Citrus Sinensis ID: 012404

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
MCTENECCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA
cccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHccccccccccccccHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccc
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHccccccHHHccccEEEEccccccHHHHHHHHHcccccccccccEcccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHEEcccccHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccc
mctenecclhrtgifdsdptvmpKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKrslslklhetvscpeefkcplskelmrdpvilasgqtfdrPYIQRWLkagnrtcprtqqvlshtiltpNHLIREMISQWCRsqgielpnsvqyineegiteaDRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMpsfralfgeshdaipqllsplseskcenginpnlqEDVITTLLNLSihdnnkklvaetpMVIPLLMDALRSGTIETRSNAAAALFTLSAldsnkevigksgalkpLIDLLDEGHQSAMKDVASAIFNLCIthenkaravrdGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA
mctenecclhrtgifdsdptvmPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKelktkkrslslklhetvscpeefkcplskelMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCIThenkaravrdgGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIREStcdrnkenCIAILHticlsdrtkWKAMReeesthgtisklaqdgtaraKRKAtgilerlkrtvnlthta
MCTENECCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCAlkelktkkrslslklHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA
******CCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLK******************L******FRALFG********************GINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWK********************************************
********LHR***F****************LQK**********************************************PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGI*********************F*************QTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLK*********
MCTENECCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKW***************************ATGILERLKRTVNLTHTA
*C**NECCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELK************TVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPN**********TEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTV******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCTENECCLHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKRSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query464 2.2.26 [Sep-21-2011]
Q9SRT0460 U-box domain-containing p yes no 0.967 0.976 0.638 1e-165
Q3E9F7458 Putative U-box domain-con no no 0.913 0.925 0.435 1e-88
Q5VRH9611 U-box domain-containing p no no 0.829 0.630 0.421 1e-77
Q8VZ40632 U-box domain-containing p no no 0.816 0.599 0.415 8e-73
Q8GUG9612 U-box domain-containing p no no 0.801 0.607 0.407 1e-71
Q3E9F5456 U-box domain-containing p no no 0.900 0.916 0.393 3e-70
Q9SNC6660 U-box domain-containing p no no 0.788 0.554 0.396 1e-69
Q3E9F6445 Putative U-box domain-con no no 0.924 0.964 0.375 4e-69
Q9ZV31654 U-box domain-containing p no no 0.784 0.556 0.402 2e-68
Q0IMG9694 E3 ubiquitin-protein liga no no 0.797 0.533 0.402 2e-67
>sp|Q9SRT0|PUB9_ARATH U-box domain-containing protein 9 OS=Arabidopsis thaliana GN=PUB9 PE=1 SV=1 Back     alignment and function desciption
 Score =  581 bits (1497), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 298/467 (63%), Positives = 376/467 (80%), Gaps = 18/467 (3%)

Query: 9   LHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKK- 67
           + +TG+FDSDPT + KA ELK+E++KL+  I D+ D   +TIDQ +D L AL+E   +K 
Sbjct: 1   MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKM 60

Query: 68  -RSLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQ 126
            +S SL++ ETVSCPEEF+CPLS ELMRDPV+LASGQT+D+ +IQ+WL +GNRTCP+TQQ
Sbjct: 61  AKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQ 120

Query: 127 VLSHTILTPNHLIREMISQWCRSQGIELPNSVQY----INE-EGITEADRDHFLSLLKKM 181
           VL HT LTPN LIREMIS+WC+  G+E  +  QY    +NE E +T +DR+ F SLL K+
Sbjct: 121 VLPHTALTPNLLIREMISKWCKKNGLETKS--QYHPNLVNEDETVTRSDREIFNSLLCKV 178

Query: 182 SAT-LPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPN--LQE 238
           S++ L DQ  AAKELRLLT++   FRALFGES D I +L++PL      +G NP+  LQE
Sbjct: 179 SSSNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLL-----HGSNPDEKLQE 233

Query: 239 DVITTLLNLSIHDN-NKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKE 297
           DV+TTLLN+SIHD+ NKKLV E P VIPLL+DALR GT+ TRSNAAAA+FTLSALDSNK 
Sbjct: 234 DVVTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKV 293

Query: 298 VIGKSGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGV 357
           +IGKSG LKPLIDLL+EG+  A+KDVA+AIF LCI HEN++RAVRDG V V+ KKI +G+
Sbjct: 294 LIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGL 353

Query: 358 HVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRT 417
           +VDELLAILAML T+ +AVEE+G+LGGVS +L+I RES C RNKEN I ILHTIC SDRT
Sbjct: 354 YVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRT 413

Query: 418 KWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 464
           KWK ++EEE+ HGTI+KL+++GT+RA+RKA GIL+RL++ +NLTHTA
Sbjct: 414 KWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA 460
Functions as an E3 ubiquitin ligase (By similarity). May be involved in the abscisic acid-mediated signaling pathway, at least during germination.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q3E9F7|PUB46_ARATH Putative U-box domain-containing protein 46 OS=Arabidopsis thaliana GN=PUB46 PE=3 SV=1 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|Q3E9F5|PUB48_ARATH U-box domain-containing protein 48 OS=Arabidopsis thaliana GN=PUB48 PE=2 SV=1 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q3E9F6|PUB47_ARATH Putative U-box domain-containing protein 47 OS=Arabidopsis thaliana GN=PUB47 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
224065423456 predicted protein [Populus trichocarpa] 0.982 1.0 0.802 0.0
255585624456 Spotted leaf protein, putative [Ricinus 0.982 1.0 0.774 0.0
225469211449 PREDICTED: U-box domain-containing prote 0.963 0.995 0.733 0.0
356527306461 PREDICTED: U-box domain-containing prote 0.978 0.984 0.732 0.0
449453296461 PREDICTED: U-box domain-containing prote 0.980 0.986 0.703 0.0
356567779461 PREDICTED: U-box domain-containing prote 0.982 0.989 0.724 0.0
225430672455 PREDICTED: U-box domain-containing prote 0.976 0.995 0.676 1e-178
388491812453 unknown [Lotus japonicus] 0.974 0.997 0.660 1e-176
224118828450 predicted protein [Populus trichocarpa] 0.969 1.0 0.664 1e-175
297789349460 armadillo/beta-catenin repeat family pro 0.967 0.976 0.640 1e-164
>gi|224065423|ref|XP_002301810.1| predicted protein [Populus trichocarpa] gi|222843536|gb|EEE81083.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/456 (80%), Positives = 411/456 (90%)

Query: 9   LHRTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCALKELKTKKR 68
           + +TG+F SDP VM KA ELKKELQKLVR IVDD DYRTE IDQAR+TL ALK LK K+R
Sbjct: 1   MAKTGVFKSDPMVMTKAMELKKELQKLVRNIVDDEDYRTELIDQARETLFALKGLKVKRR 60

Query: 69  SLSLKLHETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVL 128
           S SLKL ETV CPEEFKCPLSKELMRDPV+LA+GQT+DRP+IQ+WLKAGNRTCP TQQVL
Sbjct: 61  SSSLKLRETVLCPEEFKCPLSKELMRDPVVLATGQTYDRPFIQKWLKAGNRTCPLTQQVL 120

Query: 129 SHTILTPNHLIREMISQWCRSQGIELPNSVQYINEEGITEADRDHFLSLLKKMSATLPDQ 188
           SHTILTPN LIREMISQWC+SQG+ELP+  Q +NE+GITEADRDHFLSLL+KMS TLP+Q
Sbjct: 121 SHTILTPNLLIREMISQWCKSQGLELPDLSQNVNEDGITEADRDHFLSLLEKMSLTLPEQ 180

Query: 189 TEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLS 248
            +AA+ELRLLTKRMPSFRALF ES +AIPQLL PLSE K  + + P+LQED+ITTLLNLS
Sbjct: 181 KDAARELRLLTKRMPSFRALFSESLEAIPQLLRPLSEGKSGSSMYPDLQEDIITTLLNLS 240

Query: 249 IHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGKSGALKPL 308
           IHDNNKKLVAETPMVIPLLM+ALRSG+IETR+NAAAALFTLSALDSNK +IGKSGALKPL
Sbjct: 241 IHDNNKKLVAETPMVIPLLMEALRSGSIETRTNAAAALFTLSALDSNKTLIGKSGALKPL 300

Query: 309 IDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDELLAILAM 368
           IDLL+EGH SAMKDVASAIFNLCI HENKARAVRDG + VIL KIM+G+HVDELLAILA+
Sbjct: 301 IDLLEEGHPSAMKDVASAIFNLCIIHENKARAVRDGALKVILTKIMNGMHVDELLAILAV 360

Query: 369 LSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKAMREEEST 428
           L+++ + VEE+GD G V C+LRIIRESTCDRNKENCIAILHTICL+DRTKWK MR+EES+
Sbjct: 361 LASHQKVVEELGDSGAVPCLLRIIRESTCDRNKENCIAILHTICLNDRTKWKVMRDEESS 420

Query: 429 HGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 464
           +GTISKLA+ GT+RAKRKA GILERL R VNLTHTA
Sbjct: 421 YGTISKLARHGTSRAKRKANGILERLNRAVNLTHTA 456

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255585624|ref|XP_002533499.1| Spotted leaf protein, putative [Ricinus communis] gi|223526643|gb|EEF28886.1| Spotted leaf protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225469211|ref|XP_002263607.1| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera] gi|296083515|emb|CBI23501.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356527306|ref|XP_003532252.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max] Back     alignment and taxonomy information
>gi|449453296|ref|XP_004144394.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus] gi|449506075|ref|XP_004162645.1| PREDICTED: U-box domain-containing protein 9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356567779|ref|XP_003552093.1| PREDICTED: U-box domain-containing protein 9-like [Glycine max] Back     alignment and taxonomy information
>gi|225430672|ref|XP_002270882.1| PREDICTED: U-box domain-containing protein 9 [Vitis vinifera] gi|296085175|emb|CBI28670.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388491812|gb|AFK33972.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224118828|ref|XP_002331359.1| predicted protein [Populus trichocarpa] gi|222874397|gb|EEF11528.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297789349|ref|XP_002862652.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297308299|gb|EFH38910.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
TAIR|locus:2079706460 PUB9 "plant U-box 9" [Arabidop 0.967 0.976 0.626 2.8e-146
TAIR|locus:2146183458 AT5G18320 [Arabidopsis thalian 0.810 0.820 0.461 7.6e-80
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.793 0.602 0.427 8.4e-74
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.816 0.599 0.415 9.6e-73
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.795 0.602 0.410 5.6e-68
UNIPROTKB|Q0IMG9694 SPL11 "E3 ubiquitin-protein li 0.797 0.533 0.405 5.1e-67
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.786 0.553 0.398 5.8e-66
TAIR|locus:2146213456 AT5G18340 [Arabidopsis thalian 0.909 0.925 0.383 9.4e-66
TAIR|locus:2146198445 AT5G18330 [Arabidopsis thalian 0.797 0.831 0.403 1.4e-64
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.803 0.593 0.387 3.7e-64
TAIR|locus:2079706 PUB9 "plant U-box 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1429 (508.1 bits), Expect = 2.8e-146, P = 2.8e-146
 Identities = 290/463 (62%), Positives = 362/463 (78%)

Query:    11 RTGIFDSDPTVMPKATELKKELQKLVRLIVDDVDYRTETIDQARDTLCAXXXXXXXXXXX 70
             +TG+FDSDPT + KA ELK+E++KL+  I D+ D   +TIDQ +D L A           
Sbjct:     3 KTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKMAK 62

Query:    71 XXXXH--ETVSCPEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVL 128
                    ETVSCPEEF+CPLS ELMRDPV+LASGQT+D+ +IQ+WL +GNRTCP+TQQVL
Sbjct:    63 SSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVL 122

Query:   129 SHTILTPNHLIREMISQWCRSQGIELPNSVQ--YINE-EGITEADRDHFLSLLKKMSAT- 184
              HT LTPN LIREMIS+WC+  G+E  +      +NE E +T +DR+ F SLL K+S++ 
Sbjct:   123 PHTALTPNLLIREMISKWCKKNGLETKSQYHPNLVNEDETVTRSDREIFNSLLCKVSSSN 182

Query:   185 LPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPN--LQEDVIT 242
             L DQ  AAKELRLLT++   FRALFGES D I +L++PL      +G NP+  LQEDV+T
Sbjct:   183 LQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLL-----HGSNPDEKLQEDVVT 237

Query:   243 TLLNLSIHDN-NKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDSNKEVIGK 301
             TLLN+SIHD+ NKKLV E P VIPLL+DALR GT+ TRSNAAAA+FTLSALDSNK +IGK
Sbjct:   238 TLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGK 297

Query:   302 SGALKPLIDLLDEGHQSAMKDVASAIFNLCITHENKARAVRDGGVSVILKKIMDGVHVDE 361
             SG LKPLIDLL+EG+  A+KDVA+AIF LCI HEN++RAVRDG V V+ KKI +G++VDE
Sbjct:   298 SGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDE 357

Query:   362 LLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENCIAILHTICLSDRTKWKA 421
             LLAILAML T+ +AVEE+G+LGGVS +L+I RES C RNKEN I ILHTIC SDRTKWK 
Sbjct:   358 LLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKE 417

Query:   422 MREEESTHGTISKLAQDGTARAKRKATGILERLKRTVNLTHTA 464
             ++EEE+ HGTI+KL+++GT+RA+RKA GIL+RL++ +NLTHTA
Sbjct:   418 IKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA 460
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA;IDA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0016567 "protein ubiquitination" evidence=IEA;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0070696 "transmembrane receptor protein serine/threonine kinase binding" evidence=IPI
GO:0071215 "cellular response to abscisic acid stimulus" evidence=IMP
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2146183 AT5G18320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146213 AT5G18340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146198 AT5G18330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SRT0PUB9_ARATH6, ., 3, ., 2, ., -0.63810.96760.9760yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_II2472
hypothetical protein (456 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
smart0050463 smart00504, Ubox, Modified RING finger domain 5e-23
pfam0456473 pfam04564, U-box, U-box domain 4e-21
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-10
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 7e-06
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 8e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.002
COG5113929 COG5113, UFD2, Ubiquitin fusion degradation protei 0.002
pfam05804 708 pfam05804, KAP, Kinesin-associated protein (KAP) 0.003
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information 
 Score = 91.5 bits (228), Expect = 5e-23
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 83  EFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIREM 142
           EF CP+S E+M+DPVIL SGQT++R  I++WL   + T P T Q L+H  L PN  ++  
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWLL-SHGTDPVTGQPLTHEDLIPNLALKSA 59

Query: 143 ISQW 146
           I +W
Sbjct: 60  IQEW 63

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227444 COG5113, UFD2, Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 464
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.96
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.95
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.95
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.94
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.93
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.91
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.9
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.87
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.86
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.83
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.81
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.71
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.7
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.7
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 99.7
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.68
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.68
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 99.65
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.56
KOG1048717 consensus Neural adherens junction protein Plakoph 99.53
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.52
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.31
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.29
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.27
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.24
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.23
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.18
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.1
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.09
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.07
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.07
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.97
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.94
PRK09687280 putative lyase; Provisional 98.9
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.89
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.89
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.8
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.71
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.69
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.68
PRK09687280 putative lyase; Provisional 98.66
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.66
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.6
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.57
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.51
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.51
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.49
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.47
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.44
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.41
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.4
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.37
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.35
PHA02929238 N1R/p28-like protein; Provisional 98.33
KOG0289 506 consensus mRNA splicing factor [General function p 98.28
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.24
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.21
PF05536 543 Neurochondrin: Neurochondrin 98.18
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.14
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.14
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.12
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.11
COG5222427 Uncharacterized conserved protein, contains RING Z 98.1
KOG4646173 consensus Uncharacterized conserved protein, conta 98.09
PF05536 543 Neurochondrin: Neurochondrin 98.09
KOG4646173 consensus Uncharacterized conserved protein, conta 98.07
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.06
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.06
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.06
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.04
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.04
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.03
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.99
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.96
KOG2973353 consensus Uncharacterized conserved protein [Funct 97.93
KOG2973 353 consensus Uncharacterized conserved protein [Funct 97.92
PHA02926242 zinc finger-like protein; Provisional 97.92
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.85
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.81
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.8
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.79
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.73
PTZ00429 746 beta-adaptin; Provisional 97.71
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.68
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.67
TIGR02270 410 conserved hypothetical protein. Members are found 97.65
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
PTZ00429 746 beta-adaptin; Provisional 97.57
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.54
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.52
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.49
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.46
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.37
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.34
PF1463444 zf-RING_5: zinc-RING finger domain 97.32
KOG2759 442 consensus Vacuolar H+-ATPase V1 sector, subunit H 97.31
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.27
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.27
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.23
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.22
COG5369743 Uncharacterized conserved protein [Function unknow 97.2
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 97.18
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.15
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.07
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.06
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.05
KOG2660331 consensus Locus-specific chromosome binding protei 97.05
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.99
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 96.95
KOG0297391 consensus TNF receptor-associated factor [Signal t 96.94
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.9
KOG0212 675 consensus Uncharacterized conserved protein [Funct 96.88
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.87
KOG4413 524 consensus 26S proteasome regulatory complex, subun 96.83
KOG1242 569 consensus Protein containing adaptin N-terminal re 96.77
TIGR02270410 conserved hypothetical protein. Members are found 96.7
COG1413335 FOG: HEAT repeat [Energy production and conversion 96.6
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.57
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.54
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.51
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.38
PF04641260 Rtf2: Rtf2 RING-finger 96.36
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.29
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.23
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.22
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.13
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.13
KOG4413 524 consensus 26S proteasome regulatory complex, subun 96.11
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.06
COG1413335 FOG: HEAT repeat [Energy production and conversion 96.05
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 96.01
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 95.93
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 95.88
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.87
KOG2979262 consensus Protein involved in DNA repair [General 95.85
KOG3036293 consensus Protein involved in cell differentiation 95.8
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.8
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 95.75
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.75
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 95.67
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.63
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.6
KOG2259 823 consensus Uncharacterized conserved protein [Funct 95.57
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 95.55
COG5369 743 Uncharacterized conserved protein [Function unknow 95.42
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 95.3
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 95.28
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.26
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 95.24
PF05004309 IFRD: Interferon-related developmental regulator ( 95.1
KOG3036293 consensus Protein involved in cell differentiation 95.04
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.03
KOG1242 569 consensus Protein containing adaptin N-terminal re 94.99
COG5096 757 Vesicle coat complex, various subunits [Intracellu 94.96
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 94.91
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.88
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.79
KOG4367 699 consensus Predicted Zn-finger protein [Function un 94.72
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.61
KOG1824 1233 consensus TATA-binding protein-interacting protein 94.6
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 94.56
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.39
KOG3113293 consensus Uncharacterized conserved protein [Funct 94.34
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 94.31
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 94.14
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 94.04
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.01
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.01
COG5152259 Uncharacterized conserved protein, contains RING a 93.97
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 93.83
PF07814361 WAPL: Wings apart-like protein regulation of heter 93.74
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.71
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 93.71
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 93.61
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 93.54
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.48
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 93.46
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 93.4
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 93.35
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 93.3
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 93.27
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 93.23
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 93.17
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 93.16
COG5109396 Uncharacterized conserved protein, contains RING Z 93.1
KOG0883518 consensus Cyclophilin type, U box-containing pepti 92.94
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 92.91
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 92.83
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.7
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 92.63
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.62
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 92.39
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 92.12
PF05004309 IFRD: Interferon-related developmental regulator ( 92.1
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 91.99
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 91.95
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 91.92
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 91.91
KOG18241233 consensus TATA-binding protein-interacting protein 91.87
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 91.85
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 91.74
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 91.63
COG5096 757 Vesicle coat complex, various subunits [Intracellu 91.49
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 91.14
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 91.05
PF08045257 CDC14: Cell division control protein 14, SIN compo 91.04
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 91.03
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 91.02
PF11701157 UNC45-central: Myosin-binding striated muscle asse 90.84
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.62
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 90.34
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 90.33
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 90.33
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 90.29
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 89.93
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 89.75
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 89.59
PF06416113 DUF1076: Protein of unknown function (DUF1076); In 89.57
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 89.51
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.38
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 89.33
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 89.27
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 88.96
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 88.59
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 88.22
PF10408629 Ufd2P_core: Ubiquitin elongating factor core; Inte 87.79
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 87.78
KOG4535728 consensus HEAT and armadillo repeat-containing pro 87.77
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 87.67
PF11701157 UNC45-central: Myosin-binding striated muscle asse 87.65
PF08167165 RIX1: rRNA processing/ribosome biogenesis 87.52
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 87.44
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 87.31
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 87.3
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 87.19
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 87.18
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 87.15
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 86.84
KOG04141251 consensus Chromosome condensation complex Condensi 86.67
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 86.3
COG5175480 MOT2 Transcriptional repressor [Transcription] 86.28
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 86.23
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 86.07
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 85.98
COG5209315 RCD1 Uncharacterized protein involved in cell diff 85.95
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 85.87
KOG0396389 consensus Uncharacterized conserved protein [Funct 85.76
KOG2032533 consensus Uncharacterized conserved protein [Funct 85.57
COG5209315 RCD1 Uncharacterized protein involved in cell diff 85.3
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 84.41
KOG2259 823 consensus Uncharacterized conserved protein [Funct 83.85
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 83.7
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 83.67
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 83.36
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 83.17
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 83.03
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 82.89
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 82.85
PF04641260 Rtf2: Rtf2 RING-finger 82.84
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 82.37
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 82.28
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 82.08
KOG4653982 consensus Uncharacterized conserved protein [Funct 81.2
KOG0301745 consensus Phospholipase A2-activating protein (con 80.98
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 80.54
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 80.1
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 80.02
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=99.96  E-value=2.4e-27  Score=268.53  Aligned_cols=278  Identities=18%  Similarity=0.256  Sum_probs=241.7

Q ss_pred             hhhHHHHHHhhcC---CchhHHHHHHHHHHHhhcCchhhhhhhhcCCchhhhhhhcccccccCCCChhhHHHHHHHHHcc
Q 012404          171 RDHFLSLLKKMSA---TLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNL  247 (464)
Q Consensus       171 ~~~i~~Lv~~Ls~---~~~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~A~~~L~~L  247 (464)
                      ...+..+++.|.+   +.+.++.|+..|+.+++.++++|..|.+..|+||.|+.+|+      +.++.++++|+.+|.+|
T Consensus        12 ~~~v~~Lve~L~s~~ss~~~~~~Al~~Lr~Lak~~~enR~~Ia~~aGaIP~LV~lL~------sg~~~vk~nAaaaL~nL   85 (2102)
T PLN03200         12 LASVAQCIEQLRAKSSSPQEKELTTARLLELAKTREEARKAIGSHSQAMPLLVSLLR------SGTLGAKVNAAAVLGVL   85 (2102)
T ss_pred             HHHHHHHHHHHHcccCCHHHHHHHHHHHHHHHhcChHHHHHHHHccCcHHHHHHHHc------CCCHHHHHHHHHHHHHH
Confidence            4578889999953   36889999999999999999999999876899999999998      45689999999999999


Q ss_pred             ccCcchHHHHhcCCCChHHHHHHHhcCCHHHHHHHHHHHHHhcccC---cch-hhhcccCchHHHHHhcccCC---HHHH
Q 012404          248 SIHDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALD---SNK-EVIGKSGALKPLIDLLDEGH---QSAM  320 (464)
Q Consensus       248 s~~~~~~~~i~~~~~~i~~Lv~lL~~~~~~~~~~aa~~L~~Ls~~~---~~~-~~i~~~g~i~~Lv~lL~~~~---~~~~  320 (464)
                      +.+++++..|+.. |++|.|+.+|++|+++.+++|+++|++|+.+.   .++ ..++..|+||.|+.+|++++   ..++
T Consensus        86 S~~e~nk~~Iv~~-GaIppLV~LL~sGs~eaKe~AA~AL~sLS~~~~~D~~~~~I~v~~GaVp~Lv~lL~~gsk~d~~L~  164 (2102)
T PLN03200         86 CKEEDLRVKVLLG-GCIPPLLSLLKSGSAEAQKAAAEAIYAVSSGGLSDHVGSKIFSTEGVVPSLWDQLQPGNKQDKVVE  164 (2102)
T ss_pred             hcCHHHHHHHHHc-CChHHHHHHHHCCCHHHHHHHHHHHHHHHcCcchhhhhhhhhhhcCChHHHHHHHhCCchhhHHHH
Confidence            9999999999974 79999999999999999999999999999864   344 34567999999999999873   2356


Q ss_pred             HHHHHHHHHhccCchhhhH-HHhcCcHHHHHHHHcCC--chHHHHHHHHHHhhCC-HHHHHHHHhcCcHHHHHHHHhccC
Q 012404          321 KDVASAIFNLCITHENKAR-AVRDGGVSVILKKIMDG--VHVDELLAILAMLSTN-HRAVEEIGDLGGVSCMLRIIREST  396 (464)
Q Consensus       321 ~~al~aL~~L~~~~~~~~~-iv~~g~v~~Lv~lL~~~--~~~~~a~~~L~~L~~~-~~~~~~i~~~g~i~~Lv~ll~~~~  396 (464)
                      +.++.+|+|||..++++.+ +++.|+||.|+++|.++  ..++.|+++|.+++.+ ++++..+++.|+|+.|+++|+++.
T Consensus       165 ~~Av~AL~nLs~~~en~~~~IIeaGaVp~LV~LLsS~d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~sg~  244 (2102)
T PLN03200        165 GLLTGALRNLCGSTDGFWSATLEAGGVDILVKLLSSGNSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQGN  244 (2102)
T ss_pred             HHHHHHHHHHhcCccchHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHccCC
Confidence            7788999999999998865 57999999999999876  6789999999999876 779999999999999999998765


Q ss_pred             ChhHHHHHHHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCC---------HHHHHHHHHHHHHHhc
Q 012404          397 CDRNKENCIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGT---------ARAKRKATGILERLKR  456 (464)
Q Consensus       397 ~~~~~~~A~~~L~~L~~~~~~~~~~~~~~~g~~~~L~~Ll~~g~---------~~~k~~A~~~L~~l~~  456 (464)
                      +..+|++|+++|++|+..+++..+.++ +.|+++.|++++...+         ...++.|.|+|.|+++
T Consensus       245 ~~~VRE~AA~AL~nLAs~s~e~r~~Iv-~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcg  312 (2102)
T PLN03200        245 EVSVRAEAAGALEALSSQSKEAKQAIA-DAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICG  312 (2102)
T ss_pred             ChHHHHHHHHHHHHHhcCCHHHHHHHH-HCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhC
Confidence            578999999999999998876655555 6899999999987543         3469999999999886

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74) Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF10408 Ufd2P_core: Ubiquitin elongating factor core; InterPro: IPR019474 This entry represents the most conserved part of the core region of ubiquitin conjugation factor E4 (or Ub elongating factor, or Ufd2P), running from helix alpha-11 to alpha-38 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 8e-23
2kre_A100 Solution Structure Of E4bUFD2A U-Box Domain Length 3e-06
2kr4_A85 U-Box Domain Of The E3 Ubiquitin Ligase E4b Length 4e-06
2c2v_S78 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 8e-04
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/73 (54%), Positives = 60/73 (82%)
Query: 81  PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 140
           PE F+CP+S ELM+DPVI+++GQT++R  IQ+WL AG++TCP++Q+ L H  LTPN++++
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65
Query: 141 EMISQWCRSQGIE 153
            +I+ WC S GIE
Sbjct: 66  SLIALWCESNGIE 78
>pdb|2KRE|A Chain A, Solution Structure Of E4bUFD2A U-Box Domain Length = 100 Back     alignment and structure
>pdb|2KR4|A Chain A, U-Box Domain Of The E3 Ubiquitin Ligase E4b Length = 85 Back     alignment and structure
>pdb|2C2V|S Chain S, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 7e-39
2f42_A179 STIP1 homology and U-box containing protein 1; cha 4e-34
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-32
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-13
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-04
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 1e-29
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 3e-29
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-28
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-23
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-14
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-27
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-15
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 7e-27
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-22
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-15
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-13
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-11
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 6e-07
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-26
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-23
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-14
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-11
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 6e-25
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 4e-24
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-21
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-19
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-13
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 7e-11
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 4e-21
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-12
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-20
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-19
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-17
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-06
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-18
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-16
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-08
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-17
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-17
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-16
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-17
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-11
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-09
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 4e-17
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-08
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-08
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 1e-15
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-15
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-10
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-08
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-14
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 5e-14
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-08
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-10
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 7e-10
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-08
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 5e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 6e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 9e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 7e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 4e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 5e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 5e-04
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
 Score =  134 bits (340), Expect = 7e-39
 Identities = 40/73 (54%), Positives = 60/73 (82%)

Query: 81  PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 140
           PE F+CP+S ELM+DPVI+++GQT++R  IQ+WL AG++TCP++Q+ L H  LTPN++++
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65

Query: 141 EMISQWCRSQGIE 153
            +I+ WC S GIE
Sbjct: 66  SLIALWCESNGIE 78
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 99.97
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.96
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.96
3nmz_A458 APC variant protein; protein-protein complex, arma 99.95
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.95
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.95
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.94
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.94
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.94
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.92
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.92
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.92
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.91
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.91
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.91
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.9
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.9
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.88
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.88
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.87
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.87
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.87
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.84
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.84
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.84
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.84
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.82
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.82
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.8
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.73
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.71
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.61
3grl_A 651 General vesicular transport factor P115; vesicle t 99.58
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.53
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.39
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.35
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.35
3grl_A 651 General vesicular transport factor P115; vesicle t 99.31
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.28
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.25
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.21
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.21
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.21
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.18
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.17
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.17
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.17
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.16
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.16
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.15
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.15
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.14
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.14
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.11
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.11
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.11
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.02
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.01
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.97
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.97
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.97
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.96
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.94
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.9
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.9
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.9
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.86
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.85
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.83
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.82
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.79
2ect_A78 Ring finger protein 126; metal binding protein, st 98.73
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.72
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.63
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.62
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.61
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.6
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.58
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.58
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.58
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.57
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.57
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.56
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.52
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.52
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.49
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.46
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.43
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.43
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.39
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.32
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.28
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.26
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.24
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.21
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.2
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.19
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.17
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.16
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.13
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.12
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.11
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.11
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.06
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.95
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.89
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.87
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.87
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.86
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.82
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.81
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.81
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.8
2ea5_A68 Cell growth regulator with ring finger domain prot 97.76
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.74
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.62
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.58
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.57
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.55
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.48
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.44
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.43
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.42
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.35
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.23
1ho8_A 480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.16
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.86
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.8
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.55
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.48
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.42
2db0_A253 253AA long hypothetical protein; heat repeats, hel 95.82
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.8
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.66
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 95.61
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.59
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.03
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 94.74
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.3
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.21
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 94.04
2x19_B 963 Importin-13; nuclear transport, protein transport; 93.76
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 93.6
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 93.51
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 93.49
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 93.37
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 92.62
2x1g_F 971 Cadmus; transport protein, developmental protein, 92.38
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 92.18
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.91
2kkx_A102 Uncharacterized protein ECS2156; methods developme 91.67
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 91.62
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 91.27
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 91.07
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 90.26
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 89.45
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 88.64
2x19_B 963 Importin-13; nuclear transport, protein transport; 88.07
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 87.32
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 87.07
2x1g_F 971 Cadmus; transport protein, developmental protein, 86.99
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 83.9
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 83.58
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 83.33
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 82.84
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 81.82
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 80.79
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
Probab=100.00  E-value=6.5e-32  Score=268.18  Aligned_cols=271  Identities=18%  Similarity=0.180  Sum_probs=235.6

Q ss_pred             chhHHHHHHHHHHHhhcCchhhhhhhhcCCchhhhhhhccccc-----ccCCCChhhHHHHHHHHHccccCcc-hHHHHh
Q 012404          185 LPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESK-----CENGINPNLQEDVITTLLNLSIHDN-NKKLVA  258 (464)
Q Consensus       185 ~~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~-----~~~~~~~~~~~~A~~~L~~Ls~~~~-~~~~i~  258 (464)
                      ...+..|+++|.+++. ++++|..|.+ .|+++.|+.+|....     .....++.++++|+++|.||+.+++ ++..+.
T Consensus        46 ~~~~~~A~~aL~nls~-d~e~R~~i~~-~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~  123 (354)
T 3nmw_A           46 EHQICPAVCVLMKLSF-DEEHRHAMNE-LGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLC  123 (354)
T ss_dssp             GGTHHHHHHHHHHHHT-SHHHHHHHHH-TTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHcC-CHHHHHHHHH-cCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            3456689999999999 5899999999 999999999996310     0001246789999999999998876 777776


Q ss_pred             cCCCChHHHHHHHhcCCHHHHHHHHHHHHHhccc--CcchhhhcccCchHHHHHhc-ccCCHHHHHHHHHHHHHhcc-Cc
Q 012404          259 ETPMVIPLLMDALRSGTIETRSNAAAALFTLSAL--DSNKEVIGKSGALKPLIDLL-DEGHQSAMKDVASAIFNLCI-TH  334 (464)
Q Consensus       259 ~~~~~i~~Lv~lL~~~~~~~~~~aa~~L~~Ls~~--~~~~~~i~~~g~i~~Lv~lL-~~~~~~~~~~al~aL~~L~~-~~  334 (464)
                      ..+|++|.|+.+|++++++++..|+++|.+|+..  ++++..+++.|+|+.|+++| +++++++++.|+.+|+||+. ++
T Consensus       124 ~~~GaIp~LV~LL~s~~~~v~~~A~~aL~nLs~~~~~~~k~~i~~~G~Ip~Lv~lL~~~~~~~~~~~A~~aL~nLs~~~~  203 (354)
T 3nmw_A          124 SMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT  203 (354)
T ss_dssp             HCHHHHHHHHHGGGCSCHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTTCH
T ss_pred             HcCCcHHHHHHHHCCCCHHHHHHHHHHHHHHhccCCHHHHHHHHHCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHHccCh
Confidence            6667899999999999999999999999999985  46889999999999999975 55688999999999999999 66


Q ss_pred             hhhhHHH-hcCcHHHHHHHHcCC------chHHHHHHHHHHhhC----CHHHHHHHHhcCcHHHHHHHHhccCChhHHHH
Q 012404          335 ENKARAV-RDGGVSVILKKIMDG------VHVDELLAILAMLST----NHRAVEEIGDLGGVSCMLRIIRESTCDRNKEN  403 (464)
Q Consensus       335 ~~~~~iv-~~g~v~~Lv~lL~~~------~~~~~a~~~L~~L~~----~~~~~~~i~~~g~i~~Lv~ll~~~~~~~~~~~  403 (464)
                      +++..++ ..|++|.|+++|.++      .+++.|+++|.||+.    +++++..+.++|+++.|+.+|+++ +..++++
T Consensus       204 ~nk~~i~~~~Gai~~Lv~lL~~~~~~~~~~v~~~A~~aL~nLs~~~a~~~~~~~~i~~~g~i~~Lv~lL~~~-~~~v~~~  282 (354)
T 3nmw_A          204 ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSH-SLTIVSN  282 (354)
T ss_dssp             HHHHHHHHSTTHHHHHHHHTTCCCSSSCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTTHHHHHHHHTTCS-CHHHHHH
T ss_pred             hhhHHHHHhcCcHHHHHHHhccCCCcccHHHHHHHHHHHHHHHhhccCCHHHHHHHHHcCCHHHHHHHHcCC-ChHHHHH
Confidence            8898888 689999999999854      278999999999995    789999999999999999999976 4899999


Q ss_pred             HHHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCCHHHHHHHHHHHHHHhcccc
Q 012404          404 CIAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRTVN  459 (464)
Q Consensus       404 A~~~L~~L~~~~~~~~~~~~~~~g~~~~L~~Ll~~g~~~~k~~A~~~L~~l~~~~~  459 (464)
                      |+++|++|+..+++..+.++ +.|++++|++|++++++++++.|+++|++|.....
T Consensus       283 A~~aL~nLa~~~~~~~~~i~-~~G~i~~Lv~LL~s~~~~i~~~A~~aL~nL~~~~~  337 (354)
T 3nmw_A          283 ACGTLWNLSARNPKDQEALW-DMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRP  337 (354)
T ss_dssp             HHHHHHHHTSSCHHHHHHHH-HTTHHHHHHTTTTCSSHHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHhCCCHHHHHHHH-HCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHcCCH
Confidence            99999999987776655565 58999999999999999999999999999987644
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 464
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 4e-21
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-14
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-10
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-08
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-07
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-06
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 7e-14
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-12
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-10
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-09
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 6e-07
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-04
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 2e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 9e-08
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 5e-07
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-06
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-05
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 1e-04
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 7e-04
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 85.1 bits (210), Expect = 4e-21
 Identities = 40/73 (54%), Positives = 60/73 (82%)

Query: 81  PEEFKCPLSKELMRDPVILASGQTFDRPYIQRWLKAGNRTCPRTQQVLSHTILTPNHLIR 140
           PE F+CP+S ELM+DPVI+++GQT++R  IQ+WL AG++TCP++Q+ L H  LTPN++++
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVLK 65

Query: 141 EMISQWCRSQGIE 153
            +I+ WC S GIE
Sbjct: 66  SLIALWCESNGIE 78
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.87
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.87
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.86
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.86
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.85
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.83
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.75
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.73
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.49
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.4
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.29
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.85
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.85
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.68
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.53
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.37
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.35
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.34
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.25
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.19
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.1
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.09
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.93
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.88
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.83
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.73
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.69
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.57
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.57
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.52
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.46
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.43
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.27
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.12
d1ho8a_ 477 Regulatory subunit H of the V-type ATPase {Baker's 96.93
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.91
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.77
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.55
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.49
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.27
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.69
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 90.64
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 90.45
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 89.45
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 88.56
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 86.64
d2bnxa1 343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 86.24
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 83.97
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 83.37
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=4.8e-23  Score=212.86  Aligned_cols=275  Identities=19%  Similarity=0.182  Sum_probs=239.2

Q ss_pred             hhhHHHHHHhhcC-CchhHHHHHHHHHHHhhcCchhhhhhhhcCCchhhhhhhcccccccCCCChhhHHHHHHHHHcccc
Q 012404          171 RDHFLSLLKKMSA-TLPDQTEAAKELRLLTKRMPSFRALFGESHDAIPQLLSPLSESKCENGINPNLQEDVITTLLNLSI  249 (464)
Q Consensus       171 ~~~i~~Lv~~Ls~-~~~~~~~a~~~L~~L~~~~~~~r~~i~~~~g~i~~Lv~lL~~~~~~~~~~~~~~~~A~~~L~~Ls~  249 (464)
                      .+++|.|++.|.+ +...+..|+..|.++++ ++..|..+....|+++.|+.+|+.     ..++++++.|+.+|.+++.
T Consensus        16 ~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~-~~~~~~~~~~~~~~v~~l~~~L~~-----~~~~~~~~~a~~~L~~l~~   89 (529)
T d1jdha_          16 TRAIPELTKLLNDEDQVVVNKAAVMVHQLSK-KEASRHAIMRSPQMVSAIVRTMQN-----TNDVETARCTAGTLHNLSH   89 (529)
T ss_dssp             -CHHHHHHHHHTCSCHHHHHHHHHHHHHHHT-SHHHHHHHHTCHHHHHHHHHHHHH-----CCCHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHHHHHHHHh-ccHHHHHHHHhhhHHHHHHHHHcC-----CCCHHHHHHHHHHHHHHhC
Confidence            5679999999964 47789999999999998 567777666646899999999975     3468899999999999999


Q ss_pred             CcchHHHHhcCCCChHHHHHHHhcCCHHHHHHHHHHHHHhcccCc-chhhhcccCchHHHHHhcccCCHHHHHHHHHHHH
Q 012404          250 HDNNKKLVAETPMVIPLLMDALRSGTIETRSNAAAALFTLSALDS-NKEVIGKSGALKPLIDLLDEGHQSAMKDVASAIF  328 (464)
Q Consensus       250 ~~~~~~~i~~~~~~i~~Lv~lL~~~~~~~~~~aa~~L~~Ls~~~~-~~~~i~~~g~i~~Lv~lL~~~~~~~~~~al~aL~  328 (464)
                      +++++..+++. |++|.|+.+|+++++.++..|+++|.+|+.+.+ .+..+.+.|+|+.|+++|.+++++++..++.+|.
T Consensus        90 ~~~~~~~i~~~-g~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~~~~~~a~~~L~  168 (529)
T d1jdha_          90 HREGLLAIFKS-GGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQ  168 (529)
T ss_dssp             SHHHHHHHHHT-THHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGGCCCHHHHHHHHHHHH
T ss_pred             CchhHHHHHHC-CCHHHHHHHhCCCCHHHHHHHHHHHHHhhcccchhhhHHHhcCCchHHHHHHHccChHHHHHHHHHHH
Confidence            99999999987 579999999999999999999999999998654 5667778999999999999999999999999999


Q ss_pred             HhccCc-hhhhHHHhcCcHHHHHHHHcCC---chHHHHHHHHHHhhCCHHHHHHHHhcCcHHHHHHHHhccCChhHHHHH
Q 012404          329 NLCITH-ENKARAVRDGGVSVILKKIMDG---VHVDELLAILAMLSTNHRAVEEIGDLGGVSCMLRIIRESTCDRNKENC  404 (464)
Q Consensus       329 ~L~~~~-~~~~~iv~~g~v~~Lv~lL~~~---~~~~~a~~~L~~L~~~~~~~~~i~~~g~i~~Lv~ll~~~~~~~~~~~A  404 (464)
                      +|+... +.+..++..|+++.|+.++..+   ..+..++.+|.+++.+++++..+.+.|+++.|+.++.++ +...+.+|
T Consensus       169 ~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~g~~~~L~~ll~~~-~~~~~~~a  247 (529)
T d1jdha_         169 ILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-SQRLVQNC  247 (529)
T ss_dssp             HHHTTCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHTTSTTHHHHHHHTTHHHHHHTTTTSS-CHHHHHHH
T ss_pred             HHhhhhhHHHHHHHhcccchHHHHHHHhhhhHHHHHHHHHHHhhhhccccccchhhhhhhhhhHHHHhccc-chhhhhhh
Confidence            999765 5677778899999999999743   578889999999999999999999999999999999876 48999999


Q ss_pred             HHHHHHHhccChhhHHHHHHhhccHHHHHHHhhcCCHHHHHHHHHHHHHHhcc
Q 012404          405 IAILHTICLSDRTKWKAMREEESTHGTISKLAQDGTARAKRKATGILERLKRT  457 (464)
Q Consensus       405 ~~~L~~L~~~~~~~~~~~~~~~g~~~~L~~Ll~~g~~~~k~~A~~~L~~l~~~  457 (464)
                      +++|.+++......   .. ..|+++.|++++.++++.+++.|.++|.++...
T Consensus       248 ~~~l~~ls~~~~~~---~~-~~~~i~~Lv~ll~~~~~~~~~~a~~~L~~l~~~  296 (529)
T d1jdha_         248 LWTLRNLSDAATKQ---EG-MEGLLGTLVQLLGSDDINVVTCAAGILSNLTCN  296 (529)
T ss_dssp             HHHHHHHHTTCTTC---SC-CHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTTT
T ss_pred             hhHHHhccccccch---hh-hhhcchhhhhhcccccHHHHHHHHHHHHhhccc
Confidence            99999998655432   12 358899999999999999999999999999753
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure