Citrus Sinensis ID: 012437

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---

MQEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW

cccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHcccccccEEEEccEEEEccccccEEEcccccHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHccEEEEEcccHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHcc

cccccccHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccEEEEEEccccEcHHcHHHHHHHHHHHcccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccEEEcccHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHccccccEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHcccEEEEcccHHHHHHHHHccccEEcccHHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHHHcc

MQEWGTDLAKMATVNSATVKYTEFLLATAsgkvegvkgpgklatpfekTKVAAYTLGAMSPCMRLYAFLGKEFHALLnanegnhpytkwidnyssesfqaSALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFfcaqplaqptvvplikghnpagdrliifsdfdltctivdssAILAEIAIvtapksdqnqpenqlgrmssgelrntwgLLSKQYTEEYEQCIESfmpsekvenfnYETLHKALEQLSHFEKRANSRViesgvlkginlEDIKKAGerlslqdgCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHAnefsfkesistgeiiekvespiDKVQAFNNTLEkygtdrknlsvYIGDSVGDLLCLLEADIGivigsssslrrvgsqfgvtfiplypglvkkqkeytegsssnwkeksGILYTVSSWAEVHAFILGW

MQEWGTDLAKMATVNSATVKYTEFLLATasgkvegvkgpgklatpfEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVtapksdqnqpenqlgrmssgelrNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANsrviesgvlkginLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLekygtdrknlSVYIGDSVGDLLCLLEADIGIVIGsssslrrvGSQFGVTFIPLYPGLVKKQKEYtegsssnwkeksGILYTVSSWAEVHAFILGW

*******LAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVT**********************NTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQK*********WKEKSGILYTVSSWAEVHAFILG*

MQEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTA*******************LRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKK************KEKSGILYTVSSWAEVHAFILGW

**EWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPK************MSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		463	2.2.26 [Sep-21-2011]
Q9UUE0		274	UPF0655 protein C17G9.12c	yes	no	0.565	0.956	0.233	3e-09
P25616		317	UPF0655 protein YCR015C O	yes	no	0.460	0.671	0.264	3e-06
P44659		215	Uncharacterized protein H	yes	no	0.248	0.534	0.270	7e-06
Q8FTH8		739	Thiamine biosynthesis mul	yes	no	0.207	0.129	0.283	0.0001

>sp\|Q9UUE0\|YNZC_SCHPO UPF0655 protein C17G9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17G9.12c PE=3 SV=1	Back alignment and function desciption

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 126/312 (40%), Gaps = 50/312 (16%)

Query: 163 LIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYT 222
           ++   DFD T T  D+  +LAE           N+PE              W ++S +Y 
Sbjct: 1   MLYIVDFDETITTYDTIHLLAEAV---------NKPEE-------------WSVISDKYW 38

Query: 223 EEYEQCIESFMPSEKVENFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAG 282
           +EY    E+   S  + ++        L    + E+ +  R+ +S    G++   +    
Sbjct: 39  QEYLAWREALPHSTTLTSY-----LPLLGGSRYLEEASIKRIEKSQYFSGLSEGALDNIV 93

Query: 283 ERLSLQDGCTTFFQKVVKNENLNANV-HVLSYCWCGDLIRASF---SSAGLNALNVHANE 338
           + ++L+ G   F   +V +  ++  + HVLS  W   +I  +    +    + L VHAN+
Sbjct: 94  QLITLRAGFVEFINALVPDLRVSKTIFHVLSVNWSARVIEQTLLHHTDLTADLLCVHAND 153

Query: 339 FSFKESIST--GEIIEKVESPI-----DKVQAFNNTLEKYGTDRKNLSVYIGDSVGDLLC 391
           F F  S +T  G I+ +  S +     DKV+ F   ++          VYIGDS  D  C
Sbjct: 154 FDFDTSTNTTNGRILARNASSLLMNSTDKVREFRRIVQTDAVSSPLNVVYIGDSPTDFGC 213

Query: 392 LLEADIGIVIGSSSSLRRVGSQF-GVTFIPLYPGLVKKQKEYTEGSSSNWKEKSGILYTV 450
           L  + I I++ S+     + S+F  V  + +    V+K                 I+YT 
Sbjct: 214 LQISPISILMRSNQKYYDILSRFEDVQLVDISEFPVQKA-----------VPGKKIIYTC 262

Query: 451 SSWAEVHAFILG 462
           S W  +    L 
Sbjct: 263 SDWCAIQKAFLA 274

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

>sp\|P25616\|YCQ5_YEAST UPF0655 protein YCR015C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR015C PE=3 SV=2	Back alignment and function description

>sp\|P44659\|Y358_HAEIN Uncharacterized protein HI_0358 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0358 PE=3 SV=1	Back alignment and function description

>sp\|Q8FTH8\|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		463
296088278		657	unnamed protein product [Vitis vinifera]	1.0	0.704	0.796	0.0
225466287		566	PREDICTED: uncharacterized protein LOC10	1.0	0.818	0.796	0.0
118486577		618	unknown [Populus trichocarpa]	0.995	0.745	0.792	0.0
356576723		607	PREDICTED: uncharacterized protein LOC10	0.997	0.761	0.787	0.0
224125750		577	predicted protein [Populus trichocarpa]	0.995	0.798	0.796	0.0
356535194		604	PREDICTED: uncharacterized protein LOC10	0.997	0.764	0.777	0.0
224145849		541	predicted protein [Populus trichocarpa]	0.939	0.804	0.758	0.0
357441425		452	hypothetical protein MTR_1g080470 [Medic	0.963	0.986	0.735	0.0
449449591		567	PREDICTED: uncharacterized protein LOC10	0.997	0.814	0.653	0.0
145358529		617	heme oxygenase-like, multi-helical prote	0.987	0.740	0.715	0.0

>gi\|296088278\|emb\|CBI36504.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/463 (79%), Positives = 416/463 (89%)

Query: 1   MQEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMS 60
           ++EWG DL+K +++NSATVKY +FLLATASGK+EGVKGPGKLATPFEKTKVAAYTLGAM+
Sbjct: 195 VKEWGFDLSKESSLNSATVKYRDFLLATASGKIEGVKGPGKLATPFEKTKVAAYTLGAMT 254

Query: 61  PCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEE 120
           PCMRLYAFLGKE  ALL+ +E  HPY KWIDNYSSE FQ SALQ EDLLDKLSVSLTGEE
Sbjct: 255 PCMRLYAFLGKELQALLHPSESTHPYKKWIDNYSSEGFQGSALQTEDLLDKLSVSLTGEE 314

Query: 121 LDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSA 180
           LDIIEKLY+QAMKLE+EFFCAQ L Q T+VPL KGH+PA DRL+IFSDFDLTCT+VDSSA
Sbjct: 315 LDIIEKLYYQAMKLEIEFFCAQLLDQYTIVPLTKGHDPAADRLVIFSDFDLTCTVVDSSA 374

Query: 181 ILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVEN 240
           ILAEIAI+TAPK DQNQPENQ+ RMSS +LRNTWG+LSKQYTEEYEQCIE+ +PSEKVE 
Sbjct: 375 ILAEIAIITAPKFDQNQPENQIIRMSSADLRNTWGVLSKQYTEEYEQCIENILPSEKVEE 434

Query: 241 FNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVK 300
           F+YE L KALEQLS FEKRANSRVIESGVLKG+NL+DIK+AGERL LQDGC +FFQ +VK
Sbjct: 435 FDYEGLCKALEQLSDFEKRANSRVIESGVLKGLNLDDIKRAGERLILQDGCASFFQNIVK 494

Query: 301 NENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDK 360
           NE+L A+VH+LSYCWCGDLIR++FSS GL+ LNVHANEF+FKESIS GEI++ VESPIDK
Sbjct: 495 NESLIADVHILSYCWCGDLIRSAFSSGGLHVLNVHANEFAFKESISNGEIVKNVESPIDK 554

Query: 361 VQAFNNTLEKYGTDRKNLSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVTFIP 420
           ++AF N LE    DRKNL+VYIGDSVGDLLCLL AD+GIVIGSSSSL+RVGSQFGV+F+P
Sbjct: 555 LKAFLNILENCSNDRKNLTVYIGDSVGDLLCLLNADVGIVIGSSSSLKRVGSQFGVSFVP 614

Query: 421 LYPGLVKKQKEYTEGSSSNWKEKSGILYTVSSWAEVHAFILGW 463
           L+  LVKKQKEY EGSSS WK  SG LYTVSSWAE+HAFILGW
Sbjct: 615 LFRFLVKKQKEYVEGSSSRWKGLSGTLYTVSSWAEIHAFILGW 657

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225466287\|ref\|XP_002270291.1\| PREDICTED: uncharacterized protein LOC100266835 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|118486577\|gb\|ABK95127.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356576723\|ref\|XP_003556479.1\| PREDICTED: uncharacterized protein LOC100813450 [Glycine max]	Back alignment and taxonomy information

>gi\|224125750\|ref\|XP_002319666.1\| predicted protein [Populus trichocarpa] gi\|222858042\|gb\|EEE95589.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356535194\|ref\|XP_003536133.1\| PREDICTED: uncharacterized protein LOC100788250 [Glycine max]	Back alignment and taxonomy information

>gi\|224145849\|ref\|XP_002325785.1\| predicted protein [Populus trichocarpa] gi\|222862660\|gb\|EEF00167.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357441425\|ref\|XP_003590990.1\| hypothetical protein MTR_1g080470 [Medicago truncatula] gi\|355480038\|gb\|AES61241.1\| hypothetical protein MTR_1g080470 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449449591\|ref\|XP_004142548.1\| PREDICTED: uncharacterized protein LOC101217744 [Cucumis sativus] gi\|449521164\|ref\|XP_004167600.1\| PREDICTED: uncharacterized LOC101217744 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|145358529\|ref\|NP_198287.3\| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana] gi\|332006501\|gb\|AED93884.1\| heme oxygenase-like, multi-helical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		463
TAIR\|locus:2145816		617	AT5G32470 "AT5G32470" [Arabido	0.995	0.747	0.719	1.7e-178
UNIPROTKB\|G4MTS1		304	MGG_04762 "Uncharacterized pro	0.503	0.766	0.256	6.2e-10
POMBASE\|SPBC17G9.12c		274	SPBC17G9.12c "hydrolase (predi	0.561	0.948	0.257	8.8e-08
UNIPROTKB\|Q5HW25		221	CJE0491 "TenA/Thi-4 family pro	0.181	0.380	0.352	2.7e-07
TIGR_CMR\|CJE_0491		221	CJE_0491 "TenA/Thi-4 family pr	0.181	0.380	0.352	2.7e-07
SGD\|S000000608		317	YCR015C "Putative protein of u	0.490	0.716	0.267	1.5e-05
CGD\|CAL0004824		288	orf19.6732 [Candida albicans (	0.395	0.635	0.252	2e-05

TAIR\|locus:2145816 AT5G32470 "AT5G32470" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1733 (615.1 bits), Expect = 1.7e-178, P = 1.7e-178
 Identities = 336/467 (71%), Positives = 398/467 (85%)

Query:     1 MQEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMS 60
             +Q+W  D+ K  +VNSAT++YTEFLLATASGKVEG K PG L TPFEKTKVAAYTLGA++
Sbjct:   152 VQDWDLDINKEVSVNSATLRYTEFLLATASGKVEGCKAPGMLDTPFEKTKVAAYTLGAVT 211

Query:    61 PCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEE 120
             PCMRLYAFLGKEF +LL+ ++ NHPY KWIDNYSS++FQASA Q EDLL+KLSVS+TGEE
Sbjct:   212 PCMRLYAFLGKEFGSLLDLSDVNHPYKKWIDNYSSDAFQASAKQTEDLLEKLSVSMTGEE 271

Query:   121 LDIIEKLYHQAMKLEVEFFCAQPLAQPTVVPLIKGHNPAGDRLIIFSDFDLTCTIVDSSA 180
             LDIIEKLY QAMKLEVEFF AQPLAQPT+VPL+K H+   D L+IFSDFDLTCT+VDSSA
Sbjct:   272 LDIIEKLYQQAMKLEVEFFHAQPLAQPTIVPLLKNHSK--DDLVIFSDFDLTCTVVDSSA 329

Query:   181 ILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVEN 240
             ILAEIAIVTAPK +Q++   Q+ RM S +L+NTW LLSKQYTE YE+CIES +  +K + 
Sbjct:   330 ILAEIAIVTAPKDEQSRSGQQIHRMLSSDLKNTWNLLSKQYTEHYEECIESILNKKKADK 389

Query:   241 FNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGERLSLQDGCTTFFQKVVK 300
             F+YE L KALEQLS FEK AN+RVIESGVLKG+NLEDIK+AGERL LQDGC   FQK++K
Sbjct:   390 FDYEGLCKALEQLSDFEKEANNRVIESGVLKGLNLEDIKRAGERLILQDGCINVFQKILK 449

Query:   301 NENLNANVHVLSYCWCGDLIRASFSSAGLNALNVHANEFSFKESISTGEIIEKVESPIDK 360
              ENLNA +HVLSYCWCGDLIRA+FS+ G++A+ VHANEF+F+ESISTGEI  KVESPI+K
Sbjct:   450 TENLNAELHVLSYCWCGDLIRAAFSAGGVDAVEVHANEFTFEESISTGEIERKVESPINK 509

Query:   361 VQAFNNTLE--KYGTDRKN-LSVYIGDSVGDLLCLLEADIGIVIGSSSSLRRVGSQFGVT 417
              Q F + L+  K   ++K+ LSVYIGDSVGDLLCLLEADIGIV+ SSSSLRRVGS FGV+
Sbjct:   510 AQQFKSILQNRKNENNKKSFLSVYIGDSVGDLLCLLEADIGIVVSSSSSLRRVGSHFGVS 569

Query:   418 FIPLYPGLVKKQKEYTEGSSSN-WKEKSGILYTVSSWAEVHAFILGW 463
             F+PL+ G+V+KQK++TE SSS+ WK  SG LYTVSSWAE+H+F LGW
Sbjct:   570 FVPLFSGIVQKQKQHTEESSSSAWKGLSGTLYTVSSWAEIHSFALGW 616

GO:0003674 "molecular_function" evidence=ND

GO:0008150 "biological_process" evidence=ND

GO:0009507 "chloroplast" evidence=ISM

GO:0005829 "cytosol" evidence=IDA

UNIPROTKB\|G4MTS1 MGG_04762 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

POMBASE\|SPBC17G9.12c SPBC17G9.12c "hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5HW25 CJE0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_0491 CJE_0491 "TenA/Thi-4 family protein" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

SGD\|S000000608 YCR015C "Putative protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

CGD\|CAL0004824 orf19.6732 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00023523001	SubName- Full=Chromosome undetermined scaffold_30, whole genome shotgun sequence; (566 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		463
COG0819		218	COG0819, TenA, Putative transcription activator [T	3e-19
PTZ00347		504	PTZ00347, PTZ00347, phosphomethylpyrimidine kinase	8e-12
TIGR04306		208	TIGR04306, salvage_TenA, thiaminase II	1e-11
PRK14713		530	PRK14713, PRK14713, multifunctional hydroxymethylp	5e-10
pfam03070		210	pfam03070, TENA_THI-4, TENA/THI-4/PQQC family	3e-07
PRK09517		755	PRK09517, PRK09517, multifunctional thiamine-phosp	4e-06
TIGR00338		219	TIGR00338, serB, phosphoserine phosphatase SerB	2e-05
COG0560		212	COG0560, SerB, Phosphoserine phosphatase [Amino ac	2e-05
pfam12710		122	pfam12710, HAD, haloacid dehalogenase-like hydrola	3e-04

>gnl\|CDD\|223889 COG0819, TenA, Putative transcription activator [Transcription]	Back alignment and domain information

 Score = 85.8 bits (213), Expect = 3e-19
 Identities = 45/142 (31%), Positives = 70/142 (49%), Gaps = 23/142 (16%)

Query: 1   MQEWGTDLAKMATV--NSATVKYTEFLLATA-SGKVEGVKGPGKLATPFEKTKVAAYTLG 57
            +E G  L ++     + A   YT +LL TA SG                     A  L 
Sbjct: 90  AEELGISLDELLKTEPSPANKAYTRYLLDTAYSGSF-------------------AELLA 130

Query: 58  AMSPCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLT 117
           A+ PC+  YA +GK   A   A+  N PY +WID Y+SE FQ +  + E LLD L+ + +
Sbjct: 131 ALLPCLWGYAEIGKRLKAKPRASP-NPPYQEWIDTYASEEFQEAVEELEALLDSLAENSS 189

Query: 118 GEELDIIEKLYHQAMKLEVEFF 139
            EEL+ +++++  A + E+ F+
Sbjct: 190 EEELEKLKQIFLTASRFELAFW 211

Length = 218

>gnl\|CDD\|240375 PTZ00347, PTZ00347, phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|213919 TIGR04306, salvage_TenA, thiaminase II	Back alignment and domain information

>gnl\|CDD\|237797 PRK14713, PRK14713, multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional	Back alignment and domain information

>gnl\|CDD\|217351 pfam03070, TENA_THI-4, TENA/THI-4/PQQC family	Back alignment and domain information

>gnl\|CDD\|169939 PRK09517, PRK09517, multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|232927 TIGR00338, serB, phosphoserine phosphatase SerB	Back alignment and domain information

>gnl\|CDD\|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		463
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	99.96
COG0819		218	TenA Putative transcription activator [Transcripti	99.95
COG4359		220	Uncharacterized conserved protein [Function unknow	99.92
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	99.92
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	99.91
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	99.9
PRK14713		530	multifunctional hydroxymethylpyrimidine phosphokin	99.9
PF05822		246	UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter	99.89
PRK11133		322	serB phosphoserine phosphatase; Provisional	99.89
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	99.89
PF03070		210	TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR0	99.88
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	99.88
PTZ00347		504	phosphomethylpyrimidine kinase; Provisional	99.88
KOG3128		298	consensus Uncharacterized conserved protein [Funct	99.87
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	99.85
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	99.84
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	99.83
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	99.83
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	99.83
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	99.82
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	99.79
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	99.78
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	99.78
PLN02954		224	phosphoserine phosphatase	99.76
PRK11590		211	hypothetical protein; Provisional	99.75
PRK13582		205	thrH phosphoserine phosphatase; Provisional	99.65
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	99.61
PLN02177		497	glycerol-3-phosphate acyltransferase	99.38
KOG2598		523	consensus Phosphomethylpyrimidine kinase [Coenzyme	99.34
PRK13222		226	phosphoglycolate phosphatase; Provisional	99.22
PRK08238		479	hypothetical protein; Validated	99.21
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	99.15
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	99.14
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	99.12
PRK13288		214	pyrophosphatase PpaX; Provisional	99.11
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	99.1
PRK13226		229	phosphoglycolate phosphatase; Provisional	99.08
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	99.07
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	99.06
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	99.05
PRK13225		273	phosphoglycolate phosphatase; Provisional	99.04
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	99.01
PLN02575		381	haloacid dehalogenase-like hydrolase	99.0
PRK14988		224	GMP/IMP nucleotidase; Provisional	98.98
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	98.97
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	98.96
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	98.95
PRK13223		272	phosphoglycolate phosphatase; Provisional	98.93
PRK09449		224	dUMP phosphatase; Provisional	98.93
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	98.93
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	98.92
COG0546		220	Gph Predicted phosphatases [General function predi	98.91
PRK11587		218	putative phosphatase; Provisional	98.9
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	98.87
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	98.86
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	98.85
PLN02940		382	riboflavin kinase	98.83
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	98.82
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	98.74
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	98.7
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	98.69
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	98.66
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	98.66
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	98.66
PRK10563		221	6-phosphogluconate phosphatase; Provisional	98.65
PHA02597		197	30.2 hypothetical protein; Provisional	98.65
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	98.65
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	98.62
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	98.61
TIGR01497		675	kdpB K+-transporting ATPase, B subunit. One sequen	98.57
TIGR01511		562	ATPase-IB1_Cu copper-(or silver)-translocating P-t	98.52
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.52
PRK01122		679	potassium-transporting ATPase subunit B; Provision	98.52
PRK14010		673	potassium-transporting ATPase subunit B; Provision	98.49
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	98.44
PRK10748		238	flavin mononucleotide phosphatase; Provisional	98.44
PLN02811		220	hydrolase	98.42
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	98.42
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	98.42
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	98.38
PLN02499		498	glycerol-3-phosphate acyltransferase	98.37
TIGR01524		867	ATPase-IIIB_Mg magnesium-translocating P-type ATPa	98.34
TIGR01512		536	ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo	98.34
COG4030		315	Uncharacterized protein conserved in archaea [Func	98.29
PRK10517		902	magnesium-transporting ATPase MgtA; Provisional	98.29
PRK15122		903	magnesium-transporting ATPase; Provisional	98.29
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	98.27
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	98.24
TIGR01647		755	ATPase-IIIA_H plasma-membrane proton-efflux P-type	98.23
TIGR01525		556	ATPase-IB_hvy heavy metal translocating P-type ATP	98.2
TIGR01517		941	ATPase-IIB_Ca plasma-membrane calcium-translocatin	98.19
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	98.17
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	98.17
TIGR01523		1053	ATPase-IID_K-Na potassium and/or sodium efflux P-t	98.15
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	98.15
PRK10671		834	copA copper exporting ATPase; Provisional	98.14
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	98.13
TIGR01522		884	ATPase-IIA2_Ca golgi membrane calcium-translocatin	98.11
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	98.1
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	98.09
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	98.09
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	98.05
COG4087		152	Soluble P-type ATPase [General function prediction	98.04
KOG0207		951	consensus Cation transport ATPase [Inorganic ion t	98.04
PRK05446		354	imidazole glycerol-phosphate dehydratase/histidino	98.02
TIGR01116		917	ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium	97.99
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	97.99
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	97.95
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	97.86
KOG0202		972	consensus Ca2+ transporting ATPase [Inorganic ion	97.86
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	97.83
PRK06769		173	hypothetical protein; Validated	97.78
TIGR01106		997	ATPase-IIC_X-K sodium or proton efflux -- potassiu	97.75
COG0474		917	MgtA Cation transport ATPase [Inorganic ion transp	97.72
PRK10513		270	sugar phosphate phosphatase; Provisional	97.72
TIGR01685		174	MDP-1 magnesium-dependent phosphatase-1. This mode	97.7
PRK10976		266	putative hydrolase; Provisional	97.68
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	97.66
TIGR01494		499	ATPase_P-type ATPase, P-type (transporting), HAD s	97.66
TIGR01657		1054	P-ATPase-V P-type ATPase of unknown pump specifici	97.64
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	97.64
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	97.63
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	97.63
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	97.61
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	97.58
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	97.56
TIGR01668		170	YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph	97.52
KOG3085		237	consensus Predicted hydrolase (HAD superfamily) [G	97.51
PF08235		157	LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209	97.51
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	97.5
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	97.49
PRK01158		230	phosphoglycolate phosphatase; Provisional	97.44
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	97.37
COG2216		681	KdpB High-affinity K+ transport system, ATPase cha	97.36
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	97.36
PLN02887		580	hydrolase family protein	97.35
TIGR02471		236	sucr_syn_bact_C sucrose phosphate synthase, sucros	97.27
PHA02530		300	pseT polynucleotide kinase; Provisional	97.26
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	97.25
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	97.2
TIGR01652		1057	ATPase-Plipid phospholipid-translocating P-type AT	97.19
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	97.18
PLN03190		1178	aminophospholipid translocase; Provisional	97.12
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	97.06
COG0241		181	HisB Histidinol phosphatase and related phosphatas	96.92
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	96.89
PLN02382		413	probable sucrose-phosphatase	96.87
PF06941		191	NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol	96.82
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	96.79
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	96.74
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	96.69
PF05116		247	S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter	96.64
KOG0204		1034	consensus Calcium transporting ATPase [Inorganic i	96.52
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	96.45
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	96.36
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	96.23
PF11019		252	DUF2608: Protein of unknown function (DUF2608); In	96.14
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	96.11
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	96.09
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	96.02
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	95.89
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	95.89
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	95.87
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	95.56
COG2503		274	Predicted secreted acid phosphatase [General funct	95.38
PTZ00174		247	phosphomannomutase; Provisional	95.31
KOG0210		1051	consensus P-type ATPase [Inorganic ion transport a	94.82
PLN02423		245	phosphomannomutase	94.75
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	94.62
PF13242		75	Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY	93.46
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	93.44
KOG0203		1019	consensus Na+/K+ ATPase, alpha subunit [Inorganic	93.35
TIGR02244		343	HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd	92.86
TIGR01680		275	Veg_Stor_Prot vegetative storage protein. The prot	92.76
KOG3109		244	consensus Haloacid dehalogenase-like hydrolase [Ge	92.74
PLN02580		384	trehalose-phosphatase	92.53
KOG0206		1151	consensus P-type ATPase [General function predicti	92.41
COG3700		237	AphA Acid phosphatase (class B) [General function	92.35
COG4996		164	Predicted phosphatase [General function prediction	92.02
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	91.97
COG2179		175	Predicted hydrolase of the HAD superfamily [Genera	90.84
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	90.54
PHA03398		303	viral phosphatase superfamily protein; Provisional	90.27
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	89.73
PLN02645		311	phosphoglycolate phosphatase	88.72
KOG0208		1140	consensus Cation transport ATPase [Inorganic ion t	87.95
PTZ00445		219	p36-lilke protein; Provisional	87.5
KOG0209		1160	consensus P-type ATPase [Inorganic ion transport a	87.49
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	85.26
COG3769		274	Predicted hydrolase (HAD superfamily) [General fun	84.8
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	83.98
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	82.41
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	80.14

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

Probab=99.96  E-value=1.2e-28  Score=240.78  Aligned_cols=228  Identities=18%  Similarity=0.273  Sum_probs=184.8

Q ss_pred             CCCeEEEcccccceecccchhHHHHHHHhhCCCCCCCCCcccccccccccccchhhhhHHHHHHHHHHHHhhcCCCCccc
Q 012437          160 GDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVE  239 (463)
Q Consensus       160 ~~~~~ii~DFD~TiT~~DT~~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~i~~~y~~~~~~~~~~~~P~~~~~  239 (463)
                      +++++||+|||.|||++-+-        .++++.            +||.+....+.+++.|.++..+++++|+|+|.++
T Consensus        20 ~~~lqvisDFD~Tlt~~~~~--------~g~~~~------------s~~~~~~~~~~~~~~~~~~~~~l~~~Y~PiE~d~   79 (277)
T TIGR01544        20 AAKLQIISDFDYTLSRFSYE--------DGKRCP------------TCHGIFDNCKLLTDECRKKLLQLKEKYYPIEVDP   79 (277)
T ss_pred             hhheEEeeccCccceeeecC--------CCCCCc------------chHhHHhhCCCCCHHHHHHHHHHHhhccceecCC
Confidence            48999999999999987321        223332            5777888889999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhhHHHHHHHHHHHHhhhcCCCCHHHHHHHhh--cCCCChhHHHHHHHHHHcCCCCCcEEEEccccCH
Q 012437          240 NFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGE--RLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCG  317 (463)
Q Consensus       240 ~~~~~~~~~~l~~l~e~e~~s~~rv~~~~~f~Gi~~~~i~~~~~--~i~lr~G~~efl~~l~~~g~~~~~~~IvS~g~s~  317 (463)
                      .++.+++.++|.   |||++++..+++.    +++++++.++.+  .+.++||+.+|++.|+++|   ++++|+|+|+ .
T Consensus        80 ~~~~~eK~~~m~---eWw~k~~~l~~~~----~~~~e~i~~~v~~~~l~l~pG~~efl~~L~~~G---Ipv~IvS~G~-~  148 (277)
T TIGR01544        80 VLTVEEKYPYMV---EWWTKSHGLLVQQ----AFPKAKIKEIVAESDVMLKDGYENFFDKLQQHS---IPVFIFSAGI-G  148 (277)
T ss_pred             CCChHHhhhHHH---HHHHHHHHHHhcC----CCCHHHHHHHHhhcCCccCcCHHHHHHHHHHCC---CcEEEEeCCc-H
Confidence            999999999874   9999999999874    569999999987  8999999999999999999   9999999998 8


Q ss_pred             HHHHHHHHhcCC--CcceEEeeceEEc-cceeeccccccCCCCcchHHHHHH-HHHHhC-CCCCceEEEEcCCcccHHHh
Q 012437          318 DLIRASFSSAGL--NALNVHANEFSFK-ESISTGEIIEKVESPIDKVQAFNN-TLEKYG-TDRKNLSVYIGDSVGDLLCL  392 (463)
Q Consensus       318 ~~I~~~l~~~gl--~~~~I~aN~l~~~-~g~~tG~~~~~~~~g~~K~~~l~~-l~~~~~-~~~~~~vIyIGDs~tDl~~l  392 (463)
                      .+|+.+|++.|+  .+++|+||+|.|+ +|+++| +.+++....+|.+.+.+ .....+ ...+.++|++|||.||++|+
T Consensus       149 ~~Ie~vL~~lgl~~~~~~IvSN~L~f~~dGvltG-~~~P~i~~~~K~~~v~~~~~~~~~~~~~~~~vI~vGDs~~Dl~ma  227 (277)
T TIGR01544       149 NVLEEVLRQAGVYHPNVKVVSNFMDFDEDGVLKG-FKGPLIHTFNKNHDVALRNTEYFNQLKDRSNIILLGDSQGDLRMA  227 (277)
T ss_pred             HHHHHHHHHcCCCCcCceEEeeeEEECCCCeEeC-CCCCcccccccHHHHHHHHHHHhCccCCcceEEEECcChhhhhHh
Confidence            999999998887  4669999999995 599999 45566777889876654 333332 12357899999999999998


Q ss_pred             Hhc-C---e-eEEEcC---ChhHHHHhhhhCceee
Q 012437          393 LEA-D---I-GIVIGS---SSSLRRVGSQFGVTFI  419 (463)
Q Consensus       393 ~~A-d---i-giv~~~---~~~L~~~~~~~gi~~~  419 (463)
                      .-. .   + .|-|-+   ...|.+|.+.+.|-++
T Consensus       228 ~g~~~~~~~l~igfln~~~e~~l~~y~~~~Divl~  262 (277)
T TIGR01544       228 DGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLV  262 (277)
T ss_pred             cCCCcccceEEEEecccCHHHHHHHHHHhCCEEEE
Confidence            765 1   1 222322   2467778877776444

This group of sequences was found during searches for members of the haloacid dehalogenase (HAD) superfamily. All of the conserved catalytic motifs are found. The placement of the variable domain between motifs 1 and 2 indicates membership in subfamily I of the superfamily, but these sequences are sufficiently different from any of the branches (IA, TIGR01493, TIGR01509, TIGR01549; IB, TIGR01488; IC, TIGR01494; ID, TIGR01658; IF TIGR01545) of that subfamily as to constitute a separate branch to now be called IE. Considering that the closest identifiable hit outside of the noise range is to a phosphoserine phosphatase, this group may be considered to be most closely allied to subfamily IB.

>COG0819 TenA Putative transcription activator [Transcription]	Back alignment and domain information

>COG4359 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional	Back alignment and domain information

>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>PF03070 TENA_THI-4: TENA/THI-4/PQQC family; InterPro: IPR004305 Proteins containing this domain are found in all the three major phyla of life: archaebacteria, eubacteria, and eukaryotes	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>PTZ00347 phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>KOG3128 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>PLN02177 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription]	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>TIGR01497 kdpB K+-transporting ATPase, B subunit	Back alignment and domain information

>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK01122 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>PRK14010 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>PLN02499 glycerol-3-phosphate acyltransferase	Back alignment and domain information

>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase	Back alignment and domain information

>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase	Back alignment and domain information

>COG4030 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PRK10517 magnesium-transporting ATPase MgtA; Provisional	Back alignment and domain information

>PRK15122 magnesium-transporting ATPase; Provisional	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase	Back alignment and domain information

>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase	Back alignment and domain information

>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>COG4087 Soluble P-type ATPase [General function prediction only]	Back alignment and domain information

>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional	Back alignment and domain information

>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>PRK06769 hypothetical protein; Validated	Back alignment and domain information

>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit	Back alignment and domain information

>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01685 MDP-1 magnesium-dependent phosphatase-1	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC	Back alignment and domain information

>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V)	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins []	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>PLN03190 aminophospholipid translocase; Provisional	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []	Back alignment and domain information

>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>COG2503 Predicted secreted acid phosphatase [General function prediction only]	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase	Back alignment and domain information

>TIGR01680 Veg_Stor_Prot vegetative storage protein	Back alignment and domain information

>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

>KOG0206 consensus P-type ATPase [General function prediction only]	Back alignment and domain information

>COG3700 AphA Acid phosphatase (class B) [General function prediction only]	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PTZ00445 p36-lilke protein; Provisional	Back alignment and domain information

>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		463
2f2g_A		221	SEED maturation protein PM36 homolog; TENA_THI-4 d	9e-19
3ibx_A		221	TENA, HP1287, putative thiaminase II; vitamin B1,	3e-18
2qcx_A		263	Transcriptional activator TENA; UP-DOWN bundle, hy	5e-18
1rtw_A		220	Transcriptional activator, putative; PF1337, TENA,	6e-17
2a2m_A		258	Hypothetical protein BT3146; putative TENA family	7e-17
3no6_A		248	Transcriptional activator TENA; structural genomic	8e-16
3rm5_A		550	Hydroxymethylpyrimidine/phosphomethylpyrimidine K	9e-16
2gm8_A		221	TENA homolog/THI-4 thiaminase; transcription, tran	1e-14
2qzc_A		214	Transcriptional activator TENA-1; heme oxygenase-l	2e-14
1udd_A		226	Transcriptional regulator; helix-bundle, lipid bin	2e-14
3mvu_A		226	TENA family transcriptional regulator; TENA/THI-4/	3e-14
1z72_A		225	Transcriptional regulator, putative; structu genom	2e-12
1wwm_A		190	Hypothetical protein TT2028; TENA/THI-4 family, pu	3e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-06
2g09_A		297	Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMP	2e-07
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	6e-07
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	3e-06
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	6e-06
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	1e-05
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	3e-05
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	5e-05

>2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A* Length = 221	Back alignment and structure

 Score = 84.0 bits (207), Expect = 9e-19
 Identities = 23/139 (16%), Positives = 48/139 (34%), Gaps = 20/139 (14%)

Query: 1   MQEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMS 60
             +W  D +       A  +Y  FL    S +V+                     + A  
Sbjct: 96  GSKWDVDFS-TVVPQRANQEYGRFLEDLMSSEVK-----------------YPVIMTAFW 137

Query: 61  PCMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEE 120
               +Y       H L + N+     T     + ++ F+      +++ ++   + +GE 
Sbjct: 138 AIEAVYQESFA--HCLEDGNKTPVELTGACHRWGNDGFKQYCSSVKNIAERCLENASGEV 195

Query: 121 LDIIEKLYHQAMKLEVEFF 139
           L   E +  + ++LEV F+
Sbjct: 196 LGEAEDVLVRVLELEVAFW 214

PyMOL of 2f2g

>3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A Length = 221	Back alignment and structure

>2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A Length = 263	Back alignment and structure

>1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3 Length = 220	Back alignment and structure

>2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A Length = 258	Back alignment and structure

>3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} Length = 248	Back alignment and structure

>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Length = 550	Back alignment and structure

>2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A* Length = 221	Back alignment and structure

>2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2} Length = 214	Back alignment and structure

>1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3 Length = 226	Back alignment and structure

>3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Length = 226	Back alignment and structure

>1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A Length = 225	Back alignment and structure

>1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3 Length = 190	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		463
3ibx_A		221	TENA, HP1287, putative thiaminase II; vitamin B1,	99.94
3no6_A		248	Transcriptional activator TENA; structural genomic	99.94
4fn6_A		229	Thiaminase-2, thiaminase II; alpha-helix, vitamin	99.93
3mvu_A		226	TENA family transcriptional regulator; TENA/THI-4/	99.93
1wwm_A		190	Hypothetical protein TT2028; TENA/THI-4 family, pu	99.92
2qcx_A		263	Transcriptional activator TENA; UP-DOWN bundle, hy	99.92
1rtw_A		220	Transcriptional activator, putative; PF1337, TENA,	99.92
2f2g_A		221	SEED maturation protein PM36 homolog; TENA_THI-4 d	99.91
3rm5_A		550	Hydroxymethylpyrimidine/phosphomethylpyrimidine K	99.91
1z72_A		225	Transcriptional regulator, putative; structu genom	99.9
2gm8_A		221	TENA homolog/THI-4 thiaminase; transcription, tran	99.9
1udd_A		226	Transcriptional regulator; helix-bundle, lipid bin	99.89
2a2m_A		258	Hypothetical protein BT3146; putative TENA family	99.89
4fe3_A		297	Cytosolic 5'-nucleotidase 3; substrate complex, HA	99.88
2qzc_A		214	Transcriptional activator TENA-1; heme oxygenase-l	99.88
3fvv_A		232	Uncharacterized protein; unknown function, structu	99.88
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	99.79
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	99.78
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	99.76
4gxt_A		385	A conserved functionally unknown protein; structur	99.73
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	99.7
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	99.66
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	99.61
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.6
3oql_A		262	TENA homolog; transcriptional activator, structura	99.58
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	99.49
4as2_A		327	Phosphorylcholine phosphatase; hydrolase, HAD supe	99.47
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	99.4
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	99.39
1rcw_A		231	CT610, CADD; iron, DI-iron, redox enzyme, metallo	99.33
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	99.27
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	99.26
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	99.24
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	99.24
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	99.23
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	99.18
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	99.18
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	99.18
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	99.17
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	99.17
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	99.16
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	99.16
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	99.15
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	99.15
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	99.15
1te2_A		226	Putative phosphatase; structural genomics, phospha	99.11
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	99.11
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	99.09
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	99.09
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	99.07
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	99.07
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	99.06
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	99.06
2hsz_A		243	Novel predicted phosphatase; structural genomics,	99.06
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	99.05
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	99.05
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	99.02
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	99.02
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	99.02
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	99.01
1y8a_A		332	Hypothetical protein AF1437; structural genomics,	99.01
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	99.01
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	98.99
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	98.99
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	98.99
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	98.99
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	98.98
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	98.97
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	98.97
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	98.95
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	98.94
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	98.93
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	98.91
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	98.91
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	98.91
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	98.89
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	98.88
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	98.87
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	98.85
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	98.85
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	98.84
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	98.82
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	98.8
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	98.79
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	98.79
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	98.77
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	98.74
3dde_A		239	TENA/THI-4 protein, domain of unknown function WI	98.73
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	98.2
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	98.66
2zg6_A		220	Putative uncharacterized protein ST2620, probable	98.66
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	98.66
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	98.64
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	98.63
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	98.62
3mmz_A		176	Putative HAD family hydrolase; structural genomics	98.59
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	98.58
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	98.57
3dao_A		283	Putative phosphatse; structural genomics, joint ce	98.56
3n07_A		195	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	98.54
3mn1_A		189	Probable YRBI family phosphatase; structural genom	98.48
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	98.45
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	98.43
2p9j_A		162	Hypothetical protein AQ2171; secsg, riken, PSI, st	98.42
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	98.42
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	98.4
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	98.4
1k1e_A		180	Deoxy-D-mannose-octulosonate 8-phosphate phosphat;	98.39
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	98.38
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	98.38
2o2x_A		218	Hypothetical protein; structural genomics, joint c	98.37
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	98.37
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	98.36
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	98.36
3hlx_A		258	Pyrroloquinoline-quinone synthase; PQQC, PQQ biosy	98.35
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	98.32
3rfu_A		736	Copper efflux ATPase; alpha helical, CPC, CXXC, AT	98.31
3e8m_A		164	Acylneuraminate cytidylyltransferase; 2-keto-3-deo	98.29
3n1u_A		191	Hydrolase, HAD superfamily, subfamily III A; struc	98.29
3j08_A		645	COPA, copper-exporting P-type ATPase A; copper tra	98.26
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	98.26
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	98.23
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	98.23
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	98.23
3ar4_A		995	Sarcoplasmic/endoplasmic reticulum calcium ATPase;	98.21
3j09_A		723	COPA, copper-exporting P-type ATPase A; copper tra	98.19
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	98.18
1mhs_A		920	Proton pump, plasma membrane ATPase; ION transport	98.17
3bjd_A		332	Putative 3-oxoacyl-(acyl-carrier-protein) synthas;	98.13
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	98.13
2zxe_A		1028	Na, K-ATPase alpha subunit; membrane protein, ION	98.09
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	98.02
3b8c_A		885	ATPase 2, plasma membrane-type; P-type ATPase, pro	98.01
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	98.01
3ixz_A		1034	Potassium-transporting ATPase alpha; ION pump, H+,	97.91
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	97.9
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	97.86
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	97.82
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	97.79
1qyi_A		384	ZR25, hypothetical protein; structural genomics, P	97.77
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	97.67
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	97.67
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	97.64
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	97.6
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	97.58
3nvb_A		387	Uncharacterized protein; protein FKBH, protein fkb	97.54
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	97.54
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	97.26
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	97.19
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	97.15
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	97.15
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	97.12
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	97.1
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	97.1
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	97.07
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	97.06
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	97.0
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	97.0
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	96.92
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	96.85
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	96.64
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	96.55
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	96.14
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	96.07
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	95.44
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	94.94
2oyc_A		306	PLP phosphatase, pyridoxal phosphate phosphatase;	94.59
1vjr_A		271	4-nitrophenylphosphatase; TM1742, structural genom	93.8
3pdw_A		266	Uncharacterized hydrolase YUTF; structural genomic	93.46
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	91.22
1zjj_A		263	Hypothetical protein PH1952; alpha/beta hydrolase	90.84
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	90.17
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	89.88
2jc9_A		555	Cytosolic purine 5'-nucleotidase; cytosolic 5-prim	85.57
3b5o_A		244	CADD-like protein of unknown function; structural	82.83

>3ibx_A TENA, HP1287, putative thiaminase II; vitamin B1, hydrol; 2.40A {Helicobacter pylori} PDB: 2rd3_A	Back alignment and structure

Probab=99.94  E-value=2.4e-27  Score=225.89  Aligned_cols=123  Identities=24%  Similarity=0.391  Sum_probs=111.0

Q ss_pred             CcCCCCccc--ccCCChhHHHHHHHHHHHhc-CCCcCcCCCCCCCCccchhhhhHHHHHHHHhHHHHHHHHHHHHHhhcc
Q 012437            2 QEWGTDLAK--MATVNSATVKYTEFLLATAS-GKVEGVKGPGKLATPFEKTKVAAYTLGAMSPCMRLYAFLGKEFHALLN   78 (463)
Q Consensus         2 ~~~gi~~~~--~~~~~~~~~~Y~~~l~~~a~-~~~~~~~~~~~~~~~~~~~~~~~~~l~A~~pC~~~Y~~~~~~~~~~~~   78 (463)
                      ++|||+.++  ..+++|+|.+|++||++++. |++                   +++++||+||+|+|++||+++.+...
T Consensus        95 ~~~Gi~~~~~~~~~~~p~~~aY~~~l~~~a~~~~~-------------------~~~~aAl~pc~~~Y~~ig~~l~~~~~  155 (221)
T 3ibx_A           95 RELQITQKELQNACPTLANKSYTSYMLAEGFKGSI-------------------KEVAAAVLSCGWSYLVIAQNLSQIPN  155 (221)
T ss_dssp             HHTTCCHHHHHHCCCCHHHHHHHHHHHHHHHHSCH-------------------HHHHHHTHHHHHHHHHHHHHHTCSSS
T ss_pred             HHcCCCHHHHhhccCCHHHHHHHHHHHHHHhcCCH-------------------HHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            578999864  57889999999999999996 544                   78999999999999999999976532


Q ss_pred             CCCCcccccccccccCChHHHHHHHHHHHHHHHhhccCCHHHHHHHHHHHHHHHHHHHHhhccCCCC
Q 012437           79 ANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEELDIIEKLYHQAMKLEVEFFCAQPLA  145 (463)
Q Consensus        79 ~~~~~~~y~~Wi~~y~s~~f~~~~~~~~~~ld~~~~~~~~~~~~~l~~~f~~a~~lE~~Fw~~~~~~  145 (463)
                      + .++|+|++||++|+|++|++.|.+++++||++++.++++++++|+++|.++|+||++||+|+ |.
T Consensus       156 ~-~~~~~y~~WI~~y~~~~f~~~v~~~~~~ld~~~~~~~~~~~~~~~~~F~~a~~lE~~Fwd~a-~~  220 (221)
T 3ibx_A          156 A-LEHAFYGHWIKGYSSKEFQACVNWNINLLDSLTLASSKQEIEKLKEIFITTSEYEYLFWDMA-YQ  220 (221)
T ss_dssp             T-TTCTTTHHHHHHTTSHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHHH-HT
T ss_pred             C-CCCChHHHHHHHhCCHHHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHHHHHHH-hc
Confidence            1 35799999999999999999999999999999999999999999999999999999999998 64

PyMOL of 3ibx

>3no6_A Transcriptional activator TENA; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.65A {Staphylococcus epidermidis} SCOP: a.132.1.0	Back alignment and structure

>4fn6_A Thiaminase-2, thiaminase II; alpha-helix, vitamin B1, BI-functional enzyme, C of thiamine INTO HMP and THZ; HET: CME; 2.69A {Staphylococcus aureus}	Back alignment and structure

>3mvu_A TENA family transcriptional regulator; TENA/THI-4/PQQC family, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} SCOP: a.132.1.0	Back alignment and structure

>1wwm_A Hypothetical protein TT2028; TENA/THI-4 family, putative transctiption activator, structu genomics; 2.61A {Thermus thermophilus} SCOP: a.132.1.3	Back alignment and structure

>2qcx_A Transcriptional activator TENA; UP-DOWN bundle, hydrolase; HET: PF1; 2.20A {Bacillus subtilis} PDB: 1yak_A* 1yaf_A* 1to9_A* 1tyh_A	Back alignment and structure

>1rtw_A Transcriptional activator, putative; PF1337, TENA, thiamin, structural genomics, PSI, protein STR initiative; HET: MP5; 2.35A {Pyrococcus furiosus} SCOP: a.132.1.3	Back alignment and structure

>2f2g_A SEED maturation protein PM36 homolog; TENA_THI-4 domain, TENA/THI-4/PQQC family, AT3G16990, struct genomics, protein structure initiative; HET: HMH; 2.10A {Arabidopsis thaliana} SCOP: a.132.1.3 PDB: 2q4x_A*	Back alignment and structure

>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae}	Back alignment and structure

>1z72_A Transcriptional regulator, putative; structu genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 1.45A {Streptococcus pneumoniae} SCOP: a.132.1.3 PDB: 2a6b_A	Back alignment and structure

>2gm8_A TENA homolog/THI-4 thiaminase; transcription, transferase; HET: HMH; 2.50A {Pyrobaculum aerophilum} SCOP: a.132.1.3 PDB: 2gm7_A*	Back alignment and structure

>1udd_A Transcriptional regulator; helix-bundle, lipid binding protein; 2.15A {Pyrococcus horikoshii} SCOP: a.132.1.3	Back alignment and structure

>2a2m_A Hypothetical protein BT3146; putative TENA family transcriptional regulator, structural G joint center for structural genomics; 1.88A {Bacteroides thetaiotaomicron} SCOP: a.132.1.3 PDB: 2a2o_A	Back alignment and structure

>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A	Back alignment and structure

>2qzc_A Transcriptional activator TENA-1; heme oxygenase-like fold, structural genomics, joint center structural genomics, JCSG; 1.50A {Sulfolobus solfataricus P2}	Back alignment and structure

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii}	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>3oql_A TENA homolog; transcriptional activator, structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.54A {Pseudomonas syringae PV}	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A*	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>1rcw_A CT610, CADD; iron, DI-iron, redox enzyme, metallo enzyme, oxidoreductase,; 2.50A {Chlamydia trachomatis} SCOP: a.132.1.4	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>3dde_A TENA/THI-4 protein, domain of unknown function WI oxygenase-like fold; structural genomics, joint center for structural genomics; HET: MSE PGE; 2.30A {Shewanella denitrificans OS217}	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae}	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A	Back alignment and structure

>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus}	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A*	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>3hlx_A Pyrroloquinoline-quinone synthase; PQQC, PQQ biosynthesis, oxidase, complex, all helical, oxido; HET: PQQ; 1.30A {Klebsiella pneumoniae subsp} SCOP: a.132.1.4 PDB: 3hml_A* 1otv_A 3hnh_A* 1otw_A*	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp}	Back alignment and structure

>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A*	Back alignment and structure

>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0	Back alignment and structure

>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ...	Back alignment and structure

>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus}	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1	Back alignment and structure

>3bjd_A Putative 3-oxoacyl-(acyl-carrier-protein) synthas; structural genomics, APC5632, 3-oxoacyl-(acyl-carrier-protei synthase, PSI-2; HET: MSE; 1.85A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana}	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A*	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens}	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*	Back alignment and structure

>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A*	Back alignment and structure

>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii}	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A*	Back alignment and structure

>3b5o_A CADD-like protein of unknown function; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; HET: MSE; 1.35A {Nostoc punctiforme} PDB: 3b5p_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		463
d1wwma1		180	a.132.1.3 (A:11-190) Hypothetical protein TTHA0169	2e-18
d2f2ga1		215	a.132.1.3 (A:5-219) Seed maturation protein-relate	1e-17
d2a2ma1		231	a.132.1.3 (A:10-240) Hypothetical protein BT3146 {	7e-17
d2gm8a1		211	a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon	3e-15
d1rtwa_		206	a.132.1.3 (A:) Putative transcriptional activator	4e-15
d1udda_		215	a.132.1.3 (A:) Hypothetical transcriptional regula	7e-14
d1to9a_		225	a.132.1.3 (A:) Transcriptional activator TenA {Bac	3e-13
d1z72a1		217	a.132.1.3 (A:4-220) Putative transcriptional regul	7e-13
d2bdua1		291	c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III	1e-10

>d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]} Length = 180	Back information, alignment and structure


class: All alpha proteins
fold: Heme oxygenase-like
superfamily: Heme oxygenase-like
family: TENA/THI-4
domain: Hypothetical protein TTHA0169 (TT2028)
species: Thermus thermophilus [TaxId: 274]

 Score = 80.7 bits (199), Expect = 2e-18
 Identities = 18/138 (13%), Positives = 33/138 (23%), Gaps = 30/138 (21%)

Query: 2   QEWGTDLAKMATVNSATVKYTEFLLATASGKVEGVKGPGKLATPFEKTKVAAYTLGAMSP 61
              G   +  A V+     Y   L                           AY +     
Sbjct: 69  LLQGASPS--APVHPVRAGYIALLEEMGRLPY-------------------AYRVVFFYF 107

Query: 62  CMRLYAFLGKEFHALLNANEGNHPYTKWIDNYSSESFQASALQNEDLLDKLSVSLTGEEL 121
              L+           +      P+ +   ++ +  FQA     E L   L   L  E +
Sbjct: 108 LNGLFLEAWA------HHVPEEGPWAELSQHWFAPEFQAVLYDLEVLARGLWEDLDPEVV 161

Query: 122 DIIEKLYHQAMKLEVEFF 139
                   + ++ E   +
Sbjct: 162 ---RTYLRRILEAEKATW 176

PyMOL of d1wwma1

>d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 215	Back information, alignment and structure

>d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 231	Back information, alignment and structure

>d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 211	Back information, alignment and structure

>d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 206	Back information, alignment and structure

>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} Length = 215	Back information, alignment and structure

>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]} Length = 225	Back information, alignment and structure

>d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]} Length = 217	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		463
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	99.96
d1to9a_		225	Transcriptional activator TenA {Bacillus subtilis	99.89
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	99.89
d1wwma1		180	Hypothetical protein TTHA0169 (TT2028) {Thermus th	99.89
d1rtwa_		206	Putative transcriptional activator PF1337 {Archaeo	99.89
d2f2ga1		215	Seed maturation protein-related At3g16990 {Thale c	99.88
d2a2ma1		231	Hypothetical protein BT3146 {Bacteroides thetaiota	99.88
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	99.88
d1udda_		215	Hypothetical transcriptional regulator PH1161 {Pyr	99.87
d2gm8a1		211	TenA homolog PAE0170 {Archaeon Pyrobaculum aerophi	99.85
d1z72a1		217	Putative transcriptional regulator SP0716 (SPr0628	99.85
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	99.73
d1rkua_		206	Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta	99.43
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	99.11
d1rcwa_		213	Hypothetical protein CT610 {Chlamydia trachomatis	99.1
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	99.07
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	99.05
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	99.05
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	99.03
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	99.02
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	99.0
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	98.95
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	98.85
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	98.85
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	98.85
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	98.8
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	98.74
d2b8ea1		135	Cation-transporting ATPase {Archaeon Archaeoglobus	98.71
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	98.69
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	98.68
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	98.65
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	98.62
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	98.62
d1wpga2		168	Calcium ATPase, catalytic domain P {Rabbit (Orycto	98.57
d1y8aa1		308	Hypothetical protein AF1437 {Archaeon Archaeoglobu	98.36
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	98.33
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	98.32
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	98.28
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	98.27
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	98.2
d2o2xa1		209	Hypothetical protein Mll2559 {Mesorhizobium loti [	98.06
d1k1ea_		177	Probable phosphatase YrbI {Haemophilus influenzae,	98.02
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	98.02
d1qyia_		380	Hypothetical protein MW1667 (SA1546) {Staphylococc	98.01
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	97.95
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	97.9
d2gmwa1		182	D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc	97.83
d2rbka1		260	Sugar-phosphate phosphatase BT4131 {Bacteroides th	97.68
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	97.59
d1otva_		254	Coenzyme PQQ synthesis protein C, PqqC {Klebsiella	97.58
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	97.58
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	97.54
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	97.52
d2g80a1		225	Protein UTR4 {Baker's yeast (Saccharomyces cerevis	97.31
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	97.26
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	96.63
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	96.38
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	95.94
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	95.14
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	94.83
d1yj5a1		195	5' polynucleotide kinase-3' phosphatase, middle do	93.35
d1q92a_		195	5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo	89.12
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	88.45
d1yv9a1		253	Putative hydrolase EF1188 {Enterococcus faecalis [	88.09
d1wvia_		253	Putative phosphatase SMU.1415c {Streptococcus muta	87.03
d1vjra_		261	Hypothetical protein TM1742 {Thermotoga maritima [	83.89
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	81.59
d1ta0a_		181	Carboxy-terminal domain RNA polymerase II polypept	80.64

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Pyrimidine 5'-nucleotidase (UMPH-1)
domain: Cytosolic 5'-nucleotidase III
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=3.8e-29  Score=244.59  Aligned_cols=228  Identities=18%  Similarity=0.261  Sum_probs=178.0

Q ss_pred             CCCeEEEcccccceecccchhHHHHHHHhhCCCCCCCCCcccccccccccccchhhhhHHHHHHHHHHHHhhcCCCCccc
Q 012437          160 GDRLIIFSDFDLTCTIVDSSAILAEIAIVTAPKSDQNQPENQLGRMSSGELRNTWGLLSKQYTEEYEQCIESFMPSEKVE  239 (463)
Q Consensus       160 ~~~~~ii~DFD~TiT~~DT~~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~i~~~y~~~~~~~~~~~~P~~~~~  239 (463)
                      +++++||+|||+|||++|+.+.++.                     ++|.+......+++.|++...++.++|+|.+.++
T Consensus        35 ~~klqVisDFD~Tit~~~~~~~~~~---------------------s~~~i~~~~~~~~e~~~~~~~~l~~~y~p~E~d~   93 (291)
T d2bdua1          35 AAKLQIITDFDMTLSRFSYNGKRCP---------------------TCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDP   93 (291)
T ss_dssp             GGGEEEEECCTTTTBCSEETTEECC---------------------CHHHHHHTSTTSCHHHHHHHHHHHHHHHHHHTCS
T ss_pred             hhhEEEEecCCCcccccccCCcccc---------------------hhHHHHhhCCCCCHHHHHHHHHHHhhhcccccCC
Confidence            5899999999999999987643211                     2333444445667888899999999999999999


Q ss_pred             CCCHHHHHHHHHhhhHHHHHHHHHHHHhhhcCCCCHHHHHHHhh--cCCCChhHHHHHHHHHHcCCCCCcEEEEccccCH
Q 012437          240 NFNYETLHKALEQLSHFEKRANSRVIESGVLKGINLEDIKKAGE--RLSLQDGCTTFFQKVVKNENLNANVHVLSYCWCG  317 (463)
Q Consensus       240 ~~~~~~~~~~l~~l~e~e~~s~~rv~~~~~f~Gi~~~~i~~~~~--~i~lr~G~~efl~~l~~~g~~~~~~~IvS~g~s~  317 (463)
                      .++.+++.++|   .|||.+++..+.+    .|++++++.+.+.  .+.||||+.+|++.|+++|   ++++|||+|| .
T Consensus        94 ~~s~~ek~~~m---~ew~~~~~~ll~~----~~l~~~~i~~~v~~~~i~Lr~G~~e~~~~l~~~~---i~~~IvSgG~-~  162 (291)
T d2bdua1          94 VLTVEEKFPYM---VEWYTKSHGLLIE----QGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHG---IPVFIFSAGI-G  162 (291)
T ss_dssp             SSCHHHHHHHH---HHHHHHHHHHHHH----HCCBGGGHHHHHHHSCCCBCBTHHHHHHHHHHHT---CCEEEEEEEE-H
T ss_pred             CCCHHHHHHHH---HHHHHHHHHHHHH----cCCCHHHHHHHHHhcCCCcccCHHHHHHHHHHcC---CeEEEEcCCh-H
Confidence            99999999976   4999999999976    4679999999876  4899999999999999999   9999999999 8


Q ss_pred             HHHHHHHHhcCCC--cceEEeeceEEccceeeccccccCCCCcchHHHHHHHHHHhC-CCCCceEEEEcCCcccHHHhHh
Q 012437          318 DLIRASFSSAGLN--ALNVHANEFSFKESISTGEIIEKVESPIDKVQAFNNTLEKYG-TDRKNLSVYIGDSVGDLLCLLE  394 (463)
Q Consensus       318 ~~I~~~l~~~gl~--~~~I~aN~l~~~~g~~tG~~~~~~~~g~~K~~~l~~l~~~~~-~~~~~~vIyIGDs~tDl~~l~~  394 (463)
                      ++|+++++++|++  +++|+||.+.|+++..++.+.+++....+|...+.+...... ...+.++|++|||.||+.|+..
T Consensus       163 ~~ie~vl~~lg~~~~ni~I~sN~l~f~~~~~~~~~~~~~i~~~~K~~~~~~~~~~~~~~~~~~~vI~iGDs~~Dl~Ma~g  242 (291)
T d2bdua1         163 DVLEEVIRQAGVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRMADG  242 (291)
T ss_dssp             HHHHHHHHHTTCCBTTEEEEEECEEECTTSBEEEECSSCCCTTCHHHHHHTTHHHHHHTTTCCEEEEEESSSGGGGTTTT
T ss_pred             HHHHHHHHHcCCCccCceEEeeEEEEeCCeeEeeccCCccccccCcchhhhhHHHHhccCCcCcEEEEeCCHhHHHHHhC
Confidence            9999999998863  568999999999877777777777677777655443322111 1125789999999999999975


Q ss_pred             c---C--eeEEEc-CC--hhHHHHhhhhCceee
Q 012437          395 A---D--IGIVIG-SS--SSLRRVGSQFGVTFI  419 (463)
Q Consensus       395 A---d--igiv~~-~~--~~L~~~~~~~gi~~~  419 (463)
                      +   +  ++|.|- .+  ..|..|++.+.|-++
T Consensus       243 ~~~~~~~l~igFL~~~~ee~l~~y~~~~DIVl~  275 (291)
T d2bdua1         243 VANVEHILKIGYLNDRVDELLEKYMDSYDIVLV  275 (291)
T ss_dssp             CSCCSEEEEEEEECSCHHHHHHHHHHHSSEEEE
T ss_pred             CccccceeeeehhHhhHHHHHHHHHhcCCEEEe
Confidence            3   2  233342 22  468888877766544

PyMOL of d2bdua1

>d1to9a_ a.132.1.3 (A:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rtwa_ a.132.1.3 (A:) Putative transcriptional activator PF1337 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2a2ma1 a.132.1.3 (A:10-240) Hypothetical protein BT3146 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1z72a1 a.132.1.3 (A:4-220) Putative transcriptional regulator SP0716 (SPr0628) {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}	Back information, alignment and structure

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1otva_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure