Citrus Sinensis ID: 012484

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--
MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
ccccccHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcccHHHHcccccccccccEEEEccccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEcccEEEEccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHcccccccccEEccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccEEEcccccHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc
ccccccHHHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHccccccEEEEEccccEEHccccccEEEcHcHccHHHHHHHHHHHHHHcccccEEEEccccHHHHHccHHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccEEEEEEEEEcccEEEcccccccccccccccccHHHHHHHHHcccccccHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccEEEEcccHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
maepktkydrQLRIWGEQGQAALEKASVCllncgptgsetLKNLVLggigsitvidgskvevgdlgnnfmldescvgesKAKSVCAFLQELNDAVKAKFIEEYPEaliemnppffsQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEhtvveskpdhflddlrlnnpwpelRKFAEtfdlnvpdpvahkhtPYVVILIKMSEewtnshggslpstrEEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLqsadssffpfsiaigrpwiFAEADCLAIEQRVRNNLkklgrepesiSKATIKSFCRNARKLKVCRYRlledefsnpsvpdiqkyltdedysvAMGFYILLRAVDRFAAnynnypgefdgpmdediSRLKTTAVSVLNdlgcngstLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
maepktkydrqlrIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTvveskpdhflddlrlnNPWPELRKFAETfdlnvpdpvaHKHTPYVVILIKMSEEWtnshggslpstreeKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNnlkklgrepesiskatiksfcrnaRKLKVCRYRlledefsnpsvpdiqKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTreekrefkellkskMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
**********QLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEW*************************MVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKL*******SKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFL*
***PKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLND****GSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
********DRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEW****************EFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
****KTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query462 2.2.26 [Sep-21-2011]
P42744540 NEDD8-activating enzyme E yes no 0.993 0.85 0.681 0.0
Q7SXP2533 NEDD8-activating enzyme E yes no 0.978 0.848 0.382 6e-96
Q6NTW6533 NEDD8-activating enzyme E N/A no 0.974 0.844 0.369 3e-95
Q54JM3520 NEDD8-activating enzyme E yes no 0.969 0.861 0.389 4e-95
Q8VBW6534 NEDD8-activating enzyme E yes no 0.987 0.853 0.382 2e-94
Q5ZIE6535 NEDD8-activating enzyme E yes no 0.987 0.852 0.376 4e-94
Q9Z1A5534 NEDD8-activating enzyme E yes no 0.974 0.842 0.377 1e-93
Q13564534 NEDD8-activating enzyme E yes no 0.969 0.838 0.369 4e-93
Q4R3L6510 NEDD8-activating enzyme E N/A no 0.930 0.843 0.348 2e-84
Q9VTE9524 NEDD8-activating enzyme E yes no 0.958 0.845 0.340 2e-74
>sp|P42744|ULA1_ARATH NEDD8-activating enzyme E1 regulatory subunit OS=Arabidopsis thaliana GN=AXR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/499 (68%), Positives = 398/499 (79%), Gaps = 40/499 (8%)

Query: 1   MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKV 60
           M EPKTKYDRQLRIWGE GQAALE+AS+CLLNCGPTGSE LKNLVLGG+GSITV+DGSKV
Sbjct: 17  MVEPKTKYDRQLRIWGEVGQAALEEASICLLNCGPTGSEALKNLVLGGVGSITVVDGSKV 76

Query: 61  EVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTL 120
           + GDLGNNFM+D   VG+SKAKSVCAFLQELND+V AKFIEE P+ LI  NP FFSQFTL
Sbjct: 77  QFGDLGNNFMVDAKSVGQSKAKSVCAFLQELNDSVNAKFIEENPDTLITTNPSFFSQFTL 136

Query: 121 VVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRL 180
           V+ATQL E+ M+KLDRICR+ANV L+  RSYGL GFVRISVKEH +++SKPDHFLDDLRL
Sbjct: 137 VIATQLVEDSMLKLDRICRDANVKLVLVRSYGLAGFVRISVKEHPIIDSKPDHFLDDLRL 196

Query: 181 NNPWPELRKFAETFDLNVPDP-VAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFK 239
           NNPWPEL+ F ET DLNV +P  AHKH PYVVIL+KM+EEW  SH G+LPSTREEK+EFK
Sbjct: 197 NNPWPELKSFVETIDLNVSEPAAAHKHIPYVVILVKMAEEWAQSHSGNLPSTREEKKEFK 256

Query: 240 ELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQ------SADSSFFPFSIAIG 293
           +L+KSKMV+ DEDNYKEAIEA+FKVFAP GI   + K++       +++SS F   +A  
Sbjct: 257 DLVKSKMVSTDEDNYKEAIEAAFKVFAPRGISSEVQKLINDSCAEVNSNSSAFWVMVAAL 316

Query: 294 RPWIF---------------------------------AEADCLAIEQRVRNNLKKLGRE 320
           + ++                                  AEAD L IE+RV+N LKK+GR+
Sbjct: 317 KEFVLNEGGGEAPLEGSIPDMTSSTEHYINLQKIYLAKAEADFLVIEERVKNILKKIGRD 376

Query: 321 PESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRA 380
           P SI K TIKSFC+NARKLK+CRYR++EDEF NPSV +IQKYL DEDYS AMGFYILLRA
Sbjct: 377 PSSIPKPTIKSFCKNARKLKLCRYRMVEDEFRNPSVTEIQKYLADEDYSGAMGFYILLRA 436

Query: 381 VDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAEL 440
            DRFAANYN +PG+FDG MDEDISRLKTTA+S+L DLGCNGS L +DLI+EMCRFGA+E+
Sbjct: 437 ADRFAANYNKFPGQFDGGMDEDISRLKTTALSLLTDLGCNGSVLPDDLIHEMCRFGASEI 496

Query: 441 HAVAAFIGGVASQEVIKVV 459
           H V+AF+GG+ASQEVIK+V
Sbjct: 497 HVVSAFVGGIASQEVIKLV 515
Regulatory subunit of the dimeric ECR1-AXR1 E1 enzyme. E1 activates NEDD8/RUB1 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-ECR1 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of RCE1. Plays an important role in auxin response.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7SXP2|ULA1_DANRE NEDD8-activating enzyme E1 regulatory subunit OS=Danio rerio GN=nae1 PE=2 SV=2 Back     alignment and function description
>sp|Q6NTW6|ULA1_XENLA NEDD8-activating enzyme E1 regulatory subunit OS=Xenopus laevis GN=nae1 PE=2 SV=1 Back     alignment and function description
>sp|Q54JM3|ULA1_DICDI NEDD8-activating enzyme E1 regulatory subunit OS=Dictyostelium discoideum GN=nae1 PE=3 SV=1 Back     alignment and function description
>sp|Q8VBW6|ULA1_MOUSE NEDD8-activating enzyme E1 regulatory subunit OS=Mus musculus GN=Nae1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIE6|ULA1_CHICK NEDD8-activating enzyme E1 regulatory subunit OS=Gallus gallus GN=NAE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1A5|ULA1_RAT NEDD8-activating enzyme E1 regulatory subunit OS=Rattus norvegicus GN=Nae1 PE=1 SV=1 Back     alignment and function description
>sp|Q13564|ULA1_HUMAN NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R3L6|ULA1_MACFA NEDD8-activating enzyme E1 regulatory subunit OS=Macaca fascicularis GN=NAE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VTE9|ULA1_DROME NEDD8-activating enzyme E1 regulatory subunit OS=Drosophila melanogaster GN=APP-BP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
225447007523 PREDICTED: NEDD8-activating enzyme E1 re 0.993 0.877 0.757 0.0
255566401523 NEDD8-activating enzyme E1 regulatory su 0.993 0.877 0.744 0.0
224128954521 predicted protein [Populus trichocarpa] 0.989 0.877 0.732 0.0
449468362523 PREDICTED: NEDD8-activating enzyme E1 re 0.993 0.877 0.716 0.0
388512807523 unknown [Lotus japonicus] 0.993 0.877 0.712 0.0
356517638523 PREDICTED: NEDD8-activating enzyme E1 re 0.993 0.877 0.708 0.0
356542822523 PREDICTED: NEDD8-activating enzyme E1 re 0.993 0.877 0.696 0.0
388493680523 unknown [Medicago truncatula] 0.993 0.877 0.688 0.0
15220442540 amyloid beta precursor protein binding p 0.993 0.85 0.681 0.0
297848782540 hypothetical protein ARALYDRAFT_470511 [ 0.993 0.85 0.677 0.0
>gi|225447007|ref|XP_002267415.1| PREDICTED: NEDD8-activating enzyme E1 regulatory subunit [Vitis vinifera] gi|297739147|emb|CBI28798.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/498 (75%), Positives = 417/498 (83%), Gaps = 39/498 (7%)

Query: 1   MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKV 60
           MAEPKTKYDRQLRIWGEQGQ ALEKAS+CLLNCGPTGSETLKNLVLGGIGSITVIDGSKV
Sbjct: 1   MAEPKTKYDRQLRIWGEQGQEALEKASICLLNCGPTGSETLKNLVLGGIGSITVIDGSKV 60

Query: 61  EVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTL 120
           E+GDLGNNFM+DES +G+SKAK VCA LQELNDAVKAKFIEEYPEALIE NP FFSQFTL
Sbjct: 61  ELGDLGNNFMVDESSIGQSKAKCVCASLQELNDAVKAKFIEEYPEALIETNPSFFSQFTL 120

Query: 121 VVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRL 180
           V+ATQL E+ MIKLDRICREANVMLIFARSYGLTGFVRIS+KEH V+ESKPDHFLDDLRL
Sbjct: 121 VIATQLVEDSMIKLDRICREANVMLIFARSYGLTGFVRISLKEHAVIESKPDHFLDDLRL 180

Query: 181 NNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKE 240
           NNPWPELR FAET DLNV DPV HKHTPYVVIL+KM+E+WT SH G LPSTREEK+EFK+
Sbjct: 181 NNPWPELRGFAETIDLNVSDPVVHKHTPYVVILVKMAEQWTKSHDGKLPSTREEKKEFKD 240

Query: 241 LLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSA----DSSFFPFSIAIGRPW 296
           LLKSKM+A+DEDNYKEAIEASFKVFAP GI   L +++  +    DSS   F + +    
Sbjct: 241 LLKSKMIAMDEDNYKEAIEASFKVFAPRGISSNLQQIIDDSRADVDSSSSNFWVMVASLK 300

Query: 297 IF-----------------------------------AEADCLAIEQRVRNNLKKLGREP 321
            F                                   AEAD L IEQRVRN LKK+GR+P
Sbjct: 301 EFIANEGGGEAPLEGSIPDMTSSTEHYVNLQKIYQAKAEADFLVIEQRVRNILKKIGRDP 360

Query: 322 ESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAV 381
           +SISKA IKSF +NARKL VCRYRLLE+EF++P  P++QKYLTDEDYSVA+GFYILLRAV
Sbjct: 361 DSISKANIKSFSKNARKLTVCRYRLLEEEFNSPIQPELQKYLTDEDYSVAVGFYILLRAV 420

Query: 382 DRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELH 441
           DRFAANYN++PG+FDG MDEDISRLKTTAVS+L+DLGCNGSTLTEDLINEMCRFGAAELH
Sbjct: 421 DRFAANYNSFPGQFDGGMDEDISRLKTTAVSLLSDLGCNGSTLTEDLINEMCRFGAAELH 480

Query: 442 AVAAFIGGVASQEVIKVV 459
           AVAAFIGG+ASQEVIK++
Sbjct: 481 AVAAFIGGIASQEVIKLI 498

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255566401|ref|XP_002524186.1| NEDD8-activating enzyme E1 regulatory subunit, putative [Ricinus communis] gi|223536555|gb|EEF38201.1| NEDD8-activating enzyme E1 regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224128954|ref|XP_002320462.1| predicted protein [Populus trichocarpa] gi|222861235|gb|EEE98777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449468362|ref|XP_004151890.1| PREDICTED: NEDD8-activating enzyme E1 regulatory subunit-like [Cucumis sativus] gi|449523113|ref|XP_004168569.1| PREDICTED: NEDD8-activating enzyme E1 regulatory subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388512807|gb|AFK44465.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356517638|ref|XP_003527494.1| PREDICTED: NEDD8-activating enzyme E1 regulatory subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|356542822|ref|XP_003539864.1| PREDICTED: NEDD8-activating enzyme E1 regulatory subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|388493680|gb|AFK34906.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|15220442|ref|NP_172010.1| amyloid beta precursor protein binding protein 1 [Arabidopsis thaliana] gi|1168609|sp|P42744.1|ULA1_ARATH RecName: Full=NEDD8-activating enzyme E1 regulatory subunit; AltName: Full=Auxin-resistance protein AXR1 gi|304104|gb|AAB59348.1| ubiquitin-activating enzyme E1 [Arabidopsis thaliana] gi|2388579|gb|AAB71460.1| Match to Arabidopsis AXR1 (gb|ATHAXR1122) [Arabidopsis thaliana] gi|15215702|gb|AAK91397.1| At1g05180/YUP8H12_21 [Arabidopsis thaliana] gi|332189679|gb|AEE27800.1| amyloid beta precursor protein binding protein 1 [Arabidopsis thaliana] gi|448755|prf||1917337A ubiquitin-activating enzyme E1 Back     alignment and taxonomy information
>gi|297848782|ref|XP_002892272.1| hypothetical protein ARALYDRAFT_470511 [Arabidopsis lyrata subsp. lyrata] gi|297338114|gb|EFH68531.1| hypothetical protein ARALYDRAFT_470511 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
TAIR|locus:2207220540 AXR1 "AUXIN RESISTANT 1" [Arab 0.608 0.520 0.716 1.3e-176
TAIR|locus:2062571523 AXL "AXR1-like" [Arabidopsis t 0.599 0.529 0.693 2.5e-164
UNIPROTKB|E1B8X4534 NAE1 "Uncharacterized protein" 0.699 0.604 0.389 6.3e-89
UNIPROTKB|F1P442535 NAE1 "NEDD8-activating enzyme 0.547 0.472 0.451 4.4e-88
UNIPROTKB|E2RE24534 NAE1 "Uncharacterized protein" 0.705 0.610 0.386 5.6e-88
MGI|MGI:2384561534 Nae1 "NEDD8 activating enzyme 0.699 0.604 0.389 1.2e-87
UNIPROTKB|Q5ZIE6535 NAE1 "NEDD8-activating enzyme 0.547 0.472 0.447 2.4e-87
ZFIN|ZDB-GENE-040426-1552533 nae1 "nedd8 activating enzyme 0.699 0.606 0.370 2.4e-87
UNIPROTKB|Q13564534 NAE1 "NEDD8-activating enzyme 0.686 0.593 0.393 5e-87
RGD|619945534 Nae1 "NEDD8 activating enzyme 0.686 0.593 0.387 1e-86
TAIR|locus:2207220 AXR1 "AUXIN RESISTANT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1076 (383.8 bits), Expect = 1.3e-176, Sum P(2) = 1.3e-176
 Identities = 202/282 (71%), Positives = 230/282 (81%)

Query:     1 MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKV 60
             M EPKTKYDRQLRIWGE GQAALE+AS+CLLNCGPTGSE LKNLVLGG+GSITV+DGSKV
Sbjct:    17 MVEPKTKYDRQLRIWGEVGQAALEEASICLLNCGPTGSEALKNLVLGGVGSITVVDGSKV 76

Query:    61 EVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTL 120
             + GDLGNNFM+D   VG+SKAKSVCAFLQELND+V AKFIEE P+ LI  NP FFSQFTL
Sbjct:    77 QFGDLGNNFMVDAKSVGQSKAKSVCAFLQELNDSVNAKFIEENPDTLITTNPSFFSQFTL 136

Query:   121 VVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRL 180
             V+ATQL E+ M+KLDRICR+ANV L+  RSYGL GFVRISVKEH +++SKPDHFLDDLRL
Sbjct:   137 VIATQLVEDSMLKLDRICRDANVKLVLVRSYGLAGFVRISVKEHPIIDSKPDHFLDDLRL 196

Query:   181 NNPWPELRKFAETFDLNVPDPVA-HKHTPYVVILIKMSEEWTNSHGGSLPSTXXXXXXXX 239
             NNPWPEL+ F ET DLNV +P A HKH PYVVIL+KM+EEW  SH G+LPST        
Sbjct:   197 NNPWPELKSFVETIDLNVSEPAAAHKHIPYVVILVKMAEEWAQSHSGNLPSTREEKKEFK 256

Query:   240 XXXXXXMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSA 281
                   MV+ DEDNYKEAIEA+FKVFAP GI   + K++  +
Sbjct:   257 DLVKSKMVSTDEDNYKEAIEAAFKVFAPRGISSEVQKLINDS 298
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0008641 "small protein activating enzyme activity" evidence=ISS;IDA
GO:0009965 "leaf morphogenesis" evidence=IGI
GO:0010252 "auxin homeostasis" evidence=NAS
GO:0016567 "protein ubiquitination" evidence=IGI;RCA
GO:0006281 "DNA repair" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=IGI
GO:0009734 "auxin mediated signaling pathway" evidence=IMP
GO:0009414 "response to water deprivation" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
TAIR|locus:2062571 AXL "AXR1-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1B8X4 NAE1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P442 NAE1 "NEDD8-activating enzyme E1 regulatory subunit" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE24 NAE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2384561 Nae1 "NEDD8 activating enzyme E1 subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIE6 NAE1 "NEDD8-activating enzyme E1 regulatory subunit" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1552 nae1 "nedd8 activating enzyme E1 subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q13564 NAE1 "NEDD8-activating enzyme E1 regulatory subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619945 Nae1 "NEDD8 activating enzyme E1 subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZIE6ULA1_CHICKNo assigned EC number0.37620.98700.8523yesno
Q8VBW6ULA1_MOUSENo assigned EC number0.38280.98700.8539yesno
Q7SXP2ULA1_DANRENo assigned EC number0.38250.97830.8480yesno
Q13564ULA1_HUMANNo assigned EC number0.36970.96960.8389yesno
P42744ULA1_ARATHNo assigned EC number0.68130.99350.85yesno
Q9Z1A5ULA1_RATNo assigned EC number0.37720.97400.8426yesno
Q54JM3ULA1_DICDINo assigned EC number0.38900.96960.8615yesno
Q9VTE9ULA1_DROMENo assigned EC number0.34050.95880.8454yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 1e-158
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 1e-43
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 7e-38
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 3e-23
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 9e-23
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 8e-20
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 1e-17
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 2e-16
pfam00899134 pfam00899, ThiF, ThiF family 1e-15
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 3e-10
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 4e-10
PTZ00245287 PTZ00245, PTZ00245, ubiquitin activating enzyme; P 2e-09
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 4e-09
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 2e-08
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-08
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 2e-08
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 2e-08
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-07
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 4e-07
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 1e-06
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 2e-06
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 4e-06
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 1e-05
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 8e-05
TIGR01408 1008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 1e-04
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 7e-04
PRK15116268 PRK15116, PRK15116, sulfur acceptor protein CsdL; 7e-04
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 0.002
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information 
 Score =  455 bits (1173), Expect = e-158
 Identities = 181/392 (46%), Positives = 242/392 (61%), Gaps = 58/392 (14%)

Query: 6   TKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDL 65
            KYDRQLR+WGE GQAALE A VCLLN   TG+E LKNLVL GIGS T++DGSKV+  DL
Sbjct: 1   QKYDRQLRLWGEHGQAALESAHVCLLNATATGTEILKNLVLPGIGSFTIVDGSKVDEEDL 60

Query: 66  GNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQ 125
           GNNF LD S +G+S+A++ C  LQELN  V    +EE PEAL++ +P FFSQFT+V+AT 
Sbjct: 61  GNNFFLDASSLGKSRAEATCELLQELNPDVNGSAVEESPEALLDNDPSFFSQFTVVIATN 120

Query: 126 LGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWP 185
           L E  +++L  +   AN+ L++ RSYGL G++RI +KEHT+VES PD+ L+DLRL+NP+P
Sbjct: 121 LPESTLLRLADVLWSANIPLLYVRSYGLYGYIRIQLKEHTIVESHPDNALEDLRLDNPFP 180

Query: 186 ELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSK 245
           ELR+ A++ DL+  DP  H HTPY+VILIK  E+W ++H G LPST +EK+EF++L++S 
Sbjct: 181 ELREHADSIDLDDMDPAEHSHTPYIVILIKYLEKWRSAHNGQLPSTYKEKKEFRDLVRSL 240

Query: 246 MVAI-DEDNYKEAIEASFKVFAPPGIKLALSKVLQ-------SADSSFFPFSIAIGRPWI 297
           M +  DE+N++EAI+A  K      I  ++ ++         ++ SS F         WI
Sbjct: 241 MRSNEDEENFEEAIKAVNKALNRTKIPSSVEEIFNDDRCENLTSQSSSF---------WI 291

Query: 298 FAEA-----------------------------------------DCLAIEQRVRNNLKK 316
            A A                                         D   +E+ VR  LK 
Sbjct: 292 MARALKEFVAEENGLLPLPGTLPDMTADTEKYIKLQNIYREKAEKDAAEVEKYVREILKS 351

Query: 317 LGREPESISKATIKSFCRNARKLKVCRYRLLE 348
           LGR P+SIS   IK FC+NA  L+V R R LE
Sbjct: 352 LGRSPDSISDKEIKLFCKNAAFLRVIRGRSLE 383

APPBP1 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. ABPP1 contains part of the adenylation domain. Length = 425
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 462
KOG2016523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 100.0
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 100.0
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 100.0
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK08223287 hypothetical protein; Validated 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
PRK08328231 hypothetical protein; Provisional 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK07411390 hypothetical protein; Validated 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.98
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.97
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 99.97
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.97
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.97
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.97
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 99.97
PRK14852 989 hypothetical protein; Provisional 99.96
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.96
PRK14851 679 hypothetical protein; Provisional 99.96
PTZ00245287 ubiquitin activating enzyme; Provisional 99.96
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.96
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 99.96
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.95
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.95
KOG2013 603 consensus SMT3/SUMO-activating complex, catalytic 99.94
PRK07877 722 hypothetical protein; Provisional 99.94
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.93
KOG2015422 consensus NEDD8-activating complex, catalytic comp 99.93
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.92
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.92
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.92
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.92
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.92
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.9
PRK06153393 hypothetical protein; Provisional 99.87
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.85
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.81
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.69
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 99.45
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 99.35
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 98.57
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.72
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.65
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.55
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.55
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.49
PRK06719157 precorrin-2 dehydrogenase; Validated 97.28
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.19
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.08
PRK04148134 hypothetical protein; Provisional 96.63
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.59
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.43
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.42
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.4
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.37
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.3
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.25
PRK10637457 cysG siroheme synthase; Provisional 96.16
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.06
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 96.02
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.96
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.93
PRK13940414 glutamyl-tRNA reductase; Provisional 95.89
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.81
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.78
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.68
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.43
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.42
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.41
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.31
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.24
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.21
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.06
PLN00203519 glutamyl-tRNA reductase 94.99
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.92
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 94.91
PRK09496453 trkA potassium transporter peripheral membrane com 94.7
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.51
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 94.49
PRK09496453 trkA potassium transporter peripheral membrane com 94.48
PLN02602350 lactate dehydrogenase 94.24
PTZ00082321 L-lactate dehydrogenase; Provisional 94.2
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 94.14
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.01
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.98
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 93.97
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 93.97
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 93.79
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 93.75
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 93.7
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 93.63
PRK00811283 spermidine synthase; Provisional 93.5
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.39
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 93.33
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 93.32
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.23
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 93.16
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 93.04
PRK03562621 glutathione-regulated potassium-efflux system prot 93.04
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.98
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.89
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.87
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 92.87
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 92.83
PRK06141314 ornithine cyclodeaminase; Validated 92.72
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 92.64
PRK07502307 cyclohexadienyl dehydrogenase; Validated 92.6
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 92.56
PRK03659601 glutathione-regulated potassium-efflux system prot 92.39
PRK08618325 ornithine cyclodeaminase; Validated 92.38
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.28
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 92.23
PRK10537393 voltage-gated potassium channel; Provisional 92.23
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 92.23
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 92.16
PRK07417279 arogenate dehydrogenase; Reviewed 92.13
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.1
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 91.98
PRK07340304 ornithine cyclodeaminase; Validated 91.91
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.89
PRK00048257 dihydrodipicolinate reductase; Provisional 91.81
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.8
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 91.74
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 91.69
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 91.65
PRK06197306 short chain dehydrogenase; Provisional 91.64
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 91.6
PRK07680273 late competence protein ComER; Validated 91.51
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 91.36
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 91.33
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 91.29
PRK00676338 hemA glutamyl-tRNA reductase; Validated 91.28
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 91.17
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 91.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.99
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 90.98
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 90.95
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 90.82
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 90.8
PLN02206442 UDP-glucuronate decarboxylase 90.8
PRK14982340 acyl-ACP reductase; Provisional 90.73
PRK11908347 NAD-dependent epimerase/dehydratase family protein 90.73
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 90.68
PRK12550272 shikimate 5-dehydrogenase; Reviewed 90.67
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 90.66
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 90.59
PTZ00117319 malate dehydrogenase; Provisional 90.57
PRK10669558 putative cation:proton antiport protein; Provision 90.56
PTZ00431260 pyrroline carboxylate reductase; Provisional 90.39
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.35
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 90.28
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.27
PTZ00325321 malate dehydrogenase; Provisional 90.26
PRK09330384 cell division protein FtsZ; Validated 90.19
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 90.15
PRK13403335 ketol-acid reductoisomerase; Provisional 90.14
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.12
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 90.07
PRK08229341 2-dehydropantoate 2-reductase; Provisional 90.07
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.02
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 90.02
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 89.95
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 89.94
PRK08291330 ectoine utilization protein EutC; Validated 89.92
PRK12921305 2-dehydropantoate 2-reductase; Provisional 89.9
PRK13304265 L-aspartate dehydrogenase; Reviewed 89.89
PRK05854313 short chain dehydrogenase; Provisional 89.88
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 89.85
PRK05442326 malate dehydrogenase; Provisional 89.83
PLN02928347 oxidoreductase family protein 89.69
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 89.67
PLN00016378 RNA-binding protein; Provisional 89.65
PRK13243333 glyoxylate reductase; Reviewed 89.6
PRK15059292 tartronate semialdehyde reductase; Provisional 89.58
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.56
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 89.54
PRK06436303 glycerate dehydrogenase; Provisional 89.49
PRK06545359 prephenate dehydrogenase; Validated 89.43
PRK13018378 cell division protein FtsZ; Provisional 89.37
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the 89.36
PLN02166436 dTDP-glucose 4,6-dehydratase 89.27
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 89.26
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 89.17
PLN02427386 UDP-apiose/xylose synthase 88.98
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 88.97
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 88.92
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 88.62
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.62
PRK09242257 tropinone reductase; Provisional 88.6
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 88.45
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 88.43
PRK01581374 speE spermidine synthase; Validated 88.33
PLN02366308 spermidine synthase 88.23
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.19
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 88.16
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 88.1
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.09
PRK07063260 short chain dehydrogenase; Provisional 88.04
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 88.01
PRK13302271 putative L-aspartate dehydrogenase; Provisional 88.01
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.0
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 87.8
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.78
PRK08818370 prephenate dehydrogenase; Provisional 87.69
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 87.56
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 87.46
PLN03209576 translocon at the inner envelope of chloroplast su 87.44
PLN02240352 UDP-glucose 4-epimerase 87.34
PLN02688266 pyrroline-5-carboxylate reductase 87.21
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.19
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 87.19
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 87.18
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 87.11
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.09
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 87.07
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.06
PRK08306296 dipicolinate synthase subunit A; Reviewed 87.04
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.86
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 86.8
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.78
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 86.73
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 86.66
PRK05479330 ketol-acid reductoisomerase; Provisional 86.63
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 86.5
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 86.49
PRK12480330 D-lactate dehydrogenase; Provisional 86.49
PRK11259376 solA N-methyltryptophan oxidase; Provisional 86.39
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 86.27
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.23
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 86.22
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 86.12
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 86.04
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 85.97
PRK07062265 short chain dehydrogenase; Provisional 85.95
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 85.91
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.88
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 85.85
PRK13301267 putative L-aspartate dehydrogenase; Provisional 85.82
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 85.82
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 85.79
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 85.77
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 85.76
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 85.75
PRK06487317 glycerate dehydrogenase; Provisional 85.66
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 85.63
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 85.53
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 85.49
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 85.47
PRK06932314 glycerate dehydrogenase; Provisional 85.47
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 85.47
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 85.41
COG0421282 SpeE Spermidine synthase [Amino acid transport and 85.39
PRK06223307 malate dehydrogenase; Reviewed 85.22
PRK12367245 short chain dehydrogenase; Provisional 85.22
PRK08655437 prephenate dehydrogenase; Provisional 85.22
PTZ00075476 Adenosylhomocysteinase; Provisional 85.11
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 84.97
PRK06046326 alanine dehydrogenase; Validated 84.89
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 84.85
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 84.85
PRK07831262 short chain dehydrogenase; Provisional 84.75
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 84.75
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 84.74
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 84.73
TIGR00036266 dapB dihydrodipicolinate reductase. 84.72
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 84.68
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 84.61
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 84.59
PLN00112444 malate dehydrogenase (NADP); Provisional 84.52
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 84.49
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 84.46
PRK07478254 short chain dehydrogenase; Provisional 84.39
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 84.33
PRK08374336 homoserine dehydrogenase; Provisional 84.33
KOG0409327 consensus Predicted dehydrogenase [General functio 84.28
COG0281432 SfcA Malic enzyme [Energy production and conversio 84.27
PRK15076431 alpha-galactosidase; Provisional 84.1
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 84.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.95
PRK07574385 formate dehydrogenase; Provisional 83.9
PRK06199379 ornithine cyclodeaminase; Validated 83.87
PRK06139330 short chain dehydrogenase; Provisional 83.83
PRK06270341 homoserine dehydrogenase; Provisional 83.8
PRK05867253 short chain dehydrogenase; Provisional 83.78
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 83.68
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 83.68
PF1008797 DUF2325: Uncharacterized protein conserved in bact 83.59
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 83.56
PRK06184502 hypothetical protein; Provisional 83.5
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 83.38
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 83.34
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 83.24
PRK06249313 2-dehydropantoate 2-reductase; Provisional 83.23
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 83.2
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 83.14
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 83.08
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 83.04
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 82.93
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.93
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 82.91
PRK05225487 ketol-acid reductoisomerase; Validated 82.81
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 82.77
PRK09126392 hypothetical protein; Provisional 82.68
PRK05866293 short chain dehydrogenase; Provisional 82.62
PRK08589272 short chain dehydrogenase; Validated 82.59
PLN02494477 adenosylhomocysteinase 82.52
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 82.51
PRK12939250 short chain dehydrogenase; Provisional 82.46
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 82.41
PLN02572442 UDP-sulfoquinovose synthase 82.4
PLN02172461 flavin-containing monooxygenase FMO GS-OX 82.38
PRK14031444 glutamate dehydrogenase; Provisional 82.28
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 82.25
PRK08264238 short chain dehydrogenase; Validated 82.2
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.15
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 82.09
PF10100429 DUF2338: Uncharacterized protein conserved in bact 82.02
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 82.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 81.97
PRK08300302 acetaldehyde dehydrogenase; Validated 81.95
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.95
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 81.94
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 81.83
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 81.77
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 81.77
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 81.73
cd02191303 FtsZ FtsZ is a GTPase that is similar to the eukar 81.64
PRK08251248 short chain dehydrogenase; Provisional 81.6
PRK07236386 hypothetical protein; Provisional 81.59
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 81.51
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 81.23
PRK06185407 hypothetical protein; Provisional 81.23
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 81.05
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.98
PRK00536262 speE spermidine synthase; Provisional 80.97
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 80.94
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 80.88
PTZ00317559 NADP-dependent malic enzyme; Provisional 80.83
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 80.82
PRK13529563 malate dehydrogenase; Provisional 80.79
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 80.75
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 80.74
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 80.73
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 80.72
PLN02256304 arogenate dehydrogenase 80.67
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 80.67
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 80.67
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 80.65
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 80.61
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 80.55
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 80.53
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 80.5
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 80.48
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 80.32
PRK14030445 glutamate dehydrogenase; Provisional 80.31
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 80.26
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 80.17
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 80.02
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-105  Score=779.04  Aligned_cols=457  Identities=57%  Similarity=0.969  Sum_probs=440.5

Q ss_pred             CCCccchhhhHHhhcCHHHHHHHhcCcEEEEcCChhHHHHHHHHHHhCCCeEEEEeCCcccccCCCcccccccccccccH
Q 012484            1 MAEPKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESK   80 (462)
Q Consensus         1 ~~~~~~rYdRQl~l~G~~~q~~L~~~~VlivG~g~lG~eiaknLvl~Gv~~itlvD~d~v~~~nl~r~f~~~~~dvG~~K   80 (462)
                      |++++.|||||+|+||++||..|..++||++|||++|+|++||||++|||+||++|+..|+.+|++.|||+..+++|++|
T Consensus         3 ~~~~~~kYDRQlRlwge~gQ~~le~a~vCll~~~~~g~e~lKnLvl~Gigs~tvvd~~~v~~~d~g~nF~~~~~~~Gksr   82 (523)
T KOG2016|consen    3 MSEPKTKYDRQLRLWGEEGQAALESASVCLLNATPLGSEALKNLVLPGIGSFTVVDGSKVEQGDLGNNFFLDAKSIGKSR   82 (523)
T ss_pred             ccchhhHHHHHHHHHHHHhHhhhhhceEEEecCChhHHHHHHhhcccccccEEEEecceeeecchhhHHHHHHHhhchhH
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCeEEEEecChhhhhcCCcCCCCCCcEEEEcCCChHHHHHHHHHHHHcCceEEEEeeccceEEEEEE
Q 012484           81 AKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRIS  160 (462)
Q Consensus        81 a~~~~~~l~~lNp~v~v~~~~~~~~~~~~~~~~~~~~~dvVi~~~~~~~~~~~l~~~~~~~~ip~i~~~~~G~~G~v~~~  160 (462)
                      |+++++.|+++||.|..+++.++++.+...+++||.+|++||++..+.....++.++||.+++|++.+.++|+.|++++.
T Consensus        83 A~a~~e~LqeLN~~V~~~~vee~p~~Li~~~p~ff~qFtvViatnl~E~~~~kl~~~l~~~~vpll~~rs~Gl~G~iRI~  162 (523)
T KOG2016|consen   83 AEATLEFLQELNPSVSGSFVEESPDFLIDNDPSFFSQFTVVIATNLNEQTLLKLAEILREANVPLLLTRSYGLAGTIRIS  162 (523)
T ss_pred             HHHHHHHHHHhChhhhcCccccChhhhhhcCchhhheeeeeeccccchhhhhhhHHHHHhcCCceEEEeeecceEEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCceeeecCCCCCCCCcccCCCCchhhhhhhcccCCCCCCCccCCCcHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHH
Q 012484          161 VKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKE  240 (462)
Q Consensus       161 ~~~h~~~~~~~~~~~~~lrl~~p~p~l~~~~~~~d~~~~~~~~~~~~P~~v~l~~~~~~~~~~~~g~~p~~~~~~~~f~~  240 (462)
                      +.+|+++++|||+..+||||++|||+|.+|++++|++.|++..|+|+||+++++|++++|.+.|.|+.|++++|+.+|++
T Consensus       163 ikEH~iieshPD~~~~DLRL~nPwpeLi~~v~s~dLd~m~~a~~shiPyivll~K~l~~w~~~~n~~~p~t~~ekk~fkd  242 (523)
T KOG2016|consen  163 IKEHTIIESHPDNPLDDLRLDNPWPELIEYVDSTDLDVMDPAAHSHIPYIVLLVKYLEKWAKQHNGNLPSTYDEKKEFKD  242 (523)
T ss_pred             eeeccccccCCCCcccccccCCCcHHHHHHHhhcCccccchhhhcCCCcHHHHHHHHHHHHHhhcCCCCccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcccCCCCCCHHHHHHHhhcccCCCCccHHHHHHHh--------cCCCChhHHHHHhh-------------------
Q 012484          241 LLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQ--------SADSSFFPFSIAIG-------------------  293 (462)
Q Consensus       241 ~~~~~~~~~~~~nf~EA~~~~~~~~~~~~i~~~i~~~~~--------~~~~~f~~l~~al~-------------------  293 (462)
                      ++..++...|++||+||+++++++|.++.||++++++++        ..+..||++++||+                   
T Consensus       243 ~i~~~~~~~DeeNyeEA~~a~~~Af~~~~i~ssv~dil~d~~c~~~~~~s~~FWim~~aLk~Fv~~e~~g~lPL~GtlPD  322 (523)
T KOG2016|consen  243 LIRSEMGKADEENYEEAIKAVNKAFAPTQIPSSVKDILHDDRCAQIGKDSSDFWIMAAALKEFVLKEEGGFLPLRGTLPD  322 (523)
T ss_pred             HHHhcCCCCccccHHHHHHHHHHHhcccCCchhHHHHhcChHHHHhcCCCcHHHHHHHHHHHHHcccCCCccCCCCCCCc
Confidence            999888899999999999999999999999999999997        34678999999999                   


Q ss_pred             ------------hhh-HHHHHhHHHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHhcccceEeeccccccccCCCChhhHh
Q 012484          294 ------------RPW-IFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQ  360 (462)
Q Consensus       294 ------------~iy-~ka~~D~~~~~~~~~~~l~~~g~~~~~i~~~~i~~f~~n~~~~~~i~~~sl~~~~~~p~~~~~~  360 (462)
                                  ++| .||..|...|..+++++++++|+++++||+..++.||+|+..+++++|+++++++. |+..++.
T Consensus       323 M~ssTe~YI~Lq~iY~eKA~~D~~~v~~~v~~vlk~lgr~~~sIs~~~ik~fCkna~~lkv~r~~~~~eey~-~s~~~~~  401 (523)
T KOG2016|consen  323 MTSSTEHYIRLQKIYHEKAEADALEVERRVQEVLKSLGRSPDSISDDVIKLFCKNAAKLKVCRGRTLAEEYE-KSITELI  401 (523)
T ss_pred             cccCHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHhCCCccccCHHHHHHHHhhhhcceeeecchhhhhhc-ccchhhh
Confidence                        899 99999999999999999999999999999999999999999999999999999998 7666666


Q ss_pred             hhhcccchhhHHHHHHHHHHHHHHHHHcCCCCCCCCCCchhhHHHHHHHHHHHHhhcCCCCCCchHHHHHHHHHhCCCcc
Q 012484          361 KYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAEL  440 (462)
Q Consensus       361 ~~~~~~~~~~~~~~~~~l~a~~~F~~~~gr~P~~~~~~~~~D~~~l~~~~~~~~~~~~~~~~~i~~~~v~e~~r~~~~el  440 (462)
                      .+.++++++..+.||++|||+++|..+||+|||  +.+.+.|+..+++++..++.++++++..+.++++.||||++++|+
T Consensus       402 ~~~~~e~~~~~~~~~~~lRavdrfl~~~gk~pG--~~~v~~D~~~lks~a~~~lse~g~~~~~v~d~~i~E~cR~gaaEl  479 (523)
T KOG2016|consen  402 KYSSNENYSNEIGFYLLLRAVDRFLKEKGKYPG--EGPVEIDITKLKSIAASLLSELGLDGNAVTDDAIHEICRFGAAEL  479 (523)
T ss_pred             hhccccccchhHHHHHHHHHHHHHHHHhcCCCC--CCccchhhHHHHHHHHHHHHHhccCcccCcHHHHHHHHhcCCchh
Confidence            777777766788999999999999999999999  456789999999999999999999888899999999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHhc
Q 012484          441 HAVAAFIGGVASQEVIKVVF  460 (462)
Q Consensus       441 ~~vaa~~GGiaaQE~iK~i~  460 (462)
                      |.|+||+||+||||+||+||
T Consensus       480 H~VsAfiGGiaaQEvIKLiT  499 (523)
T KOG2016|consen  480 HVVSAFIGGIAAQEVIKLIT  499 (523)
T ss_pred             HHHHHHHhhHHHHHHHHHHH
Confidence            99999999999999999997

>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd02191 FtsZ FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
1r4m_A529 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 5e-90
1tt5_A531 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 6e-90
1yov_A537 Insights Into The Ubiquitin Transfer Cascade From T 2e-89
3gzn_A534 Structure Of Nedd8-Activating Enzyme In Complex Wit 2e-89
2nvu_A536 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 2e-89
1y8q_A346 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 1e-19
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 7e-14
3cmm_A 1015 Crystal Structure Of The Uba1-Ubiquitin Complex Len 4e-04
4ii2_A 1001 Crystal Structure Of Ubiquitin Activating Enzyme 1 6e-13
3kyd_B 551 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 3e-09
1y8q_B 640 Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex 4e-09
3kyc_B 660 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 5e-09
3dbl_B434 Structural Dissection Of A Gating Mechanism Prevent 6e-07
3dbr_B434 Structural Dissection Of A Gating Mechanism Prevent 6e-07
3dbh_B434 Structural Dissection Of A Gating Mechanism Prevent 7e-07
1r4m_B431 Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com 7e-07
1tt5_B434 Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I 7e-07
3gzn_B463 Structure Of Nedd8-Activating Enzyme In Complex Wit 8e-07
1yov_B444 Insights Into The Ubiquitin Transfer Cascade From T 9e-07
2nvu_B805 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 9e-07
>pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 Back     alignment and structure 
Iteration: 1

 Score =  328 bits (840), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 182/500 (36%), Positives = 275/500 (55%), Gaps = 50/500 (10%)
Query: 5   KTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGD 64
           + KYDRQLR+WG+ GQ ALE A VCL+N   TG+E LKNLVL GIGS T+IDG++V   D
Sbjct: 10  EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGED 69
Query: 65  LGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVAT 124
            GNNF L  S +G+++A++   FLQELN  V   F+EE PE L++ +P FF +FT+VVAT
Sbjct: 70  AGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVAT 129
Query: 125 QLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPW 184
           QL E   ++L  +   + + L+  R+YGL G++RI +KEH V+ES PD+ L+DLRL+ P+
Sbjct: 130 QLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPF 189
Query: 185 PELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTXXXXXXXXXXXXX 244
           PELR+  +++DL+  +   H HTP++VI+ K   +W +   G +P T             
Sbjct: 190 PELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQ 249
Query: 245 XMVAI-DEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEA-- 301
            ++   DE+N++EAI+          I  ++  +    D      +      WI A A  
Sbjct: 250 GILKPEDEENFEEAIKNVNTALNTTQIPSSIEDIFN--DDRCINITKQTPSFWILARALK 307
Query: 302 ----------------------------------------DCLAIEQRVRNNLKKLGREP 321
                                                   D  A+   V   L+ +G+ P
Sbjct: 308 EFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAP 367
Query: 322 ESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSV--PDIQKYLTDEDYSVAMGFYILLR 379
           ESIS+  +K  C N+  L+V R R L +E+   ++   +I   + + D  + +  Y++LR
Sbjct: 368 ESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVL--YLMLR 425
Query: 380 AVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAE 439
           AVDRF      YPG  +  ++EDI +LK+     L + G +   + +D ++E CR+GAAE
Sbjct: 426 AVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLS-VMVKDDYVHEFCRYGAAE 484
Query: 440 LHAVAAFIGGVASQEVIKVV 459
            H +AAF+GG A+QEVIK++
Sbjct: 485 PHTIAAFLGGAAAQEVIKII 504
>pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 Back     alignment and structure
>pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 Back     alignment and structure
>pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 Back     alignment and structure
>pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 Back     alignment and structure
>pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 Back     alignment and structure
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 Back     alignment and structure
>pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 Back     alignment and structure
>pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 Back     alignment and structure
>pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 Back     alignment and structure
>pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 Back     alignment and structure
>pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 Back     alignment and structure
>pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 Back     alignment and structure
>pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 Back     alignment and structure
>pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 Back     alignment and structure
>pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 Back     alignment and structure
>pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 Back     alignment and structure
>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 1e-143
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 4e-67
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 1e-13
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 6e-40
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 3e-25
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 4e-06
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 2e-15
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 1e-10
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 2e-10
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 5e-10
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-09
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 5e-09
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 6e-07
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 4e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-05
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
 Score =  419 bits (1078), Expect = e-143
 Identities = 185/505 (36%), Positives = 287/505 (56%), Gaps = 47/505 (9%)

Query: 1   MAEPKT-----KYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVI 55
           MA+        KYDRQLR+WG+ GQ ALE A VCL+N   TG+E LKNLVL GIGS T+I
Sbjct: 3   MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII 62

Query: 56  DGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFF 115
           DG++V   D GNNF L  S +G+++A++   FLQELN  V   F+EE PE L++ +P FF
Sbjct: 63  DGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF 122

Query: 116 SQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFL 175
            +FT+VVATQL E   ++L  +   + + L+  R+YGL G++RI +KEH V+ES PD+ L
Sbjct: 123 CRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL 182

Query: 176 DDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEK 235
           +DLRL+ P+PELR+  +++DL+  +   H HTP++VI+ K   +W +   G +P T +EK
Sbjct: 183 EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEK 242

Query: 236 REFKELLKSKMVAI-DEDNYKEAIEASFKVFAPPGIKLALSKVLQ--------SADSSFF 286
            +F++L++  ++   DE+N++EAI+          I  ++  +              SF+
Sbjct: 243 EDFRDLIRQGILKPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFW 302

Query: 287 PFSIAIGRPWI--------------------------------FAEADCLAIEQRVRNNL 314
             + A+                                      A+ D  A+   V   L
Sbjct: 303 ILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLL 362

Query: 315 KKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGF 374
           + +G+ PESIS+  +K  C N+  L+V R R L +E+   ++   +   + ++    +  
Sbjct: 363 QSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVL 422

Query: 375 YILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCR 434
           Y++LRAVDRF      YPG  +  ++EDI +LK+     L + G +   + +D ++E CR
Sbjct: 423 YLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLS-VMVKDDYVHEFCR 481

Query: 435 FGAAELHAVAAFIGGVASQEVIKVV 459
           +GAAE H +AAF+GG A+QEVIK++
Sbjct: 482 YGAAEPHTIAAFLGGAAAQEVIKII 506
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.98
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.97
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 99.97
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 99.97
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.96
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.95
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.95
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.51
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.35
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.25
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.25
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.2
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.17
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.04
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.88
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.76
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.69
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.69
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.66
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.5
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.47
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.43
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.37
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.23
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 96.14
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.11
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.03
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.02
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.8
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.78
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.73
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.6
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.44
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.41
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 95.41
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.33
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.28
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.27
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.18
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 95.13
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.06
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.01
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.0
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 94.93
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.88
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.85
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.83
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.64
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.64
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.57
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.55
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.54
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.53
4ezb_A317 Uncharacterized conserved protein; structural geno 94.49
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.43
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.43
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.41
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.4
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.38
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.36
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.35
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.29
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.21
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 94.19
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.14
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.13
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.12
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.04
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.99
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 93.98
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.9
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 93.74
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.72
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.71
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.67
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 93.66
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 93.59
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.57
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.48
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.45
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 93.42
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.4
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 93.33
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.33
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.29
1lnq_A336 MTHK channels, potassium channel related protein; 93.26
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 93.21
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 93.16
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 93.15
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 93.15
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 93.13
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 93.12
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.11
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.02
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.97
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 92.95
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 92.91
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 92.91
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 92.91
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.87
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 92.82
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 92.75
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 92.75
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 92.68
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 92.6
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.59
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.5
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 92.49
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.48
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 92.47
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.43
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.4
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 92.37
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 92.3
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.2
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.15
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 91.99
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 91.98
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 91.93
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 91.92
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 91.84
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 91.81
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 91.78
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 91.73
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.72
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.72
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 91.66
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 91.66
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 91.62
3l6d_A306 Putative oxidoreductase; structural genomics, prot 91.61
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 91.59
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 91.55
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.47
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 91.46
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 91.27
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 91.26
4gx0_A565 TRKA domain protein; membrane protein, ION channel 91.23
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 91.17
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 91.17
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 91.1
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.0
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 90.94
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 90.88
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 90.87
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 90.8
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.79
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 90.61
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 90.59
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.53
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.47
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.47
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 90.44
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 90.36
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 90.18
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 90.18
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 90.17
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.14
2rir_A300 Dipicolinate synthase, A chain; structural genomic 90.14
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 90.14
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 90.13
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 90.11
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 89.95
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 89.84
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.76
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 89.64
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 89.61
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 89.59
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 89.46
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 89.43
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 89.4
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 89.4
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 89.38
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 89.33
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 89.32
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 89.29
4hb9_A412 Similarities with probable monooxygenase; flavin, 89.25
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 89.06
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 89.04
1yb4_A295 Tartronic semialdehyde reductase; structural genom 89.01
2cul_A232 Glucose-inhibited division protein A-related PROT 88.98
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 88.97
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 88.94
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.8
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 88.78
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 88.78
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 88.73
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 88.69
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 88.68
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 88.63
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 88.49
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 88.46
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 88.35
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 88.27
4f6c_A427 AUSA reductase domain protein; thioester reductase 88.23
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 88.22
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 88.17
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 88.15
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 88.1
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 88.09
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 87.97
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 87.94
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 87.93
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 87.8
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 87.78
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 87.76
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.69
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 87.63
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 87.59
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 87.59
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 87.57
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 87.52
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 87.5
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 87.49
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 87.49
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 87.45
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 87.45
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 87.41
3euw_A344 MYO-inositol dehydrogenase; protein structure init 87.36
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 87.29
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 87.28
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 87.26
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 87.22
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.18
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 87.17
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 87.12
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 87.11
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 87.03
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 86.98
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 86.98
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 86.89
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 86.85
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 86.85
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 86.81
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 86.78
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 86.76
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 86.73
3tsc_A277 Putative oxidoreductase; structural genomics, seat 86.7
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 86.69
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 86.67
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 86.66
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 86.64
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 86.43
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 86.42
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 86.37
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 86.34
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 86.26
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 86.24
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 86.2
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 86.16
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 86.14
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 86.12
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 86.09
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 86.04
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 86.03
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 86.01
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 85.93
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 85.88
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 85.83
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 85.73
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 85.73
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 85.7
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 85.65
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 85.63
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 85.63
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 85.62
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 85.58
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 85.58
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 85.54
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 85.52
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 85.5
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 85.46
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.45
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 85.45
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 85.34
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 85.26
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 85.25
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 85.23
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 85.2
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 85.18
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 85.13
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 85.13
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 85.08
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 85.05
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 84.99
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 84.98
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 84.93
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 84.89
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 84.88
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 84.83
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 84.82
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 84.8
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 84.8
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 84.75
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 84.74
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 84.73
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 84.7
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.55
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 84.54
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 84.48
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 84.47
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 84.46
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 84.43
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 84.37
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 84.33
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 84.33
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 84.3
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 84.28
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 84.27
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 84.27
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 84.25
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 84.24
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 84.23
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 84.22
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 84.16
3cxt_A291 Dehydrogenase with different specificities; rossma 84.13
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 84.06
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 84.05
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 84.05
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 84.05
3tjr_A301 Short chain dehydrogenase; structural genomics, se 84.02
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 83.99
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 83.98
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 83.98
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 83.88
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 83.87
3dme_A369 Conserved exported protein; structural genomics, P 83.87
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 83.81
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 83.74
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 83.71
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 83.67
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 83.64
1vpd_A299 Tartronate semialdehyde reductase; structural geno 83.61
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 83.6
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 83.56
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 83.52
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 83.5
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 83.43
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 83.41
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 83.41
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 83.4
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 83.38
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 83.36
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 83.36
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 83.34
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 83.32
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 83.31
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 83.27
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.26
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 83.17
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 83.16
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 83.14
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 83.08
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 83.07
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 83.06
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 83.01
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 82.98
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 82.97
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 82.94
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 82.87
4gx0_A565 TRKA domain protein; membrane protein, ION channel 82.86
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 82.84
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 82.83
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 82.82
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 82.81
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 82.79
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 82.78
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 82.76
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 82.71
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 82.7
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 82.66
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 82.56
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 82.5
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 82.25
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 82.23
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 82.23
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 82.22
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 82.15
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 82.14
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 82.13
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 82.06
3e03_A274 Short chain dehydrogenase; structural genomics, PS 82.03
1ydw_A362 AX110P-like protein; structural genomics, protein 82.02
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 82.0
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 81.96
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 81.96
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 81.92
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 81.84
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 81.83
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 81.82
1iuk_A140 Hypothetical protein TT1466; structural genomics, 81.82
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 81.8
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 81.79
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 81.76
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 81.75
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 81.66
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 81.49
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 81.49
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 81.48
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 81.46
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 81.46
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 81.44
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 81.4
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 81.37
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 81.35
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 81.31
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 81.3
2bry_A497 NEDD9 interacting protein with calponin homology a 81.29
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 81.28
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 81.26
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 81.23
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 81.2
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 81.18
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 81.12
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 81.09
2d59_A144 Hypothetical protein PH1109; COA binding, structur 81.06
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 80.98
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 80.89
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 80.79
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 80.68
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 80.68
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 80.67
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 80.65
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 80.64
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 80.62
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 80.6
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 81.62
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 80.57
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 80.44
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 80.43
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 80.35
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 80.28
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 80.23
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 80.2
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 80.19
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 80.15
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 80.11
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
Probab=100.00  E-value=7.5e-91  Score=731.57  Aligned_cols=454  Identities=40%  Similarity=0.741  Sum_probs=413.2

Q ss_pred             cchhhhHHhhcCHHHHHHHhcCcEEEEcCChhHHHHHHHHHHhCCCeEEEEeCCcccccCCCcccccccccccccHHHHH
Q 012484            5 KTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSV   84 (462)
Q Consensus         5 ~~rYdRQl~l~G~~~q~~L~~~~VlivG~g~lG~eiaknLvl~Gv~~itlvD~d~v~~~nl~r~f~~~~~dvG~~Ka~~~   84 (462)
                      .+|||||+++||.++|++|++++|+|||+||+|+++||||+++|||+|||+|+|.|+.+||+|||+++.+|||++||+++
T Consensus        12 ~~rY~Rqi~l~G~~~q~~L~~~~VlvvG~GGlGseiak~La~aGVg~itlvD~D~Ve~sNL~RQ~l~~~~dvG~~Ka~~a   91 (531)
T 1tt5_A           12 EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAA   91 (531)
T ss_dssp             HHHTHHHHHHHHHHHHHHHHHCEEEEECCSHHHHHHHHHHHTTTCSEEEEECCCBBCHHHHHHCTTCCGGGBTSBHHHHH
T ss_pred             HHHhhHHHHhcCHHHHHHHhcCeEEEECcCHHHHHHHHHHHHcCCCeEEEEeCCEechhhcccCccCChhhcCcHHHHHH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCCeEEEEecChhhhhcCCcCCCCCCcEEEEcCCChHHHHHHHHHHHHcCceEEEEeeccceEEEEEEeCCc
Q 012484           85 CAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEH  164 (462)
Q Consensus        85 ~~~l~~lNp~v~v~~~~~~~~~~~~~~~~~~~~~dvVi~~~~~~~~~~~l~~~~~~~~ip~i~~~~~G~~G~v~~~~~~h  164 (462)
                      +++|+++||+|+++.+......+.+...+++++||+||+|.++...+..++++|+.+++|+|.+++.|++|++++++|+|
T Consensus        92 ~~~l~~lNp~v~v~~~~~~~~~~~~~~~~~~~~~DvVi~~~d~~~~r~~ln~~c~~~~iplI~~~~~G~~G~v~~~~p~~  171 (531)
T 1tt5_A           92 MEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEH  171 (531)
T ss_dssp             HHHHHTTCTTSBCCEESSCHHHHHHSCGGGGGGCSEEEEESCCHHHHHHHHHHHHHTTCCEEEEEEETTEEEEEEECSCE
T ss_pred             HHHHHHhCCCCeEEEeCCCcchhhhhhHHHhcCCCEEEEeCCCHHHHHHHHHHHHHcCCCEEEEEecCCeEEEEEEcCCc
Confidence            99999999999999888766655455678899999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCCCCCCCcccCCCCchhhhhhhcccCCCCCCCccCCCcHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHh
Q 012484          165 TVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKS  244 (462)
Q Consensus       165 ~~~~~~~~~~~~~lrl~~p~p~l~~~~~~~d~~~~~~~~~~~~P~~v~l~~~~~~~~~~~~g~~p~~~~~~~~f~~~~~~  244 (462)
                      ++++.+|+...+++|+.+|||++.+++.++|.+.++...++|+|++++++++++.||..|+|+.|+++.++.+|++++.+
T Consensus       172 ~~~d~~~~~~~~~lr~~~p~P~~~~~~~~~~~~~~~~~~~~~~p~vv~~~~ale~~k~~~~g~~P~~~~~~~~f~~~i~~  251 (531)
T 1tt5_A          172 PVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQ  251 (531)
T ss_dssp             EESCCCCSSCCCCCCSSSCCHHHHHHHHTCC-------CGGGSCHHHHHHHHHHHHTTTTCCCCCCHHHHHHHHHHHHHH
T ss_pred             eeccCCCCCCCCcccccCCCCCchhhhhccCcccccCCCcCCchHHHHHHHHHHHHHHhcCCCCCCchhhHHHHHHHHHh
Confidence            99999998888999999999999999999999988999999999999999999999999999999999999999999999


Q ss_pred             cccC-CCCCCHHHHHHHhhcccCCCCccHHHHHHHh--------cCCCChhHHHHHhh----------------------
Q 012484          245 KMVA-IDEDNYKEAIEASFKVFAPPGIKLALSKVLQ--------SADSSFFPFSIAIG----------------------  293 (462)
Q Consensus       245 ~~~~-~~~~nf~EA~~~~~~~~~~~~i~~~i~~~~~--------~~~~~f~~l~~al~----------------------  293 (462)
                      +|+. .+++||+||+++++++++|+++|++++++|+        ..++.||++++||+                      
T Consensus       252 ~~~~~~~e~N~~Ea~~~~~~~~~~~~i~~~v~~~~~~~~~~~~~~~s~~Fwil~~alk~F~~~~~~g~lPl~g~ipDm~s  331 (531)
T 1tt5_A          252 GILKPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIA  331 (531)
T ss_dssp             TTSSCTTHHHHHHHHHHHHHHSCCCCCCHHHHHHHTSHHHHSCCSSCCHHHHHHHHHHHHHHTTTTTSCCCCCCCCCCSS
T ss_pred             hcccCccccchHHHHHHHHhhcCCccCcHHHHHHhcccccccccCCCchHHHHHHHHHHHHHhcCCCCCCCCCccCcccc
Confidence            8855 4678999999999999999999999999996        23578999999986                      


Q ss_pred             ---------hhh-HHHHHhHHHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHhcccceEeeccccccccCCCChhhHhhhh
Q 012484          294 ---------RPW-IFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYL  363 (462)
Q Consensus       294 ---------~iy-~ka~~D~~~~~~~~~~~l~~~g~~~~~i~~~~i~~f~~n~~~~~~i~~~sl~~~~~~p~~~~~~~~~  363 (462)
                               ++| +||.+|++.|..+++++++++|+++..|+...++.||||.+.++++++++|++++..|..+. ....
T Consensus       332 ~t~~Y~~lq~iy~~ka~~D~~~v~~~v~~~~~~~~~~~~~i~~~~i~~f~kn~~~l~~i~~~~l~~~~~~~~~~~-~~~~  410 (531)
T 1tt5_A          332 DSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINK-DEII  410 (531)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSSSCHHHHHHHHHTGGGCEEECCCCHHHHHSTTTSCH-HHHH
T ss_pred             chhcccchHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcCCHHHHHHHHhchhhhhcccccchHhhhccccchh-hhhh
Confidence                     789 99999999999999999999999889999999999999999999999999999998875422 0112


Q ss_pred             ccc-chhhHHHHHHHHHHHHHHHHHcCCCCCCCCCCchhhHHHHHHHHHHHHhhcCCCCCCchHHHHHHHHHhCCCcchh
Q 012484          364 TDE-DYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHA  442 (462)
Q Consensus       364 ~~~-~~~~~~~~~~~l~a~~~F~~~~gr~P~~~~~~~~~D~~~l~~~~~~~~~~~~~~~~~i~~~~v~e~~r~~~~el~~  442 (462)
                      .+. +.+++..||++|||+++|.++|||+|++++.+.++|+++|.+++++++++.++. +.+++++++|++|++++||||
T Consensus       411 ~~~~~~~~~~~~~~~~~al~~f~~~~gr~P~~~~~~~~~D~~~l~~~~~~~~~~~~~~-~~~~~~~~~e~~r~~~~el~p  489 (531)
T 1tt5_A          411 SSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLS-VMVKDDYVHEFCRYGAAEPHT  489 (531)
T ss_dssp             HHTTSTTSTHHHHHHHHHHHHHHHHHSSCTTCSTTTHHHHHHHHHHHHHHHHHHHTCC-CCCCHHHHHHHHHTTTCCCHH
T ss_pred             hhhhccccchHHHHHHHHHHHHHHHhCCCCCccccchHHHHHHHHHHHHHHHHhcCCc-ccccHHHHHHHHHhcCCCcCH
Confidence            232 235678999999999999999999999877667899999999999999888764 568899999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhc
Q 012484          443 VAAFIGGVASQEVIKVVF  460 (462)
Q Consensus       443 vaa~~GGiaaQE~iK~i~  460 (462)
                      ||||+||+|||||||+||
T Consensus       490 vaA~~GGi~AQEviK~iT  507 (531)
T 1tt5_A          490 IAAFLGGAAAQEVIKIIT  507 (531)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHc
Confidence            999999999999999997
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 462
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 1e-148
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 7e-22
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 2e-15
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  431 bits (1109), Expect = e-148
 Identities = 181/499 (36%), Positives = 284/499 (56%), Gaps = 47/499 (9%)

Query: 7   KYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLG 66
           KYDRQLR+WG+ GQ ALE A VCL+N   TG+E LKNLVL GIGS T+IDG++V   D G
Sbjct: 7   KYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAG 66

Query: 67  NNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQL 126
           NNF L  S +G+++A++   FLQELN  V   F+EE PE L++ +P FF +FT+VVATQL
Sbjct: 67  NNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQL 126

Query: 127 GEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPE 186
            E   ++L  +   + + L+  R+YGL G++RI +KEH V+ES PD+ L+DLRL+ P+PE
Sbjct: 127 PESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPE 186

Query: 187 LRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKM 246
           LR+  +++DL+  +   H HTP++VI+ K   +W +   G +P T +EK +F++L++  +
Sbjct: 187 LREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGI 246

Query: 247 VAI------DEDNYKEAIEASFKVFAPPGIKLALSKVLQ-------SADSSFFPFSIAIG 293
           +        DE+N++EAI+          I  ++  +         +  +  F       
Sbjct: 247 LKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARAL 306

Query: 294 RPWIF---------------------------------AEADCLAIEQRVRNNLKKLGRE 320
           + ++                                  A+ D  A+   V   L+ +G+ 
Sbjct: 307 KEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQA 366

Query: 321 PESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRA 380
           PESIS+  +K  C N+  L+V R R L +E+   ++   +   + ++    +  Y++LRA
Sbjct: 367 PESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRA 426

Query: 381 VDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAEL 440
           VDRF      YPG  +  ++EDI +LK+     L + G +   + +D ++E CR+GAAE 
Sbjct: 427 VDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLS-VMVKDDYVHEFCRYGAAEP 485

Query: 441 HAVAAFIGGVASQEVIKVV 459
           H +AAF+GG A+QEVIK++
Sbjct: 486 HTIAAFLGGAAAQEVIKII 504
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.8
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.38
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.26
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.01
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.98
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.97
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.9
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.88
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.68
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.53
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.53
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.48
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.45
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.41
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.4
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.33
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.31
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.27
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.27
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.2
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.92
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.91
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.9
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.87
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.74
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.73
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.7
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.61
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.56
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.55
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.49
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.48
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.44
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 95.42
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.35
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.35
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.18
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.03
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.02
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.0
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.96
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.88
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.84
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.82
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.8
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.71
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 94.69
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.67
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.62
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.46
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.44
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.41
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.37
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.11
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.08
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.99
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.96
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.9
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 93.9
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.88
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.82
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.81
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.79
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 93.74
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 93.73
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.66
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.63
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.52
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 93.42
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.32
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.15
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.04
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.03
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.96
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.91
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 92.84
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.81
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.79
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.78
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.7
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.55
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 92.54
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 92.52
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.48
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.39
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.17
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.85
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 91.62
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 91.61
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.58
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.3
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.22
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 91.18
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.11
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.09
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.01
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 90.92
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 90.85
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 90.78
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 90.66
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 90.53
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 90.48
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 90.26
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.24
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.2
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.2
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.0
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 89.9
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 89.88
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 89.84
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.83
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.71
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.64
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 89.63
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.55
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 89.54
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 89.5
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 89.46
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 89.42
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.3
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.19
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.1
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 89.04
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 88.6
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.59
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 88.49
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 88.38
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.36
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 88.35
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 88.3
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.29
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 87.9
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.83
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.75
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.71
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 87.61
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.5
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.41
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 87.35
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.33
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 87.2
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 87.07
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.05
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 86.99
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 86.97
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.8
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.72
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 86.66
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 86.62
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 86.5
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.32
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.28
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.2
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.16
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 86.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 85.99
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 85.91
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 85.81
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 85.7
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.55
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 85.43
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 85.38
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 85.25
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 85.12
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 84.99
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 84.88
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 84.8
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 84.75
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 84.49
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 84.38
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 84.32
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 84.31
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 84.31
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 84.15
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 84.15
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 84.07
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.0
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 83.95
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.78
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 83.6
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 83.56
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.36
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 83.1
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 83.09
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 82.96
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 82.77
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 82.71
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 82.67
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 82.61
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.5
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 82.46
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 82.31
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 82.15
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 82.06
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 82.03
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 82.03
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 81.91
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 81.84
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 81.82
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 81.75
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 81.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 81.45
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 81.44
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 81.41
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 81.15
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.94
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 80.89
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 80.83
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 80.71
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 80.58
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 80.47
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 80.35
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 80.32
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-96  Score=773.40  Aligned_cols=456  Identities=40%  Similarity=0.728  Sum_probs=423.6

Q ss_pred             ccchhhhHHhhcCHHHHHHHhcCcEEEEcCChhHHHHHHHHHHhCCCeEEEEeCCcccccCCCcccccccccccccHHHH
Q 012484            4 PKTKYDRQLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKS   83 (462)
Q Consensus         4 ~~~rYdRQl~l~G~~~q~~L~~~~VlivG~g~lG~eiaknLvl~Gv~~itlvD~d~v~~~nl~r~f~~~~~dvG~~Ka~~   83 (462)
                      +++|||||+||||.+||++|++++|+|+|+||+|+|+||||+|+|||+|||+|+|.|+.+||+||||++++|+|++||++
T Consensus         4 ke~rYdRQlrlwG~~gQ~~L~~s~VlvvG~gglG~Ei~knLvl~GVg~itivD~d~v~~sdL~rqf~~~~~diGk~ka~~   83 (529)
T d1yova1           4 KEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEA   83 (529)
T ss_dssp             HHHHTHHHHHHHHHHHHHHHHHCEEEECCCSHHHHHHHHHHHTTTCSEEEEECCSBCCHHHHHHCTTCCGGGTTSBHHHH
T ss_pred             hhhhhhHHHHhhhHHHHHHHhCCCEEEECCCHHHHHHHHHHHHhcCCEEEEEcCCcCChhhcCchhcCChhhCCCHHHHH
Confidence            56899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCeEEEEecChhhhhcCCcCCCCCCcEEEEcCCChHHHHHHHHHHHHcCceEEEEeeccceEEEEEEeCC
Q 012484           84 VCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKE  163 (462)
Q Consensus        84 ~~~~l~~lNp~v~v~~~~~~~~~~~~~~~~~~~~~dvVi~~~~~~~~~~~l~~~~~~~~ip~i~~~~~G~~G~v~~~~~~  163 (462)
                      ++++|+++||+|+++.+...+.++.+.+++++.+||+||+|.++...+..++++|+++++|+|.+++.|++|++|+++++
T Consensus        84 ~~~~L~~lNp~v~i~~~~~~~~~~~~~~~~~~~~~dvVv~~~~~~~~~~~l~~~c~~~~ip~i~~~~~G~~G~v~~~~~~  163 (529)
T d1yova1          84 AMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKE  163 (529)
T ss_dssp             HHHHHHTTCTTSBCCEESSCHHHHHHSCGGGGGGCSEEEEESCCHHHHHHHHHHHHHHTCCEEEEEEETTEEEEEEECSC
T ss_pred             HHHHHHHhCCCCcEEEEcCCchhhhhhHHHHhcCCCEEEECCCCHHHHHHHHHHHHHcCCCEEEEeccCCEEEEEEEeCC
Confidence            99999999999999999888888877788999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeecCCCCCCCCcccCCCCchhhhhhhcccCCCCCCCccCCCcHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHH
Q 012484          164 HTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLK  243 (462)
Q Consensus       164 h~~~~~~~~~~~~~lrl~~p~p~l~~~~~~~d~~~~~~~~~~~~P~~v~l~~~~~~~~~~~~g~~p~~~~~~~~f~~~~~  243 (462)
                      |+++++||+...+|||+.+|||+|.++++++|++.+++..|+|+||++++++++++|+..|+|..|+++.++.+|++++.
T Consensus       164 ~~~~e~~p~~~~~dlrl~~p~p~l~~~~~~~d~~~~~~~~~~~vP~~vil~~~l~~~~~~~~g~~p~~~~ek~~~k~~i~  243 (529)
T d1yova1         164 HPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIR  243 (529)
T ss_dssp             EEESCCCCSSCCCCCCSSSCCHHHHHHHHTCCSSSSCHHHHTTSCHHHHHHHHHHHHHHHTCCCCCCTTTHHHHHHHHHH
T ss_pred             ceEEecCCCCCCCccccCCCcHHHHHHHhhcCcccCCccccCcCchHHHHHHHHHHHHHhcCCCCCCcHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hcccC------CCCCCHHHHHHHhhcccCCCCccHHHHHHHh--------cCCCChhHHHHHhh----------------
Q 012484          244 SKMVA------IDEDNYKEAIEASFKVFAPPGIKLALSKVLQ--------SADSSFFPFSIAIG----------------  293 (462)
Q Consensus       244 ~~~~~------~~~~nf~EA~~~~~~~~~~~~i~~~i~~~~~--------~~~~~f~~l~~al~----------------  293 (462)
                      .++..      .+++||+||++++++++.++.+|++++++|+        ..+++||++++||+                
T Consensus       244 ~~~~~~~~~~~~~eeNf~EA~~~~~~~~~~~~ip~~i~~ll~~~~~~~~~~~s~~Fw~l~~alk~F~~~~~~g~lPl~g~  323 (529)
T d1yova1         244 QGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGT  323 (529)
T ss_dssp             TSSCBCTTSSBCCCHHHHHHHHHHHHHSSCCSCCHHHHHHHTSHHHHSCCSSCCHHHHHHHHHHHHHHTTTSSSCCCCCC
T ss_pred             hhhhcccccCCCccccHHHHHHHHHHhhCCCCCCHHHHHHhcCcccccCCCCCccHHHHHHHHHHHHHhcCCCCCCCCCC
Confidence            87754      3678999999999999999999999999996        24678999999987                


Q ss_pred             ---------------hhh-HHHHHhHHHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHhcccceEeeccccccccCCCChh
Q 012484          294 ---------------RPW-IFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVP  357 (462)
Q Consensus       294 ---------------~iy-~ka~~D~~~~~~~~~~~l~~~g~~~~~i~~~~i~~f~~n~~~~~~i~~~sl~~~~~~p~~~  357 (462)
                                     ++| .|+..|+..|..+++++++.+|+.++.|++..++.||||++.+++++|+++.+++..+...
T Consensus       324 lPDm~s~t~~Yi~Lq~iY~~Ka~~D~~~~~~~v~~~l~~~~~~~~~i~~~~i~~F~kn~~~l~~~~~~~l~~e~~~~~~~  403 (529)
T d1yova1         324 IPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTIN  403 (529)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSSSCHHHHHHHHHTTTSCEEECCCCHHHHHCTTTSC
T ss_pred             CCCcccChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCcCCHHHHHHHHhhhhhcceeccCchHhhhcccccc
Confidence                           688 8999999999999999999999999999999999999999999999999999988765432


Q ss_pred             hHhhhhcccchhhHHHHHHHHHHHHHHHHHcCCCCCCCCCCchhhHHHHHHHHHHHHhhcCCCCCCchHHHHHHHHHhCC
Q 012484          358 DIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGA  437 (462)
Q Consensus       358 ~~~~~~~~~~~~~~~~~~~~l~a~~~F~~~~gr~P~~~~~~~~~D~~~l~~~~~~~~~~~~~~~~~i~~~~v~e~~r~~~  437 (462)
                      ........++..+++.||++|||+++|.++|||+||+++.+.++|..++..++.+++++.+++. .+++++++|+||+++
T Consensus       404 ~~~l~~~~~~~~~~~~l~~~~~a~~~f~~~~~r~P~~~~~~~~~d~~~l~~~~~~~~~~~~~~~-~~~~~~i~e~~r~~~  482 (529)
T d1yova1         404 KDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSV-MVKDDYVHEFCRYGA  482 (529)
T ss_dssp             HHHHHHHTTSTTSTHHHHHHHHHHHHHHHHSSSCTTSSTTTHHHHHHHHHHHHHHHHHHHTCCC-CCCHHHHHHHHHTTT
T ss_pred             hhHHhhhhhcccchHHHHHHHHHHHHHHHHhCCCCCCccchhHhHHHHHHHHHHHHhhhccccc-cchHHHHHHHHHHcC
Confidence            2111111223345689999999999999999999999887778999999999999999988754 578999999999999


Q ss_pred             CcchhHHHHHHHHHHHHHHHHhc
Q 012484          438 AELHAVAAFIGGVASQEVIKVVF  460 (462)
Q Consensus       438 ~el~~vaa~~GGiaaQE~iK~i~  460 (462)
                      ++|||||||+||||||||||+||
T Consensus       483 ~el~~vaA~~GGiaaQEviK~iT  505 (529)
T d1yova1         483 AEPHTIAAFLGGAAAQEVIKIIT  505 (529)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcccHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999997
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure