Citrus Sinensis ID: 012372

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MLTCSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEAVNEGTDLTLSSSVSLDDIKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSNEDASDSEEKEQQVDQEHKVAVELNIGDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEPS
cccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHccEEEcccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHcccccccHHHHEEEEEEEEEEEHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHcHHHHcccccHHccccccEEEccccccccccHHHHcccccHccccccccccccccccEEEEccccccccHHHHcccccccccEEEEEEEcccccccccccEEEEEccccccccccccccHcccccccccccccEEEcccEEEEEEEEcHHHHHHHcccccccHHHHHHHcccEEEEcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccEEEEEEccccccEEEEEcccEEEEccccccccccccccccccHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mltcscrahfRLDRVDRLLKFTStyvnsrpldysqggcsyyslscdwkmggardnqgavygdkkqkiinpvwrpvstqasvneeslvkdvsedgsqiqemhcstssnvsdaQLGVEVAEAVNegtdltlsssvslddikdetlegepvpsaerhslSVEVGASVIRFIkgkegstqKKFEKEMGVkiilpsskkedsiiiegnstDSVAKASEKIQAIIAEAvespsldyshfvslplavhpelVDKLVNFQNTILGitdvcldenvgsksnedasdseekeQQVDQEHKVAVELnigdnservkvdrtsipivgyeakasrpstssdlgidksifikpkTFHLTVLMLKLWNKDRVNAATNVLKSISSKVmdaldnrplfirlkgldlmrgskdkarilyapveeigdgdRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNllkfleps
mltcscrahfrldrvdRLLKFTStyvnsrpldysqgGCSYYSLSCDWKMGGARDNQGAvygdkkqkiinpvwrpvstqasvnEESLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEAVNegtdltlsssvslddiKDETLegepvpsaerhslsvevGASVIRFikgkegstqkkfekemgvkiilpsskkedsiIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSnedasdseekeqqvdqeHKVAvelnigdnservkvdrtsipivgyeakasrpstssdlgidKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSisskvmdaldnrplfirlkgldlmrgskDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEPS
MLTCSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEAVNEGtdltlsssvslddIKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSNEDASDSEEKEQQVDQEHKVAVELNIGDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEPS
***CSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKKQKIINPVWRPV************************************************************************************VGASVIRFIK*****************II**************************IQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDE********************************************SIPIVGY************LGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFL***
*******AHFRLDRVDRLLKFTSTYV************************************************V*TQA*********************************************************DIKDETL*********RHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILP***************DSVAKASEKIQAII*******SLDYSHFVSLPLAVHPELVDKLVNFQNTILGI***************************DQEHKVAVELNIGDNSERVKVDRTSIP*********************SIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEE*****RLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEP*
MLTCSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEAVNEGTDLTLSSSVSLDDIKDETL*************SVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENV*********************HKVAVELNIGDNSERVKVDRTSIPIVGYEA*********DLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEPS
MLTCSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMG******************NPVWR**STQASVN**SLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEA*****************IKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDV************************DQEHKVAVELNIGDNSERVKVDRTSIPIVGYEAK********DLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTCSCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEMHCSTSSNVSDAQLGVEVAEAVNEGTDLTLSSSVSLDDIKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSNEDASDSEEKEQQVDQEHKVAVELNIGDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILIAFVSSIFAPLCTSLIIKMKQYYIISLNLIVNFIQWNLLKFLEPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query465 2.2.26 [Sep-21-2011]
Q8N9N2400 Activating signal cointeg yes no 0.215 0.25 0.307 6e-05
Q9D8Z1356 Activating signal cointeg yes no 0.212 0.278 0.310 0.0001
>sp|Q8N9N2|ASCC1_HUMAN Activating signal cointegrator 1 complex subunit 1 OS=Homo sapiens GN=ASCC1 PE=1 SV=1 Back     alignment and function desciption
 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 326 SSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVM-DALDNRPLFIRL 384
           S D G+D SIF  PK  HLT+ ML L +++ +     +L+    + + D    +PL + +
Sbjct: 190 SMDHGVDSSIFQNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFINDISGGKPLEVEM 249

Query: 385 KGLDLMRGSKDKARILYAPVEEIGDGDRLLHAC--RILIAFVSS 426
            G++ M        +LYA V  + DG   L     R+L  F +S
Sbjct: 250 AGIEYMNDDPGMVDVLYAKV-HMKDGSNRLQELVDRVLERFQAS 292
Enhances NF-kappa-B, SRF and AP1 transactivation. In cells responding to gastrin-activated paracrine signals, it is involved in the induction of SERPINB2 expression by gastrin.
Homo sapiens (taxid: 9606)
>sp|Q9D8Z1|ASCC1_MOUSE Activating signal cointegrator 1 complex subunit 1 OS=Mus musculus GN=Ascc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
356557291510 PREDICTED: uncharacterized protein LOC10 0.892 0.813 0.566 1e-122
225442553476 PREDICTED: uncharacterized protein LOC10 0.804 0.785 0.595 1e-119
449491754538 PREDICTED: uncharacterized protein LOC10 0.860 0.743 0.545 1e-117
449448002499 PREDICTED: uncharacterized protein LOC10 0.860 0.801 0.545 1e-116
388512801506 unknown [Medicago truncatula] 0.881 0.810 0.559 1e-115
297743237 923 unnamed protein product [Vitis vinifera] 0.823 0.414 0.545 1e-115
357454839560 Activating signal cointegrator 1 complex 0.881 0.732 0.557 1e-114
388491020504 unknown [Lotus japonicus] 0.860 0.793 0.547 1e-113
255549898416 nucleic acid binding protein, putative [ 0.660 0.737 0.663 1e-108
224054382440 predicted protein [Populus trichocarpa] 0.670 0.709 0.619 1e-102
>gi|356557291|ref|XP_003546951.1| PREDICTED: uncharacterized protein LOC100785531 [Glycine max] Back     alignment and taxonomy information
 Score =  445 bits (1145), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 243/429 (56%), Positives = 312/429 (72%), Gaps = 14/429 (3%)

Query: 5   SCRAHFRLDRVDRLLKFTSTYVNSRPLDYSQGGCSYYSLSCDWKMGGARDNQGAVYGDKK 64
           +CR+   L  V+R+LKFT+TYV SR   + QG  +Y+ LSC++ M G +          K
Sbjct: 3   ACRS---LIGVERVLKFTNTYVASRSYCF-QGQSAYHCLSCNFMMSGRKKKICLEDHSIK 58

Query: 65  QKIINPVWRPVSTQASVNEESLVKDV---SEDGSQIQEMHCSTSSNVSDAQLGVEVAEAV 121
           QK +N +WRP++T AS  +ESL+KD    SEDG ++QE  CSTSS +S+  L    AEA+
Sbjct: 59  QKKMNYIWRPIATNASSCDESLMKDALVESEDGCKVQETGCSTSSTISNEHLTKIAAEAM 118

Query: 122 NEGTDLTLSSSVSLDDIKDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEK 181
           +E  +   S S  LD++++  LEG+   S E+HS+SV VGAS+ RFIKGK GSTQKK E+
Sbjct: 119 SEIAESDTSPSQLLDNVENRVLEGDSSVSTEKHSISVLVGASLFRFIKGKGGSTQKKIEE 178

Query: 182 EMGVKIILPSSKKEDSIIIEGNSTDSVAKASEKIQAIIAEAVESPSLDYSHFVSLPLAVH 241
           +MGVKII+P+SK+ED + IEG S +SV  ASEKIQAII E V S +LDYSHF+SLPLA+H
Sbjct: 179 DMGVKIIMPTSKEEDFVTIEGISVNSVNSASEKIQAIIDETVNSRNLDYSHFISLPLAIH 238

Query: 242 PELVDKLVNFQNTILGITDVCLDEN--VGSKSNED---ASDSEEKEQQVDQEHKVAVELN 296
           PELV+KL++FQ++ILGI   C+DEN    S SNED    +D++E +Q   +   VAVEL 
Sbjct: 239 PELVNKLISFQHSILGIGS-CMDENTYTESDSNEDEGTTTDTKEVDQLSKENSGVAVELK 297

Query: 297 IGDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDR 356
             DNSE VKV+ T+IP+V Y  KAS+ S  SDLGIDKSIFIKPKTFHLTVLMLKLWN +R
Sbjct: 298 ANDNSESVKVNLTNIPLVSYAPKASKSSAPSDLGIDKSIFIKPKTFHLTVLMLKLWNNER 357

Query: 357 VNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHA 416
           +  A+ VL+SISSKVM+ALDNRPL IRLKGL+ M+GS  KAR+LYAPVEEI    RLL A
Sbjct: 358 IKTASEVLQSISSKVMEALDNRPLSIRLKGLECMKGSLAKARVLYAPVEEIASEGRLLRA 417

Query: 417 CRILI-AFV 424
           C+++I A+V
Sbjct: 418 CQVIIDAYV 426

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225442553|ref|XP_002279009.1| PREDICTED: uncharacterized protein LOC100266864 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449491754|ref|XP_004158994.1| PREDICTED: uncharacterized protein LOC101227110 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448002|ref|XP_004141755.1| PREDICTED: uncharacterized protein LOC101217658 [Cucumis sativus] Back     alignment and taxonomy information
>gi|388512801|gb|AFK44462.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297743237|emb|CBI36104.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357454839|ref|XP_003597700.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] gi|355486748|gb|AES67951.1| Activating signal cointegrator 1 complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|388491020|gb|AFK33576.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255549898|ref|XP_002516000.1| nucleic acid binding protein, putative [Ricinus communis] gi|223544905|gb|EEF46420.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224054382|ref|XP_002298232.1| predicted protein [Populus trichocarpa] gi|222845490|gb|EEE83037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
TAIR|locus:2094907257 AT3G16220 "AT3G16220" [Arabido 0.227 0.412 0.598 4.4e-36
ZFIN|ZDB-GENE-050417-80353 ascc1 "activating signal coint 0.215 0.283 0.320 5.1e-12
UNIPROTKB|Q0IIJ9357 ASCC1 "Uncharacterized protein 0.215 0.280 0.307 6.2e-12
UNIPROTKB|E2RKL0357 ASCC1 "Uncharacterized protein 0.215 0.280 0.298 1.8e-11
UNIPROTKB|I3L6H8357 ASCC1 "Uncharacterized protein 0.215 0.280 0.298 2.8e-11
UNIPROTKB|F1NT55354 ASCC1 "Uncharacterized protein 0.245 0.322 0.262 4e-11
UNIPROTKB|I3LBQ6 407 ASCC1 "Uncharacterized protein 0.215 0.245 0.298 4.5e-11
UNIPROTKB|F5H874379 ASCC1 "Activating signal coint 0.215 0.263 0.307 1.4e-10
MGI|MGI:1916340356 Ascc1 "activating signal coint 0.212 0.278 0.310 1.5e-10
RGD|1359255356 Ascc1 "activating signal coint 0.212 0.278 0.300 2e-10
TAIR|locus:2094907 AT3G16220 "AT3G16220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 4.4e-36, Sum P(2) = 4.4e-36
 Identities = 64/107 (59%), Positives = 82/107 (76%)

Query:   324 STSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIR 383
             ST +++GI+KSIF+ PKTFHLTV+MLKL N + V  A N+L+SI S V  AL NRP+FIR
Sbjct:    74 STLAEMGIEKSIFVTPKTFHLTVVMLKLENNESVVKAQNILQSIFSNVRQALKNRPVFIR 133

Query:   384 LKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILI-AFVSSIFA 429
             L+GL+ M GS DK R+LYAPVEE+G   RLL+AC ++I AF +  FA
Sbjct:   134 LRGLECMSGSLDKTRVLYAPVEEVGREGRLLNACHVIIDAFENVGFA 180
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
ZFIN|ZDB-GENE-050417-80 ascc1 "activating signal cointegrator 1 complex subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIJ9 ASCC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKL0 ASCC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6H8 ASCC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT55 ASCC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LBQ6 ASCC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5H874 ASCC1 "Activating signal cointegrator 1 complex subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916340 Ascc1 "activating signal cointegrator 1 complex subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359255 Ascc1 "activating signal cointegrator 1 complex subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034352001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (425 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
PLN00108257 PLN00108, PLN00108, unknown protein; Provisional 9e-35
pfam10469205 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like d 4e-24
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 7e-08
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 3e-06
smart0032268 smart00322, KH, K homology RNA-binding domain 9e-06
pfam0001359 pfam00013, KH_1, KH domain 2e-05
PLN00108257 PLN00108, PLN00108, unknown protein; Provisional 2e-04
PRK13763180 PRK13763, PRK13763, putative RNA-processing protei 0.001
cd02395120 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho 0.001
TIGR03665172 TIGR03665, arCOG04150, arCOG04150 universal archae 0.001
pfam10469205 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like d 0.004
pfam1301442 pfam13014, KH_3, KH domain 0.004
>gnl|CDD|177724 PLN00108, PLN00108, unknown protein; Provisional Back     alignment and domain information 
 Score =  130 bits (327), Expect = 9e-35
 Identities = 65/107 (60%), Positives = 83/107 (77%), Gaps = 1/107 (0%)

Query: 324 STSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIR 383
           ST +++GI+KSIF+ PKTFHLTV+MLKL N + V  A N+LKSI S V  AL +RP+FIR
Sbjct: 74  STLAEMGIEKSIFVSPKTFHLTVVMLKLENNESVVKAQNILKSICSNVRQALKDRPVFIR 133

Query: 384 LKGLDLMRGSKDKARILYAPVEEIGDGDRLLHACRILI-AFVSSIFA 429
           L+GLD M GS DK R+LYAPVEE+G   RLL+AC ++I AF ++ FA
Sbjct: 134 LRGLDCMNGSLDKTRVLYAPVEEVGHEGRLLNACHVIIDAFENAGFA 180

Length = 257
>gnl|CDD|220770 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|177724 PLN00108, PLN00108, unknown protein; Provisional Back     alignment and domain information
>gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional Back     alignment and domain information
>gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>gnl|CDD|220770 pfam10469, AKAP7_NLS, AKAP7 2'5' RNA ligase-like domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 465
KOG2814345 consensus Transcription coactivator complex, P50 c 100.0
PLN00108257 unknown protein; Provisional 100.0
PF10469209 AKAP7_NLS: AKAP7 2'5' RNA ligase-like domain; Inte 99.96
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.33
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.29
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.2
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.0
smart0032269 KH K homology RNA-binding domain. 98.85
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.83
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.8
PF1301443 KH_3: KH domain 98.68
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.67
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 98.62
PRK13763180 putative RNA-processing protein; Provisional 98.58
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 98.57
TIGR02258179 2_5_ligase 2'-5' RNA ligase. This protein family c 98.56
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.48
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 98.43
KOG1676600 consensus K-homology type RNA binding proteins [RN 98.33
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 98.2
PRK15124176 2'-5' RNA ligase; Provisional 97.99
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.98
COG1514180 LigT 2'-5' RNA ligase [Translation, ribosomal stru 97.97
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 97.95
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 97.93
PRK13763180 putative RNA-processing protein; Provisional 97.9
KOG0119554 consensus Splicing factor 1/branch point binding p 97.88
KOG2208753 consensus Vigilin [Lipid transport and metabolism] 97.81
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 97.74
PHA02574149 57B hypothetical protein; Provisional 97.5
PRK13679168 hypothetical protein; Provisional 97.45
KOG1676 600 consensus K-homology type RNA binding proteins [RN 97.44
KOG2191402 consensus RNA-binding protein NOVA1/PASILLA and re 97.3
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 97.21
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.17
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 97.03
KOG1067760 consensus Predicted RNA-binding polyribonucleotide 96.96
KOG1588259 consensus RNA-binding protein Sam68 and related KH 96.93
COG5176269 MSL5 Splicing factor (branch point binding protein 96.89
KOG2113394 consensus Predicted RNA binding protein, contains 96.86
PF05213248 Corona_NS2A: Coronavirus NS2A protein; InterPro: I 96.84
PF13563153 2_5_RNA_ligase2: 2'-5' RNA ligase superfamily; PDB 96.44
COG1094194 Predicted RNA-binding protein (contains KH domains 96.03
COG1094194 Predicted RNA-binding protein (contains KH domains 96.01
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.98
PRK12704520 phosphodiesterase; Provisional 95.83
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 95.83
PRK00106535 hypothetical protein; Provisional 95.68
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 95.6
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 95.1
PF0283487 LigT_PEase: LigT like Phosphoesterase; InterPro: I 94.98
PRK12705508 hypothetical protein; Provisional 94.21
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 93.58
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 93.06
KOG2208753 consensus Vigilin [Lipid transport and metabolism] 92.43
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 91.3
COG1855604 ATPase (PilT family) [General function prediction 88.43
PRK08406140 transcription elongation factor NusA-like protein; 88.14
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 87.3
PRK13764602 ATPase; Provisional 86.7
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 86.54
PRK0046875 hypothetical protein; Provisional 85.88
PRK0282177 hypothetical protein; Provisional 85.82
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 85.53
COG183776 Predicted RNA-binding protein (contains KH domain) 85.39
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 83.94
PRK0106478 hypothetical protein; Provisional 81.01
PRK08406140 transcription elongation factor NusA-like protein; 80.36
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-43  Score=354.07  Aligned_cols=275  Identities=31%  Similarity=0.446  Sum_probs=236.5

Q ss_pred             ccccccccCCceeeeccccccccccccccccCCCCCceEee-ecccCCcccccccceeeeeecccccccccCcccccccc
Q 012372           60 YGDKKQKIINPVWRPVSTQASVNEESLVKDVSEDGSQIQEM-HCSTSSNVSDAQLGVEVAEAVNEGTDLTLSSSVSLDDI  138 (465)
Q Consensus        60 ~~~kk~k~~~~~wrpvst~as~~~~~l~~~~~~~~~~v~e~-~~~~s~~~s~~~~~~~~~~~~~e~~~~~~sss~~~~~~  138 (465)
                      +..++++..|.+|+|++|+..+..       .+++...|++ .|.++...+.            ++             .
T Consensus         2 ~~~~~~~~~n~~~~~~~~~t~~~~-------~~~~~e~~~~~~c~d~p~~~~------------dv-------------~   49 (345)
T KOG2814|consen    2 YRKTRYNLVNDVSFDLNTDTTFAD-------MSEEFEAQTSAECVDMPGDTV------------DV-------------E   49 (345)
T ss_pred             cchhhhhhhhhcccCccccccccc-------CchhhHHHhHhhcccCCCChH------------Hh-------------h
Confidence            456789999999999999988763       3445566666 7777764433            11             0


Q ss_pred             cccccCCCCccCCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCC-CCCcEEEEecCHHHHHHHHHHHHH
Q 012372          139 KDETLEGEPVPSAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSK-KEDSIIIEGNSTDSVAKASEKIQA  217 (465)
Q Consensus       139 e~~~~~~~~~~~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~-~sg~I~ItG~ske~V~~A~~rI~~  217 (465)
                      +..        -.++|+.+++|++.++++|||+.|.|+|+||+||+|+|-+|+++ +.+.|+|+|.++++|.+|.+||..
T Consensus        50 ~~~--------~~~~~~~si~v~s~~~~~lig~~g~trkkle~Etq~~i~lp~p~~n~~~i~i~~~~~~~V~~a~~Ri~~  121 (345)
T KOG2814|consen   50 DDA--------GAKDFSSSILVRSSFIGWLIGKQGKTRKKLEEETQTNIFLPRPNTNKEEIKIIGISRNCVIQALERIAK  121 (345)
T ss_pred             hcc--------ccccchhhhhhhHHHhhhhhcccchHHHHHHHhhccceEccCCCCCcceEEEeehhHHHHHHHHHHHHH
Confidence            011        12289999999999999999999999999999999999999998 589999999999999999999999


Q ss_pred             HHHHHhhCCCCcccceEeeccccchhhhhhHHHHHHHHhcCcCcccccccCCCCCCCCCchHHHHHhhhhhhhhhhhhcc
Q 012372          218 IIAEAVESPSLDYSHFVSLPLAVHPELVDKLVNFQNTILGITDVCLDENVGSKSNEDASDSEEKEQQVDQEHKVAVELNI  297 (465)
Q Consensus       218 Iv~e~~kk~k~~~thFVsIPl~~hP~I~~~~~~Fq~sIL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~  297 (465)
                      ++++.++  +.++|||+++|++ ..++.++|..|+...+-..                                      
T Consensus       122 ~ids~r~--s~p~thflal~ln-e~eVqe~f~~fke~~~~~e--------------------------------------  160 (345)
T KOG2814|consen  122 LIDSDRK--SFPITHFLALPLN-EHEVQEGFLAFKELKPFIE--------------------------------------  160 (345)
T ss_pred             HHHhhhh--cCchhhhhhhhcc-hHHHHHHHHHHHhhhhhHH--------------------------------------
Confidence            9999887  6999999999998 7889999999983322210                                      


Q ss_pred             CCCCcceecccccccccccccccCCCCCCCCCCCCCcCccCCCeeeEEEeeeEeCChhHHHHHHHHHHHhHHHHHhhhCC
Q 012372          298 GDNSERVKVDRTSIPIVGYEAKASRPSTSSDLGIDKSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDN  377 (465)
Q Consensus       298 ~~~~~~v~~~~~~~~~v~~~~~~~~~~~~~~~GIdesiF~~p~tLHLTLgVL~L~~~eev~kA~~~L~slk~~I~~iL~~  377 (465)
                                                 ..-+.|++.++|++|+++||||||++|++++++++|+++|+++.++++..+++
T Consensus       161 ---------------------------sl~~~g~~~s~F~~p~~~HLTvgm~~L~~dd~vq~a~e~les~~~e~~~~~~~  213 (345)
T KOG2814|consen  161 ---------------------------SLLDGGIDKSLFQGPGTFHLTVGMLKLLNDDDVQKALEILESTFQEIRIDVGE  213 (345)
T ss_pred             ---------------------------HhhccchhhccccCCceeeEEEEEEEecChHHHHHHHHHHHHHHHHHHhccCC
Confidence                                       01256899999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEeecccCCCCCCcceEEEEeceecCCcchHHHHH-HHHHHHHHHh--ccCCCcceEEeeeeh
Q 012372          378 RPLFIRLKGLDLMRGSKDKARILYAPVEEIGDGDRLLHAC-RILIAFVSSI--FAPLCTSLIIKMKQY  442 (465)
Q Consensus       378 ~pL~I~LkGL~~MnddPs~a~VLYAk~~~~d~~~rL~~~c-q~I~d~F~e~--F~p~~~~~i~~~~~~  442 (465)
                      +|+.|.++|+++|||||+.++||||+|.+.+...+|+.+| +.|..+|+..  +.--...++|||+..
T Consensus       214 kp~~i~lkG~~~mnddP~~~kVLYAkv~~~~~e~~l~~~~~~~i~~~f~~~~li~k~~~~~kLH~Tvm  281 (345)
T KOG2814|consen  214 KPLFIDLKGLDKMNDDPSLTKVLYAKVEPDDYEKFLQHRCGERILERFVASGLIKKESSSLKLHCTVM  281 (345)
T ss_pred             CceeeeccchhhhcCCHhHheeeeeeccCcchHHHHHHHHHHHHHHHHHHhcchhccccccEEEEEEe
Confidence            9999999999999999999999999999888899999999 9999999985  666677899999975

>PLN00108 unknown protein; Provisional Back     alignment and domain information
>PF10469 AKAP7_NLS: AKAP7 2'5' RNA ligase-like domain; InterPro: IPR019510 This entry represents the N-terminal nuclear localisation signal-containing domain found in the cyclic AMP-dependent protein kinase A (PKA) anchor protein, AKAP7 Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02258 2_5_ligase 2'-5' RNA ligase Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PRK15124 2'-5' RNA ligase; Provisional Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG1514 LigT 2'-5' RNA ligase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PHA02574 57B hypothetical protein; Provisional Back     alignment and domain information
>PRK13679 hypothetical protein; Provisional Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF05213 Corona_NS2A: Coronavirus NS2A protein; InterPro: IPR007878 This entry is represented by Coronavirus non-structural protein 2A (32kDa); it is a family of uncharacterised viral proteins Back     alignment and domain information
>PF13563 2_5_RNA_ligase2: 2'-5' RNA ligase superfamily; PDB: 1IUH_A Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02834 LigT_PEase: LigT like Phosphoesterase; InterPro: IPR014051 This entry represents a domain found in a number of known and predicted phosphoesterases Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2208 consensus Vigilin [Lipid transport and metabolism] Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
2vfk_A205 AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Hom 4e-15
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 9e-10
2dgr_A83 Ring finger and KH domain-containing protein 1; st 5e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 7e-09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-08
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-06
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 5e-05
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 7e-05
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-04
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-04
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-04
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-04
1x4n_A92 FAR upstream element binding protein 1; KH domain, 5e-04
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 7e-04
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 7e-04
>2vfk_A AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Homo sapiens} PDB: 2vfl_A* 2vfy_A Length = 205 Back     alignment and structure
 Score = 73.1 bits (179), Expect = 4e-15
 Identities = 19/99 (19%), Positives = 40/99 (40%), Gaps = 6/99 (6%)

Query: 333 KSIFIKPKTFHLTVLMLKLWNKDRVNAATNVLKSISSKVMDALDNRPLFIRLKGLDLMRG 392
               +   +FH+T+L+++L N+D VN  T+ L  +   V + L+ + L +   G+   +G
Sbjct: 35  TKAMVGDGSFHITLLVMQLLNEDEVNIGTDALLELKPFVEEILEGKHLTLPFHGIGTFQG 94

Query: 393 SKDKARILYAPVEEIGDGDRLLHAC-RILIAFVSSIFAP 430
                ++ +  + +      LL         F       
Sbjct: 95  -----QVGFVKLADGDHVSALLEIAETAKRTFQEKGILA 128
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.56
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.47
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.47
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.46
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.46
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.44
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.44
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.34
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.33
2vfk_A205 AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Hom 99.32
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.28
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.27
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.27
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.26
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.24
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.24
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.24
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.24
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.23
1we8_A104 Tudor and KH domain containing protein; structural 99.21
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.18
2cpq_A91 FragIle X mental retardation syndrome related prot 99.17
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.15
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.12
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.07
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 99.06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.05
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.05
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.04
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.02
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.95
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.93
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.93
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.84
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.83
3n89_A376 Defective in GERM LINE development protein 3, ISO; 98.74
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 98.72
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 98.65
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.63
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.6
1vgj_A184 Hypothetical protein PH0099; alpha+beta, LIGT-like 98.56
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.38
1iuh_A198 2'-5' RNA ligase; riken structural genomics/proteo 98.03
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 97.98
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.95
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 97.93
2d4g_A171 Hypothetical protein BSU11850; beta barrel, alpha 97.83
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 97.77
1tua_A191 Hypothetical protein APE0754; structural genomics, 97.47
1tua_A191 Hypothetical protein APE0754; structural genomics, 97.31
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.9
1jh6_A189 Cyclic phosphodiesterase; ADP-ribose 1'',2''-cycli 96.54
2z0s_A235 Probable exosome complex RNA-binding protein 1; al 84.62
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
Probab=99.56  E-value=7.6e-15  Score=122.98  Aligned_cols=74  Identities=26%  Similarity=0.402  Sum_probs=68.5

Q ss_pred             CCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCCC-CCcEEEEecCHHHHHHHHHHHHHHHHHHhh
Q 012372          150 SAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKK-EDSIIIEGNSTDSVAKASEKIQAIIAEAVE  224 (465)
Q Consensus       150 ~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~~-sg~I~ItG~ske~V~~A~~rI~~Iv~e~~k  224 (465)
                      ..++++..+.||+++|++|||+||+|||+|+++|||+|+||+.++ ++.|+|+|+ .+++++|+++|+.++.+..+
T Consensus        13 l~~~~t~~i~Ip~~~ig~IIG~gG~~Ik~I~~etg~~I~i~~~~~~~~~V~I~G~-~e~v~~A~~~I~~i~~~~~~   87 (94)
T 2cte_A           13 LQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGT-KEGIEKARHEVLLISAEQDK   87 (94)
T ss_dssp             CCSCEEEEEECCTTTHHHHHCSSSCHHHHHHHHTTCCCBCCCTTSSCCEEEEEEC-HHHHHHHHHHHHHHHHHHHT
T ss_pred             hCCceEEEEEEChHHeeeeECCCChhHHHHHHHHCCEEEeCCCCCCCCeEEEEEC-HHHHHHHHHHHHHHhhcccc
Confidence            467899999999999999999999999999999999999998654 589999998 99999999999999998655
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2vfk_A AKAP18 delta; APO, hydrolase; HET: AMP; 1.50A {Homo sapiens} PDB: 2vfl_A* 2vfy_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1vgj_A Hypothetical protein PH0099; alpha+beta, LIGT-like, structural genomics, ligase; 1.94A {Pyrococcus horikoshii} PDB: 1vdx_A 2fyh_A Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>1iuh_A 2'-5' RNA ligase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: d.61.1.2 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2d4g_A Hypothetical protein BSU11850; beta barrel, alpha helix, structural genomics, unknown function; 2.30A {Bacillus subtilis} Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>1jh6_A Cyclic phosphodiesterase; ADP-ribose 1'',2''-cyclic phosphate, RNA processing, 2',3'-C nucleotide phosphodiesterase, hydrolase; 1.80A {Arabidopsis thaliana} SCOP: d.61.1.1 PDB: 1fsi_A 1jh7_A* Back     alignment and structure
>2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 465
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-10
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 8e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 8e-09
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-08
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 1e-08
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 2e-08
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 6e-08
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 9e-08
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 1e-07
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 7e-07
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 9e-07
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-06
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 2e-06
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 3e-06
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 2e-05
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-05
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 5e-05
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 8e-05
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-04
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 5e-04
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Vigilin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.9 bits (130), Expect = 4e-10
 Identities = 17/69 (24%), Positives = 30/69 (43%)

Query: 153 RHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKKEDSIIIEGNSTDSVAKAS 212
           + S +V +     RF+ GK G   +  E +   KI +P      + I    + + + KA 
Sbjct: 9   QASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKAR 68

Query: 213 EKIQAIIAE 221
            ++  I AE
Sbjct: 69  HEVLLISAE 77
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.35
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.29
d2cpqa178 Fragile X mental retardation syndrome related prot 99.25
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.22
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 99.22
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 99.22
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.21
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.21
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.2
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.19
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.15
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.13
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.96
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.78
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.45
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.32
d1iuha_183 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId 98.29
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.92
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 95.69
d1jh6a_181 tRNA splicing product Appr>p cyclic nucleotide pho 95.09
d1hh2p368 Transcription factor NusA, C-terminal domains {The 89.82
d2asba367 Transcription factor NusA, C-terminal domains {Myc 89.31
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Vigilin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.52  E-value=8.5e-15  Score=117.51  Aligned_cols=74  Identities=26%  Similarity=0.402  Sum_probs=67.2

Q ss_pred             CCCCeEEEEEeCcceeccccCCCChhHHHHHHHhCcEEEcCCCCC-CCcEEEEecCHHHHHHHHHHHHHHHHHHhh
Q 012372          150 SAERHSLSVEVGASVIRFIKGKEGSTQKKFEKEMGVKIILPSSKK-EDSIIIEGNSTDSVAKASEKIQAIIAEAVE  224 (465)
Q Consensus       150 ~~~k~~~sI~VP~~~~r~IIGkgG~tiK~IEeETgtkI~IPr~~~-sg~I~ItG~ske~V~~A~~rI~~Iv~e~~k  224 (465)
                      ...+++.++.||+.+|++|||+||.++++|+++|||+|+||+.++ +..|+|+|+ .++|++|+.+|+.++++..+
T Consensus         6 ~~~~~t~~i~Ip~~~~~~iIG~~G~~i~~I~~~tg~~I~~p~~~~~~~~v~I~G~-~~~v~~A~~~I~~iv~e~~~   80 (81)
T d2ctea1           6 LQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGT-KEGIEKARHEVLLISAEQDK   80 (81)
T ss_dssp             CCSCEEEEEECCTTTHHHHHCSSSCHHHHHHHHTTCCCBCCCTTSSCCEEEEEEC-HHHHHHHHHHHHHHHHHHHT
T ss_pred             hcCceEEEEEECHHHHhhccCCCChhHHHHHHHhCCEEEECCCCCCCCEEEEEeC-HHHHHHHHHHHHHHHHHHhc
Confidence            356789999999999999999999999999999999999999876 567899996 78999999999999998543
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuha_ d.61.1.2 (A:) 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1jh6a_ d.61.1.1 (A:) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure