ + + + LL F
Sbjct: 95 -----QVGFVKLADGDHVSALLEIAETAKRTFQEKGILA 128
|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.56 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.47 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.47 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.46 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.46 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.44 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.44 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.34 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.33 | |
| 2vfk_A | 205 | AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Hom | 99.32 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.28 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.27 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.27 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.26 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.24 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.24 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.24 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.24 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.23 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.21 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.18 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 99.17 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.15 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.13 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.12 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.07 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 99.06 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.05 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.05 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.04 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.02 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.95 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 98.93 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.93 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 98.84 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.83 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.74 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.72 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 98.65 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.63 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.6 | |
| 1vgj_A | 184 | Hypothetical protein PH0099; alpha+beta, LIGT-like | 98.56 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.38 | |
| 1iuh_A | 198 | 2'-5' RNA ligase; riken structural genomics/proteo | 98.03 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 97.98 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 97.95 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 97.93 | |
| 2d4g_A | 171 | Hypothetical protein BSU11850; beta barrel, alpha | 97.83 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 97.77 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 97.47 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 97.31 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 96.9 | |
| 1jh6_A | 189 | Cyclic phosphodiesterase; ADP-ribose 1'',2''-cycli | 96.54 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 84.62 |
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
Probab=99.56 E-value=7.6e-15 Score=122.98 Aligned_cols=74 Identities=26% Similarity=0.402 Sum_probs=68.5
Q ss_pred CCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCCC-CCcEEEEecCHHHHHHHHHHHHHHHHHHhh
Q 012372 150 SAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKK-EDSIIIEGNSTDSVAKASEKIQAIIAEAVE 224 (465)
Q Consensus 150 ~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~~-sg~I~ItG~ske~V~~A~~rI~~Iv~e~~k 224 (465)
..++++..+.||+++|++|||+||+|||+|+++|||+|+||+.++ ++.|+|+|+ .+++++|+++|+.++.+..+
T Consensus 13 l~~~~t~~i~Ip~~~ig~IIG~gG~~Ik~I~~etg~~I~i~~~~~~~~~V~I~G~-~e~v~~A~~~I~~i~~~~~~ 87 (94)
T 2cte_A 13 LQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGT-KEGIEKARHEVLLISAEQDK 87 (94)
T ss_dssp CCSCEEEEEECCTTTHHHHHCSSSCHHHHHHHHTTCCCBCCCTTSSCCEEEEEEC-HHHHHHHHHHHHHHHHHHHT
T ss_pred hCCceEEEEEEChHHeeeeECCCChhHHHHHHHHCCEEEeCCCCCCCCeEEEEEC-HHHHHHHHHHHHHHhhcccc
Confidence 467899999999999999999999999999999999999998654 589999998 99999999999999998655
|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2vfk_A AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Homo sapiens} PDB: 2vfl_A* 2vfy_A | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1vgj_A Hypothetical protein PH0099; alpha+beta, LIGT-like, structural genomics, ligase; 1.94A {Pyrococcus horikoshii} PDB: 1vdx_A 2fyh_A | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1iuh_A 2'-5' RNA ligase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: d.61.1.2 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2d4g_A Hypothetical protein BSU11850; beta barrel, alpha helix, structural genomics, unknown function; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >1jh6_A Cyclic phosphodiesterase; ADP-ribose 1'',2''-cyclic phosphate, RNA processing, 2',3'-C nucleotide phosphodiesterase, hydrolase; 1.80A {Arabidopsis thaliana} SCOP: d.61.1.1 PDB: 1fsi_A 1jh7_A* | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 465 | ||||
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-10 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 8e-10 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 8e-09 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-08 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 1e-08 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-08 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 6e-08 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 9e-08 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-07 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 7e-07 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 9e-07 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-06 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 2e-06 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 3e-06 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 2e-05 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 4e-05 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 5e-05 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 8e-05 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-04 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 5e-04 |
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Vigilin species: Human (Homo sapiens) [TaxId: 9606]
Score = 53.9 bits (130), Expect = 4e-10
Identities = 17/69 (24%), Positives = 30/69 (43%)
Query: 153 RHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKAS 212
+ S +V + RF+ GK G + E + KI +P + I + + + KA
Sbjct: 9 QASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKAR 68
Query: 213 EKIQAIIAE 221
++ I AE
Sbjct: 69 HEVLLISAE 77
|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.35 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.29 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.25 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.22 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 99.22 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.22 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.21 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.21 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.2 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.19 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.15 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.13 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.96 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.78 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.45 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.32 | |
| d1iuha_ | 183 | 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId | 98.29 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.92 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 95.69 | |
| d1jh6a_ | 181 | tRNA splicing product Appr>p cyclic nucleotide pho | 95.09 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 89.82 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 89.31 |
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Vigilin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.52 E-value=8.5e-15 Score=117.51 Aligned_cols=74 Identities=26% Similarity=0.402 Sum_probs=67.2
Q ss_pred CCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCCC-CCcEEEEecCHHHHHHHHHHHHHHHHHHhh
Q 012372 150 SAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKK-EDSIIIEGNSTDSVAKASEKIQAIIAEAVE 224 (465)
Q Consensus 150 ~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~~-sg~I~ItG~ske~V~~A~~rI~~Iv~e~~k 224 (465)
...+++.++.||+.+|++|||+||.++++|+++|||+|+||+.++ +..|+|+|+ .++|++|+.+|+.++++..+
T Consensus 6 ~~~~~t~~i~Ip~~~~~~iIG~~G~~i~~I~~~tg~~I~~p~~~~~~~~v~I~G~-~~~v~~A~~~I~~iv~e~~~ 80 (81)
T d2ctea1 6 LQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGT-KEGIEKARHEVLLISAEQDK 80 (81)
T ss_dssp CCSCEEEEEECCTTTHHHHHCSSSCHHHHHHHHTTCCCBCCCTTSSCCEEEEEEC-HHHHHHHHHHHHHHHHHHHT
T ss_pred hcCceEEEEEECHHHHhhccCCCChhHHHHHHHhCCEEEECCCCCCCCEEEEEeC-HHHHHHHHHHHHHHHHHHhc
Confidence 356789999999999999999999999999999999999999876 567899996 78999999999999998543
|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iuha_ d.61.1.2 (A:) 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jh6a_ d.61.1.1 (A:) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|